Search Results

Search found 11318 results on 453 pages for 'josh close'.

Page 442/453 | < Previous Page | 438 439 440 441 442 443 444 445 446 447 448 449  | Next Page >

  • ORA-06502: PL/SQL: numeric or value error: character string buffer too small with Oracle aggregate f

    - by Tunde
    Good day gurus, I have a script that populates tables on a regular basis that crashed and gave the above error. The strange thing is that it has been running for close to 3 months on the production system with no problems and suddenly crashed last week. There has not been any changes on the tables as far as I know. Has anyone encountered something like this before? I believe it has something to do with the aggregate functions I'm implementing in it; but it worked initially. please; kindly find attached the part of the script I've developed into a procedure that I reckon gives the error. CREATE OR REPLACE PROCEDURE V1 IS --DECLARE v_a VARCHAR2(4000); v_b VARCHAR2(4000); v_c VARCHAR2(4000); v_d VARCHAR2(4000); v_e VARCHAR2(4000); v_f VARCHAR2(4000); v_g VARCHAR2(4000); v_h VARCHAR2(4000); v_i VARCHAR2(4000); v_j VARCHAR2(4000); v_k VARCHAR2(4000); v_l VARCHAR2(4000); v_m VARCHAR2(4000); v_n NUMBER(10); v_o VARCHAR2(4000); -- -- Procedure that populates DEMO table BEGIN -- Delete all from the DEMO table DELETE FROM DEMO; -- Populate fields in DEMO from DEMOV1 INSERT INTO DEMO(ID, D_ID, CTR_ID, C_ID, DT_NAM, TP, BYR, ENY, ONG, SUMM, DTW, REV, LD, MD, STAT, CRD) SELECT ID, D_ID, CTR_ID, C_ID, DT_NAM, TP, TO_NUMBER(TO_CHAR(BYR,'YYYY')), TO_NUMBER(TO_CHAR(NVL(ENY,SYSDATE),'YYYY')), CASE WHEN ENY IS NULL THEN 'Y' ELSE 'N' END, SUMMARY, DTW, REV, LD, MD, '1', SYSDATE FROM DEMOV1; -- LOOP THROUGH DEMO TABLE FOR j IN (SELECT ID, CTR_ID, C_ID FROM DEMO) LOOP Select semic_concat(TXTDESC) INTO v_a From GEOT WHERE ID = j.ID; SELECT COUNT(*) INTO v_n FROM MERP M, PROJ P WHERE M.MID = P.COD AND ID = j.ID AND PROAC IS NULL; IF (v_n > 0) THEN Select semic_concat(PRO) INTO v_b FROM MERP M, PROJ P WHERE M.MID = P.COD AND ID = j.ID; ELSE Select semic_concat(PRO || '(' || PROAC || ')' ) INTO v_b FROM MERP M, PROJ P WHERE M.MID = P.COD AND ID = j.ID; END IF; Select semic_concat(VOCNAME('P02',COD)) INTO v_c From PAR WHERE ID = j.ID; Select semic_concat(VOCNAME('L05',COD)) INTO v_d From INST WHERE ID = j.ID; Select semic_concat(NVL(AUTHOR,'Anon') ||' ('||to_char(PUB,'YYYY')||') '||TITLE||', '||EDT) INTO v_e From REFE WHERE ID = j.ID; Select semic_concat(NAM) INTO v_f FROM EDM E, EDO EO WHERE E.EDMID = EO.EDOID AND ID = j.ID; Select semic_concat(VOCNAME('L08', COD)) INTO v_g FROM AVA WHERE ID = j.ID; SELECT or_concat(NAM) INTO v_o FROM CON WHERE ID = j.ID AND NAM = 'Unknown'; IF (v_o = 'Unknown') THEN Select or_concat(JOBTITLE || ' (' || EMAIL || ')') INTO v_h FROM CON WHERE ID = j.ID; ELSE Select or_concat(NAM || ' (' || EMAIL || ')') INTO v_h FROM CON WHERE ID = j.ID; END IF; Select commaencap_concat(COD) INTO v_i FROM PAR WHERE ID = j.ID; IF (v_i = ',') THEN v_i := null; ELSE Select commaencap_concat(COD) INTO v_i FROM PAR WHERE ID = j.ID; END IF; Select commaencap_concat(COD) INTO v_j FROM INST WHERE ID = j.ID; IF (v_j = ',') THEN v_j := null; ELSE Select commaencap_concat(COD) INTO v_j FROM INST WHERE ID = j.ID; END IF; Select commaencap_concat(COD) INTO v_k FROM SAR WHERE ID = j.ID; IF (v_k = ',') THEN v_k := null; ELSE Select commaencap_concat(COD) INTO v_k FROM SAR WHERE ID = j.ID; END IF; Select commaencap_concat(CONID) INTO v_l FROM CON WHERE ID = j.ID; IF (v_l = ',') THEN v_l := null; ELSE Select commaencap_concat(CONID) INTO v_l FROM CON WHERE ID = j.ID; END IF; Select commaencap_concat(PROID) INTO v_m FROM PRO WHERE ID = j.ID; IF (v_m = ',') THEN v_m := null; ELSE Select commaencap_concat(PROID) INTO v_m FROM PRO WHERE ID = j.ID; END IF; -- UPDATE DEMO TABLE UPDATE DEMO SET GEOC = v_a, PRO = v_b, PAR = v_c, INS = v_d, REFER = v_e, ORGR = v_f, AVAY = v_g, CON = v_h, DTH = v_i, INST = v_j, SA = v_k, CC = v_l, EDPR = v_m, CTR = (SELECT NAM FROM EDM WHERE EDMID = j.CTR_ID), COLL = (SELECT NAM FROM EDM WHERE EDMID = j.C_ID) WHERE ID = j.ID; END LOOP; END V1; / The aggregate functions, commaencap_concat (encapsulates with a comma), or_concat (concats with an or) and semic_concat(concats with a semi-colon). the remaining tables used are all linked to the main table DEMO. I have checked the column sizes and there seems to be no problem. I tried executing the SELECT statements alone and they give the same error without populating the tables. Any clues? Many thanks for your anticipated support.

    Read the article

  • Calling Status Bar notification from method from other class.

    - by Jez Fischer
    Firstly, I am new to both android and Java. I have two classes, my main.class and Note.class. I am calling the notification method from my Note.class in my main.class when i press a button. The issue is with this line from the Note.class : PendingIntent contentIntent = PendingIntent.getActivity(this, 0, notificationIntent, 0); notification.setLatestEventInfo(context, contentTitle, contentText, contentIntent); When the method is called it force closes. I believe the problem to be with the "this" in PendingIntent.getActivity(this, 0, notificationIntent, 0);, but I am unsure what to change it to. The notification code works fine if it's in the main class. I would be very grateful for any guidance. Edit: Main class : http://pastebin.com/05Yx0a48 Note.class : package com.adamblanchard.remindme.com.adamblanchard; import com.adamblanchard.remindme.R; import android.app.Activity; import android.app.Notification; import android.app.NotificationManager; import android.app.PendingIntent; import android.content.Context; import android.content.Intent; import android.os.Bundle; public class Note extends Activity { public CharSequence note = "not changed"; int HELLO_ID = 1; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); setTitle("Remind Me!"); } //Notification Method public void callNotification() { // TODO Auto-generated method stub String ns = Context.NOTIFICATION_SERVICE; final NotificationManager mNotificationManager = (NotificationManager) getSystemService(ns); int icon = R.drawable.launcher; CharSequence tickerText = "Remind Me!"; long when = System.currentTimeMillis(); final Notification notification = new Notification(icon, tickerText, when); notification.flags |= Notification.FLAG_AUTO_CANCEL; final Context context = getApplicationContext(); CharSequence contentTitle = "Remind Me!"; CharSequence contentText = note; Intent notificationIntent = new Intent(context, AndroidNotifications.class); PendingIntent contentIntent = PendingIntent.getActivity(this, 0, notificationIntent, 0); notification.setLatestEventInfo(context, contentTitle, contentText, contentIntent); mNotificationManager.notify(HELLO_ID, notification); HELLO_ID++; } } Debug Output : Thread [<1 main] (Suspended (exception IllegalStateException)) Note(Activity).getSystemService(String) line: 3536 Note.callNotification() line: 37 remindme$1$1.onClick(DialogInterface, int) line: 72 AlertDialog(AlertController$ButtonHandler).handleMessage(Message) line: 159 AlertController$ButtonHandler(Handler).dispatchMessage(Message) line: 99 Looper.loop() line: 123 ActivityThread.main(String[]) line: 3647 Method.invokeNative(Object, Object[], Class, Class[], Class, int, boolean) line: not available [native method] Method.invoke(Object, Object...) line: 507 ZygoteInit$MethodAndArgsCaller.run() line: 839 ZygoteInit.main(String[]) line: 597 NativeStart.main(String[]) line: not available [native method] This is the debug output I get, plus a force close popup on the device. Edit2: Manifest xml: <?xml version="1.0" encoding="utf-8"?> <manifest xmlns:android="http://schemas.android.com/apk/res/android" package="com.adamblanchard.remindme" android:versionCode="3" android:versionName="0.7"> <application android:label="@string/app_name" android:icon="@drawable/ic_launcher72"> <activity android:name=".com.adamblanchard.remindme" android:label="@string/app_name"> <intent-filter> <action android:name="android.intent.action.MAIN" /> <category android:name="android.intent.category.LAUNCHER" /> </intent-filter> </activity> <activity android:name=".Note"> <intent-filter> <action android:name="Note" /> <category android:name="android.intent.category.DEFAULT"/> </intent-filter> </activity> </application> <uses-sdk android:minSdkVersion="1"></uses-sdk> </manifest> Stack traces (Are these what you mean?): Thread [<1> main] (Suspended (exception ActivityNotFoundException)) Instrumentation.checkStartActivityResult(int, Object) line: 1404 Instrumentation.execStartActivity(Context, IBinder, IBinder, Activity, Intent, int) line: 1378 remindme(Activity).startActivityForResult(Intent, int) line: 2827 remindme(Activity).startActivity(Intent) line: 2933 remindme$1$1.onClick(DialogInterface, int) line: 82 AlertDialog(AlertController$ButtonHandler).handleMessage(Message) line: 159 AlertController$ButtonHandler(Handler).dispatchMessage(Message) line: 99 Looper.loop() line: 123 ActivityThread.main(String[]) line: 3647 Method.invokeNative(Object, Object[], Class, Class[], Class, int, boolean) line: not available [native method] Method.invoke(Object, Object...) line: 507 ZygoteInit$MethodAndArgsCaller.run() line: 839 ZygoteInit.main(String[]) line: 597 NativeStart.main(String[]) line: not available [native method]

    Read the article

  • Convert PDF to Image Batch

    - by tro
    I am working on a solution where I can convert pdf files to images. I am using the following example from codeproject: http://www.codeproject.com/Articles/317700/Convert-a-PDF-into-a-series-of-images-using-Csharp?msg=4134859#xx4134859xx now I tried with the following code to generate from more then 1000 pdf files new images: using Cyotek.GhostScript; using Cyotek.GhostScript.PdfConversion; using System; using System.Collections.Generic; using System.Drawing; using System.IO; using System.Linq; using System.Text; using System.Threading.Tasks; namespace RefClass_PDF2Image { class Program { static void Main(string[] args) { string outputPath = Properties.Settings.Default.outputPath; string pdfPath = Properties.Settings.Default.pdfPath; if (!Directory.Exists(outputPath)) { Console.WriteLine("Der angegebene Pfad " + outputPath + " für den Export wurde nicht gefunden. Bitte ändern Sie den Pfad (outputPath) in der App.Config Datei."); return; } else { Console.WriteLine("Output Pfad: " + outputPath + " gefunden."); } if (!Directory.Exists(pdfPath)) { Console.WriteLine("Der angegebene Pfad " + pdfPath + " zu den PDF Zeichnungen wurde nicht gefunden. Bitte ändern Sie den Pfad (pdfPath) in der App.Config Datei."); return; } else { Console.WriteLine("PDF Pfad: " + pdfPath + " gefunden."); } Pdf2ImageSettings settings = GetPDFSettings(); DateTime start = DateTime.Now; TimeSpan span; Console.WriteLine(""); Console.WriteLine("Extraktion der PDF Zeichnungen wird gestartet: " + start.ToShortTimeString()); Console.WriteLine(""); DirectoryInfo diretoryInfo = new DirectoryInfo(pdfPath); DirectoryInfo[] directories = diretoryInfo.GetDirectories(); Console.WriteLine(""); Console.WriteLine("Es wurden " + directories.Length + " verschiedende Verzeichnisse gefunden."); Console.WriteLine(""); List<string> filenamesPDF = Directory.GetFiles(pdfPath, "*.pdf*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); List<string> filenamesOutput = Directory.GetFiles(outputPath, "*.*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); Console.WriteLine(""); Console.WriteLine("Es wurden " + filenamesPDF.Count + " verschiedende PDF Zeichnungen gefunden."); Console.WriteLine(""); List<string> newFileNames = new List<string>(); int cutLength = pdfPath.Length; for (int i = 0; i < filenamesPDF.Count; i++) { string temp = filenamesPDF[i].Remove(0, cutLength); temp = outputPath + temp; temp = temp.Replace("pdf", "jpg"); newFileNames.Add(temp); } for (int i = 0; i < filenamesPDF.Count; i++) { FileInfo fi = new FileInfo(newFileNames[i]); if (!fi.Exists) { if (!Directory.Exists(fi.DirectoryName)) { Directory.CreateDirectory(fi.DirectoryName); } Bitmap firstPage = new Pdf2Image(filenamesPDF[i], settings).GetImage(); firstPage.Save(newFileNames[i], System.Drawing.Imaging.ImageFormat.Jpeg); firstPage.Dispose(); } //if (i % 20 == 0) //{ // GC.Collect(); // GC.WaitForPendingFinalizers(); //} } Console.ReadLine(); } private static Pdf2ImageSettings GetPDFSettings() { Pdf2ImageSettings settings; settings = new Pdf2ImageSettings(); settings.AntiAliasMode = AntiAliasMode.Medium; settings.Dpi = 150; settings.GridFitMode = GridFitMode.Topological; settings.ImageFormat = ImageFormat.Png24; settings.TrimMode = PdfTrimMode.CropBox; return settings; } } } unfortunately, I always get in the Pdf2Image.cs an out of memory exception. here the code: public Bitmap GetImage(int pageNumber) { Bitmap result; string workFile; //if (pageNumber < 1 || pageNumber > this.PageCount) // throw new ArgumentException("Page number is out of bounds", "pageNumber"); if (pageNumber < 1) throw new ArgumentException("Page number is out of bounds", "pageNumber"); workFile = Path.GetTempFileName(); try { this.ConvertPdfPageToImage(workFile, pageNumber); using (FileStream stream = new FileStream(workFile, FileMode.Open, FileAccess.Read)) { result = new Bitmap(stream); // --->>> here is the out of memory exception stream.Close(); stream.Dispose(); } } finally { File.Delete(workFile); } return result; } how can I fix that to avoid this exception? thanks for any help, tro

    Read the article

  • jQuery CSS Custom Flyout Menu Styling Issue

    - by aherrick
    I'm close to nailing this flyout menu I have been working on, just have a couple of current pain points. I'm trying to get left/right padding on my submenu items, as you can see I am not quite there. Also when the first submenu is displayed, I want to create a bit of a gap between the first row of list items and the child. Below is my current code and a screen shot displaying what I want. Based on my current CSS, any thoughts on how to get this done in a clean way? <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <title></title> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4.2/jquery.min.js"></script> <script type="text/javascript"> function mainmenu() { $("#nav ul").css({ display: "none" }); // Opera Fix $("#nav li").hover(function() { $(this).find('ul:first').css({ visibility: "visible", display: "none" }).show(400); }, function() { $(this).find('ul:first').css({ visibility: "hidden" }); }); } $(document).ready(function() { mainmenu(); }); </script> <style type="text/css"> * { padding: 0px; margin: 0px; } body { font-size: 0.85em; font-family: Verdana, Arial, Helvetica, sans-serif; } #nav, #nav ul { margin: 0; padding: 0; list-style-type: none; list-style-position: outside; position: relative; } #nav a { display: block; padding: 4px 0px 4px 0px; color: #dfca90; text-decoration: none; background-color: #ECE9D8; font-size: 9px; font-weight: bold; font: bold 15px Palatino, 'Palatino Linotype' , Georgia, serif; } #nav > li > a { font-size: 16px; font-variant: small-caps; border-right: 1px solid #dfca90; padding-right: 10px; padding-left: 10px; padding-bottom: 6px; padding-top: 6px; background-color: #fff; color: #dfca90; } #nav li ul li a:hover { color: #999; } #nav li { float: left; position: relative; } #nav ul { position: absolute; display: none; width: 170px; border: 2px solid #dfca90; } #nav ul li { } #nav li ul a { width: 170px; height: auto; float: left; } #nav ul ul { top: -2px; } #nav li ul ul { left: 170px; background-color: #ECE9D8; } #nav li:hover ul ul, #nav li:hover ul ul ul, #nav li:hover ul ul ul ul { display: none; } #nav li:hover ul, #nav li li:hover ul, #nav li li li:hover ul, #nav li li li li:hover ul { display: block; } </style> </head> <body> <ul id="nav"> <li><a href="#">1 HTML</a></li> <li><a href="#">2 CSS</a></li> <li><a href="#">3 Javascript </a> <ul> <li><a href="#">3.1 jQuery</a> <ul> <li><a href="#">3.1.1 Download</a> </li> <li><a href="#">3.1.2 Tutorial</a> </li> </ul> </li> <li><a href="#">3.2 Mootools</a></li> <li><a href="#">3.3 Prototype</a></li> </ul> </li> </ul> </body> </html>

    Read the article

  • Threading extra state through a parser in Scala

    - by Travis Brown
    I'll give you the tl;dr up front I'm trying to use the state monad transformer in Scalaz 7 to thread extra state through a parser, and I'm having trouble doing anything useful without writing a lot of t m a -> t m b versions of m a -> m b methods. An example parsing problem Suppose I have a string containing nested parentheses with digits inside them: val input = "((617)((0)(32)))" I also have a stream of fresh variable names (characters, in this case): val names = Stream('a' to 'z': _*) I want to pull a name off the top of the stream and assign it to each parenthetical expression as I parse it, and then map that name to a string representing the contents of the parentheses, with the nested parenthetical expressions (if any) replaced by their names. To make this more concrete, here's what I'd want the output to look like for the example input above: val target = Map( 'a' -> "617", 'b' -> "0", 'c' -> "32", 'd' -> "bc", 'e' -> "ad" ) There may be either a string of digits or arbitrarily many sub-expressions at a given level, but these two kinds of content won't be mixed in a single parenthetical expression. To keep things simple, we'll assume that the stream of names will never contain either duplicates or digits, and that it will always contain enough names for our input. Using parser combinators with a bit of mutable state The example above is a slightly simplified version of the parsing problem in this Stack Overflow question. I answered that question with a solution that looked roughly like this: import scala.util.parsing.combinator._ class ParenParser(names: Iterator[Char]) extends RegexParsers { def paren: Parser[List[(Char, String)]] = "(" ~> contents <~ ")" ^^ { case (s, m) => (names.next -> s) :: m } def contents: Parser[(String, List[(Char, String)])] = "\\d+".r ^^ (_ -> Nil) | rep1(paren) ^^ ( ps => ps.map(_.head._1).mkString -> ps.flatten ) def parse(s: String) = parseAll(paren, s).map(_.toMap) } It's not too bad, but I'd prefer to avoid the mutable state. What I want Haskell's Parsec library makes adding user state to a parser trivially easy: import Control.Applicative ((*>), (<$>), (<*)) import Data.Map (fromList) import Text.Parsec paren = do (s, m) <- char '(' *> contents <* char ')' h : t <- getState putState t return $ (h, s) : m where contents = flip (,) [] <$> many1 digit <|> (\ps -> (map (fst . head) ps, concat ps)) <$> many1 paren main = print $ runParser (fromList <$> paren) ['a'..'z'] "example" "((617)((0)(32)))" This is a fairly straightforward translation of my Scala parser above, but without mutable state. What I've tried I'm trying to get as close to the Parsec solution as I can using Scalaz's state monad transformer, so instead of Parser[A] I'm working with StateT[Parser, Stream[Char], A]. I have a "solution" that allows me to write the following: import scala.util.parsing.combinator._ import scalaz._, Scalaz._ object ParenParser extends ExtraStateParsers[Stream[Char]] with RegexParsers { protected implicit def monadInstance = parserMonad(this) def paren: ESP[List[(Char, String)]] = (lift("(" ) ~> contents <~ lift(")")).flatMap { case (s, m) => get.flatMap( names => put(names.tail).map(_ => (names.head -> s) :: m) ) } def contents: ESP[(String, List[(Char, String)])] = lift("\\d+".r ^^ (_ -> Nil)) | rep1(paren).map( ps => ps.map(_.head._1).mkString -> ps.flatten ) def parse(s: String, names: Stream[Char]) = parseAll(paren.eval(names), s).map(_.toMap) } This works, and it's not that much less concise than either the mutable state version or the Parsec version. But my ExtraStateParsers is ugly as sin—I don't want to try your patience more than I already have, so I won't include it here (although here's a link, if you really want it). I've had to write new versions of every Parser and Parsers method I use above for my ExtraStateParsers and ESP types (rep1, ~>, <~, and |, in case you're counting). If I had needed to use other combinators, I'd have had to write new state transformer-level versions of them as well. Is there a cleaner way to do this? I'd love to see an example of a Scalaz 7's state monad transformer being used to thread state through a parser, but Scala 6 or Haskell examples would also be useful.

    Read the article

  • inserting null values in datetime column and integer column

    - by reggie
    I am using C# and developing a winform application. I have a project class which has the project attributes. the constructor of the project class is as follows: newProject = new Project(GCD_ID.IsNull() ? (int?)null : Convert.ToInt32(GCD_ID), txt_Proj_Desc.Text, txt_Prop_Name.Text, ST.ID.ToString().IsNull() ? null: ST.ID.ToString(), cmbCentre.Text, SEC.ID.ToString().IsNull() ? null : SEC.ID.ToString(), cmbZone.Text, FD.ID.ToString().IsNull() ? null : FD.ID.ToString(), DT.ID.ToString().IsNull() ? null : DT.ID.ToString(), OP.ID.ToString().IsNull() ? null : OP.ID.ToString(), T.ID.ToString().IsNull() ? null : T.ID.ToString(), CKV.ID.ToString().IsNull() ? null : CKV.ID.ToString(), STAT.ID.ToString().IsNull() ? null : STAT.ID.ToString(), MW.IsNull() ? (Double?)null : Convert.ToDouble(MW), txt_Subject.Text, Ip_Num.IsNull() ? (int?)null : Convert.ToInt32(Ip_Num), H1N_ID.IsNull() ? (int?)null : Convert.ToInt32(H1N_ID), NOMS_Slip_Num.IsNull() ? (int?)null : Convert.ToInt32(NOMS_Slip_Num), NMS_Updated.IsNull() ? (DateTime?)null : Convert.ToDateTime(NMS_Updated), Received_Date.IsNull() ? (DateTime?)null : Convert.ToDateTime(Received_Date), Actual_IS_Date.IsNull() ? (DateTime?)null : Convert.ToDateTime(Actual_IS_Date), Scheduled_IS_Date.IsNull() ? (DateTime?)null : Convert.ToDateTime(Scheduled_IS_Date), UpSt.ID.ToString().IsNull() ? null : UpSt.ID.ToString(), UpFd.ID.ToString().IsNull() ? null : UpFd.ID.ToString(), txtHVCircuit.Text, cmbbxSIA.Text); My problem is that i cannot insert values into the database when the datetime variables and the integer variables are null. all this data are assigned to the variable from textboxes on the form.. bELOW is the database function which takes in all the variables and insert them into the database. public static void createNewProject(int? GCD_ID, string Project_Desc, string Proponent_Name, int Station_ID, string OpCentre, int Sector_ID, string PLZone, int Feeder, int DxTx_ID, int OpControl_ID, int Type_ID, int ConnKV_ID, int Status_ID, double? MW, string Subject, int? Ip_Num, int? H1N_ID, int? NOMS_Slip_Num, DateTime? NMS_Updated, DateTime? Received_Date, DateTime? Actual_IS_Date, DateTime? Scheduled_IS_Date, int UP_Station_ID, int UP_Feeder_ID, string @HV_Circuit, string SIA_Required) { SqlConnection conn = null; try { //Takes in all the employee details to be added to the database. conn = new SqlConnection(databaseConnectionString); conn.Open(); SqlCommand cmd = new SqlCommand("createNewProject", conn); cmd.CommandType = CommandType.StoredProcedure; cmd.Parameters.Add(new SqlParameter("GCD_ID", GCD_ID)); cmd.Parameters.Add(new SqlParameter("Project_Desc", MiscFunctions.Capitalize(Project_Desc))); cmd.Parameters.Add(new SqlParameter("Proponent_Name", MiscFunctions.Capitalize(Proponent_Name))); cmd.Parameters.Add(new SqlParameter("Station_ID", Station_ID)); cmd.Parameters.Add(new SqlParameter("OpCentre", OpCentre)); cmd.Parameters.Add(new SqlParameter("Sector_ID", Sector_ID)); cmd.Parameters.Add(new SqlParameter("PLZone", PLZone)); cmd.Parameters.Add(new SqlParameter("Feeder", Feeder)); cmd.Parameters.Add(new SqlParameter("DxTx_ID", DxTx_ID)); cmd.Parameters.Add(new SqlParameter("OpControl_ID", OpControl_ID)); cmd.Parameters.Add(new SqlParameter("Type_ID", Type_ID)); cmd.Parameters.Add(new SqlParameter("ConnKV_ID", ConnKV_ID)); cmd.Parameters.Add(new SqlParameter("Status_ID", Status_ID)); cmd.Parameters.Add(new SqlParameter("MW", MW)); cmd.Parameters.Add(new SqlParameter("Subject", Subject)); cmd.Parameters.Add(new SqlParameter("Ip_Num", Ip_Num)); cmd.Parameters.Add(new SqlParameter("H1N_ID", H1N_ID)); cmd.Parameters.Add(new SqlParameter("NOMS_Slip_Num", NOMS_Slip_Num)); cmd.Parameters.Add(new SqlParameter("NMS_Updated", NMS_Updated)); cmd.Parameters.Add(new SqlParameter("Received_Date", Received_Date)); cmd.Parameters.Add(new SqlParameter("Actual_IS_Date", Actual_IS_Date)); cmd.Parameters.Add(new SqlParameter("Scheduled_IS_Date", Scheduled_IS_Date)); cmd.Parameters.Add(new SqlParameter("UP_Station_ID", UP_Station_ID)); cmd.Parameters.Add(new SqlParameter("UP_Feeder_ID", UP_Feeder_ID)); cmd.Parameters.Add(new SqlParameter("HV_Circuit", HV_Circuit)); cmd.Parameters.Add(new SqlParameter("SIA_Required", SIA_Required)); cmd.ExecuteNonQuery(); } catch (Exception e) //returns if error incurred. { MessageBox.Show("Error occured in createNewProject" + Environment.NewLine + e.ToString()); } finally { if (conn != null) { conn.Close(); } } } My question is, how do i insert values into the database. please please help

    Read the article

  • Arduino - AdHoc Network Setup

    - by methodMan
    I`m currently working with an arduino trying to build an adhoc network to which a device can connect to and send web request to. The problem I am currently having is that I can only set up one connection and then when that connection is terminated (client.stop()) all subsequent connections are not picked up by the server, even a curl command just sits there spinning. The first connection I start when I reset the server works fine and I am able to talk to the server; but after that, the arduino can no longer find new clients (even though it's trying with the library given). I`m using the sparkfun library for the wifly shield cloned from github, along with an Arduino Uno. My current code is based off their default example 'WiFly_AdHoc_Example' but I had to remove a few things to get the network to start up which might be the cause of this problem. Here is the .ino file that I am running. #include <SPI.h> #include <WiFly.h> //#include <SoftwareSerial.h> //SoftwareSerial mySerial( 5, 4); //Part from example not used(see below) WiFlyServer server(80); void setup() { Serial.begin(9600); //The code below is from the example but when I run it the WiFly will hang // on Wifly.begin(). Without it the WiFly starts up fine but only works for // one request. //mySerial.begin(9600); //WiFly.setUart(&mySerial); // Tell the WiFly library that we are not //using the SPIUart Serial.println("**************Starting WiFly**************"); // Enable Adhoc mod WiFly.begin(true); Serial.println("WiFly started, creating network."); if (!WiFly.createAdHocNetwork("wifly")) { Serial.print("Failed to create ad hoc network."); while (1) { // Hang on failure. } } Serial.println("Network created"); Serial.print("IP: "); Serial.println(WiFly.ip()); Serial.println("Starting Server..."); server.begin(); Serial.print("Server started, waiting for client."); } void loop() { delay(200); WiFlyClient client = server.available(); if (client) { Serial.println("Client Found."); // a string to store received commands String current_command = ""; while (client.connected()) { if (client.available()) { //Gets a character from the sent request. char c = client.read(); if (c=='#' || c=='\n') //End of extraneous output { current_command = ""; } else if(c!= '\n') { current_command+=c; } if (current_command== "get") { // output the value of each analog input pin for (int i = 0; i < 6; i++) { client.print("analog input "); client.print(i); client.print(" is "); client.print(analogRead(i)); client.println("<br />"); } } else if(current_command== "hello") { client.println("Hello there, I'm still here."); } else if (current_command== "quit") { client.println("Goodbye..."); client.stop(); current_command == ""; break; } else if (current_command == "*OPEN*") { current_command == ""; } } } // give the web browser time to receive the data delay(200); // close the connection client.stop(); } } If anyone understands this better then I (I`m new to arduino) please leave some helpful comments. Or just help me out on getting this little web server up and running so that I can hit it with more then one request. If there is any other helpful information I can provide please let me know. Thanks for reading and hope you can help. EDIT: Using telnet I can successfully connect (the first time) and send commands to the arduino including one to terminate the connection (calls the client.stop() method). But when I try to reconnect though telnet, it says the connection was successful but on the arduino it's still looping thinking the client is still false. WHAT??? I know right, I'm getting mixed messages from telnet vs arduino. None of the commands work obviously since the ardunio is still looping waiting for a client that evaluates to true. I'm gonna take a look at WiFlyServer from the library I imported and see if I can dig up the problem because somehow that server.available() method isn't finding new clients. Noticing a lot of TODO's in the library code.... EDIT: So I found the reason for the problem, it was in WiFlyServer.cpp file from the sparkfun library. The code that was causing the reconnect issue was infact in the server.availible() method. Right at the top of the method, there is a check: // TODO: Ensure no active non-server client connection. if (!WiFly.serverConnectionActive) { activeClient._port = 0; } For some reason when I comment this out, I can reconnect fine and everything works as it should. I will now dive into the library and see if I can fix this, I'm not exactly sure what this is doing but it gets called when the server connection is not active and is somehow blocking subsequent connections. Does anyone have any ideas how I might get to the root of this problem without using this commenting hack? Please help, no-one has commented or answered yet! Don't you want to join in on the fun???

    Read the article

  • unable to update gridview

    - by bhakti
    Please help ,i have added update/edit command button in gridview so to update data in my sql server database but am unable to do it. Data is not updated in database . ======code for onrowupdate======================================== protected void gRowUpdate(object sender, GridViewUpdateEventArgs e) { Books b = null; b = new Books(); DataTable dt=null; GridView g = (GridView)sender; try { dt=new DataTable(); b = new Books(); b.author = Convert.ToString(g.Rows[e.RowIndex].FindControl("Author")); b.bookID = Convert.ToInt32(g.Rows[e.RowIndex].FindControl("BookID")); b.title = Convert.ToString(g.Rows[e.RowIndex].FindControl("Title")); b.price = Convert.ToDouble(g.Rows[e.RowIndex].FindControl("Price")); // b.rec = Convert.ToString(g.Rows[e.RowIndex].FindControl("Date_of_reciept")); b.ed = Convert.ToString(g.Rows[e.RowIndex].FindControl("Edition")); b.bill = Convert.ToString(g.Rows[e.RowIndex].FindControl("Edition")); b.cre_by = Convert.ToString(g.Rows[e.RowIndex].FindControl("Edition")); b.src = Convert.ToString(g.Rows[e.RowIndex].FindControl("Edition")); b.pages = Convert.ToInt32(g.Rows[e.RowIndex].FindControl("Edition")); b.pub = Convert.ToString(g.Rows[e.RowIndex].FindControl("Edition")); b.mod_by = Convert.ToString(g.Rows[e.RowIndex].FindControl("Edition")); b.remark = Convert.ToString(g.Rows[e.RowIndex].FindControl("Edition")); // b.year = Convert.ToString(g.Rows[e.RowIndex].FindControl("Edition")); b.updatebook(b); g.EditIndex = -1; dt = b.GetAllBooks(); g.DataSource = dt; g.DataBind(); } catch (Exception ex) { throw (ex); } finally { b = null; } } ===================My stored procedure for update book able to update database by exec in sqlserver mgmt studio========================== set ANSI_NULLS ON set QUOTED_IDENTIFIER ON go ALTER PROCEDURE [dbo].[usp_updatebook] @bookid bigint, @author varchar(50), @title varchar(50), @price bigint, @src_equisition varchar(50), @bill_no varchar(50), @publisher varchar(50), @pages bigint, @remark varchar(50), @edition varchar(50), @created_by varchar(50), @modified_by varchar(50) /*@date_of_reciept datetime, @year_of_publication datetime*/ AS declare @modified_on datetime set @modified_on=getdate() UPDATE books SET author=@author, title=@title, price=@price, src_equisition=@src_equisition, bill_no=@bill_no, publisher=@publisher, /*Date_of_reciept=@date_of_reciept,*/ pages=@pages, remark=@remark, edition=@edition, /*Year_of_publication=@year_of_publication,*/ created_by=@created_by, modified_on=@modified_on, modified_by=@modified_by WHERE bookid=@bookid ========================class library function for update==================== public void updatebook(Books b) { DataAccess dbAccess = null; SqlCommand cmd = null; try { dbAccess = new DataAccess(); cmd = dbAccess.GetSQLCommand("usp_updatebook", CommandType.StoredProcedure); cmd.Parameters.Add("@bookid", SqlDbType.VarChar, 50).Value = b.bookID; cmd.Parameters.Add("@author", SqlDbType.VarChar, 50).Value = b.author; cmd.Parameters.Add("@title", SqlDbType.VarChar, 50).Value = b.title; cmd.Parameters.Add("@price", SqlDbType.Money).Value = b.price; cmd.Parameters.Add("@publisher", SqlDbType.VarChar, 50).Value = b.pub; // cmd.Parameters.Add("@year_of_publication", SqlDbType.DateTime).Value =Convert.ToDateTime( b.year); cmd.Parameters.Add("@src_equisition", SqlDbType.VarChar, 50).Value = b.src; cmd.Parameters.Add("@bill_no", SqlDbType.VarChar, 50).Value = b.bill; cmd.Parameters.Add("@remark", SqlDbType.VarChar, 50).Value = b.remark; cmd.Parameters.Add("@pages", SqlDbType.Int).Value = b.pages; cmd.Parameters.Add("@edition", SqlDbType.VarChar, 50).Value = b.ed; // cmd.Parameters.Add("@date_of_reciept", SqlDbType.DateTime).Value = Convert.ToDateTime(b.rec); // cmd.Parameters.Add("@created_on", SqlDbType.DateTime).Value = Convert.ToDateTime(b.cre_on); cmd.Parameters.Add("@created_by", SqlDbType.VarChar, 50).Value = b.cre_by; //cmd.Parameters.Add("@modified_on", SqlDbType.DateTime).Value = Convert.ToDateTime(b.mod_on); cmd.Parameters.Add("@modified_by", SqlDbType.VarChar, 50).Value = b.mod_by; cmd.ExecuteNonQuery(); } catch (Exception ex) { throw (ex); } finally { if (cmd.Connection != null && cmd.Connection.State == ConnectionState.Open) cmd.Connection.Close(); dbAccess = null; cmd = null; } } I have also tried to do update by following way protected void gv1_updating(object sender, GridViewUpdateEventArgs e) { GridView g = (GridView)sender; abc a = new abc(); DataTable dt = new DataTable(); try { a.cd_Id = Convert.ToInt32(g.DataKeys[e.RowIndex].Values[0].ToString()); //TextBox b = (TextBox)g.Rows[e.RowIndex].Cells[0].FindControl("cd_id"); TextBox c = (TextBox)g.Rows[e.RowIndex].Cells[2].FindControl("cd_name"); TextBox d = (TextBox)g.Rows[e.RowIndex].Cells[3].FindControl("version"); TextBox f = (TextBox)g.Rows[e.RowIndex].Cells[4].FindControl("company"); TextBox h = (TextBox)g.Rows[e.RowIndex].Cells[6].FindControl("created_by"); TextBox i = (TextBox)g.Rows[e.RowIndex].Cells[8].FindControl("modified_by"); //a.cd_Id = Convert.ToInt32(b.Text); a.cd_name = c.Text; a.ver = d.Text; a.comp = f.Text; a.cre_by = h.Text; a.mod_by = i.Text; a.updateDigi(a); g.EditIndex = -1; dt = a.GetAllDigi(); g.DataSource = dt; g.DataBind(); } catch(Exception ex) { throw (ex); } finally { dt = null; a = null; g = null; } } =================== but have error of Index out of range exception========= please do reply,thanxs in advance

    Read the article

  • Implement date picker and time picker in button click and store in edit text boxes

    - by user3597791
    Hi I am trying to implement a date picker and time picker in button click and store in edit text boxes. I have tried numerous things but since i suck at coding I cant get any of them to work. Please find my class and xml below and i would be grateful for any help import android.app.Activity; import android.content.Intent; import android.database.Cursor; import android.graphics.BitmapFactory; import android.net.Uri; import android.os.Bundle; import android.provider.MediaStore; import android.view.View; import android.view.View.OnClickListener; import android.widget.Button; import android.widget.EditText; import android.widget.ImageView; import android.widget.Toast; public class NewEvent extends Activity { private static int RESULT_LOAD_IMAGE = 1; private EventHandler handler; private String picturePath = ""; private String name; private String place; private String date; private String time; private String photograph; @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.new_event); handler = new EventHandler(getApplicationContext()); ImageView iv_user_photo = (ImageView) findViewById(R.id.iv_user_photo); iv_user_photo.setOnClickListener(new OnClickListener() { @Override public void onClick(View arg0) { Intent intent = new Intent(Intent.ACTION_PICK, android.provider.MediaStore.Images.Media.EXTERNAL_CONTENT_URI); startActivityForResult(intent, RESULT_LOAD_IMAGE); } }); Button btn_add = (Button) findViewById(R.id.btn_add); btn_add.setOnClickListener(new OnClickListener() { @Override public void onClick(View arg0) { EditText et_name = (EditText) findViewById(R.id.et_name); name = et_name.getText().toString(); EditText et_place = (EditText) findViewById(R.id.et_place); place = et_place.getText().toString(); EditText et_date = (EditText) findViewById(R.id.et_date); date = et_date.getText().toString(); EditText et_time = (EditText) findViewById(R.id.et_time); time = et_time.getText().toString(); ImageView iv_photograph = (ImageView) findViewById(R.id.iv_user_photo); photograph = picturePath; Event event = new Event(); event.setName(name); event.setPlace(place); event.setDate(date); event.setTime(time); event.setPhotograph(photograph); Boolean added = handler.addEventDetails(event); if(added){ Intent intent = new Intent(NewEvent.this, MainEvent.class); startActivity(intent); }else{ Toast.makeText(getApplicationContext(), "Event data not added. Please try again", Toast.LENGTH_LONG).show(); } } }); } @Override protected void onActivityResult(int requestCode, int resultCode, Intent data) { super.onActivityResult(requestCode, resultCode, data); if (requestCode == RESULT_LOAD_IMAGE && resultCode == RESULT_OK && null != data) { Uri imageUri = data.getData(); String[] filePathColumn = { MediaStore.Images.Media.DATA }; Cursor cursor = getContentResolver().query(imageUri, filePathColumn, null, null, null); cursor.moveToFirst(); int columnIndex = cursor.getColumnIndex(filePathColumn[0]); picturePath = cursor.getString(columnIndex); cursor.close(); Here is my xml: <?xml version="1.0" encoding="utf-8"?> <RelativeLayout xmlns:android="http://schemas.android.com/apk/res/android" android:layout_width="match_parent" android:layout_height="match_parent" android:orientation="vertical" android:padding="10dp"> <TextView android:id="@+id/tv_new_event_title" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Add New Event" android:textAppearance="?android:attr/textAppearanceLarge" android:layout_alignParentTop="true" /> <Button android:id="@+id/btn_add" android:layout_width="match_parent" android:layout_height="wrap_content" android:text="Add Event" android:layout_alignParentBottom="true" /> <ScrollView android:layout_width="match_parent" android:layout_height="match_parent" android:layout_below="@id/tv_new_event_title" android:layout_above="@id/btn_add"> <LinearLayout android:layout_width="fill_parent" android:layout_height="wrap_content" android:orientation="vertical"> <ImageView android:id="@+id/iv_user_photo" android:src="@drawable/add_user_icon" android:layout_width="100dp" android:layout_height="100dp"/> <TextView android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Event:" /> <EditText android:id="@+id/et_name" android:layout_width="match_parent" android:layout_height="wrap_content" android:ems="10" android:inputType="text" > <requestFocus /> </EditText> <TextView android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Place:" /> <EditText android:id="@+id/et_place" android:layout_width="match_parent" android:layout_height="wrap_content" android:ems="10" android:inputType="text" > <requestFocus /> </EditText> <TextView android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Date:" /> <EditText android:id="@+id/et_date" android:layout_width="match_parent" android:layout_height="wrap_content" android:ems="10" android:inputType="date" /> <Button android:id="@+id/button" style="?android:attr/buttonStyleSmall" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Button" /> <requestFocus /> <TextView android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Time:" /> <EditText android:id="@+id/et_time" android:layout_width="match_parent" android:layout_height="wrap_content" android:ems="10" android:inputType="time" /> <Button android:id="@+id/button1" style="?android:attr/buttonStyleSmall" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Button1" /> <requestFocus /> </LinearLayout> </ScrollView> </RelativeLayout>

    Read the article

  • Hibernate Query Language Problem

    - by Sarang
    Well, I have implemented a distinct query in hibernate. It returns me result. But, while casting the fields are getting interchanged. So, it generates casting error. What should be the solution? As an example, I do have database, "ProjectAssignment" that has three fields, aid, pid & userName. I want all distinct userName data from this table. I have applied query : select distinct userName, aid, pid from ProjectAssignment Whereas the ProjectAssignment.java file has the fields in sequence aid, pid & userName. Now, here the userName is first field in output. So, Casting is not getting possible. Also, query : select aid, pid, distinct userName from ProjectAssignment is not working. What is the proper query for the same ? Or what else the solution ? The code is as below : System Utilization Service Bean Method where I have to retrieve data : public List<ProjectAssignment> getProjectAssignments() { projectAssignments = ProjectAssignmentHelper.getAllResources(); //Here comes the error return projectAssignments; } ProjectAssignmentHelper from where I fetch Data : package com.hibernate; import java.util.List; import org.hibernate.Query; import org.hibernate.Session; public class ProjectAssignmentHelper { public static List<ProjectAssignment> getAllResources() { List<ProjectAssignment> projectMasters; Session session = HibernateUtil.getSessionFactory().openSession(); Query query = session.createQuery("select distinct aid, pid, userName from ProjectAssignment"); projectMasters = (List<ProjectAssignment>) query.list(); session.close(); return projectMasters; } } Hibernate Data Bean : package com.hibernate; public class ProjectAssignment implements java.io.Serializable { private short aid; private String pid; private String userName; public ProjectAssignment() { } public ProjectAssignment(short aid) { this.aid = aid; } public ProjectAssignment(short aid, String pid, String userName) { this.aid = aid; this.pid = pid; this.userName = userName; } public short getAid() { return this.aid; } public void setAid(short aid) { this.aid = aid; } public String getPid() { return this.pid; } public void setPid(String pid) { this.pid = pid; } public String getUserName() { return this.userName; } public void setUserName(String userName) { this.userName = userName; } } Error : For input string: "userName" java.lang.NumberFormatException: For input string: "userName" at java.lang.NumberFormatException.forInputString(NumberFormatException.java:48) at java.lang.Integer.parseInt(Integer.java:447) at java.lang.Integer.parseInt(Integer.java:497) at javax.el.ArrayELResolver.toInteger(ArrayELResolver.java:375) at javax.el.ArrayELResolver.getValue(ArrayELResolver.java:195) at javax.el.CompositeELResolver.getValue(CompositeELResolver.java:175) at com.sun.faces.el.FacesCompositeELResolver.getValue(FacesCompositeELResolver.java:72) at com.sun.el.parser.AstValue.getValue(AstValue.java:116) at com.sun.el.parser.AstValue.getValue(AstValue.java:163) at com.sun.el.ValueExpressionImpl.getValue(ValueExpressionImpl.java:219) at com.sun.faces.facelets.el.TagValueExpression.getValue(TagValueExpression.java:102) at javax.faces.component.ComponentStateHelper.eval(ComponentStateHelper.java:190) at javax.faces.component.ComponentStateHelper.eval(ComponentStateHelper.java:178) at javax.faces.component.UICommand.getValue(UICommand.java:218) at org.primefaces.component.commandlink.CommandLinkRenderer.encodeMarkup(CommandLinkRenderer.java:113) at org.primefaces.component.commandlink.CommandLinkRenderer.encodeEnd(CommandLinkRenderer.java:54) at javax.faces.component.UIComponentBase.encodeEnd(UIComponentBase.java:878) at org.primefaces.renderkit.CoreRenderer.renderChild(CoreRenderer.java:70) at org.primefaces.renderkit.CoreRenderer.renderChildren(CoreRenderer.java:54) at org.primefaces.component.datatable.DataTableRenderer.encodeTable(DataTableRenderer.java:525) at org.primefaces.component.datatable.DataTableRenderer.encodeMarkup(DataTableRenderer.java:407) at org.primefaces.component.datatable.DataTableRenderer.encodeEnd(DataTableRenderer.java:193) at javax.faces.component.UIComponentBase.encodeEnd(UIComponentBase.java:878) at org.primefaces.renderkit.CoreRenderer.renderChild(CoreRenderer.java:70) at org.primefaces.renderkit.CoreRenderer.renderChildren(CoreRenderer.java:54) at org.primefaces.component.tabview.TabViewRenderer.encodeContents(TabViewRenderer.java:198) at org.primefaces.component.tabview.TabViewRenderer.encodeMarkup(TabViewRenderer.java:130) at org.primefaces.component.tabview.TabViewRenderer.encodeEnd(TabViewRenderer.java:48) at javax.faces.component.UIComponentBase.encodeEnd(UIComponentBase.java:878) at javax.faces.component.UIComponent.encodeAll(UIComponent.java:1620) at javax.faces.render.Renderer.encodeChildren(Renderer.java:168) at javax.faces.component.UIComponentBase.encodeChildren(UIComponentBase.java:848) at javax.faces.component.UIComponent.encodeAll(UIComponent.java:1613) at javax.faces.component.UIComponent.encodeAll(UIComponent.java:1616) at javax.faces.component.UIComponent.encodeAll(UIComponent.java:1616) at com.sun.faces.application.view.FaceletViewHandlingStrategy.renderView(FaceletViewHandlingStrategy.java:380) at com.sun.faces.application.view.MultiViewHandler.renderView(MultiViewHandler.java:126) at com.sun.faces.lifecycle.RenderResponsePhase.execute(RenderResponsePhase.java:127) at com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) at com.sun.faces.lifecycle.LifecycleImpl.render(LifecycleImpl.java:139) at javax.faces.webapp.FacesServlet.service(FacesServlet.java:313) at org.apache.catalina.core.StandardWrapper.service(StandardWrapper.java:1523) at org.apache.catalina.core.ApplicationDispatcher.doInvoke(ApplicationDispatcher.java:802) at org.apache.catalina.core.ApplicationDispatcher.invoke(ApplicationDispatcher.java:664) at org.apache.catalina.core.ApplicationDispatcher.processRequest(ApplicationDispatcher.java:497) at org.apache.catalina.core.ApplicationDispatcher.doDispatch(ApplicationDispatcher.java:468) at org.apache.catalina.core.ApplicationDispatcher.dispatch(ApplicationDispatcher.java:364) at org.apache.catalina.core.ApplicationDispatcher.forward(ApplicationDispatcher.java:314) at org.apache.jasper.runtime.PageContextImpl.forward(PageContextImpl.java:783) at org.apache.jsp.welcome_jsp._jspService(welcome_jsp.java from :59) at org.apache.jasper.runtime.HttpJspBase.service(HttpJspBase.java:109) at javax.servlet.http.HttpServlet.service(HttpServlet.java:847) at org.apache.jasper.servlet.JspServletWrapper.service(JspServletWrapper.java:406) at org.apache.jasper.servlet.JspServlet.serviceJspFile(JspServlet.java:483) at org.apache.jasper.servlet.JspServlet.service(JspServlet.java:373) at javax.servlet.http.HttpServlet.service(HttpServlet.java:847) at org.apache.catalina.core.StandardWrapper.service(StandardWrapper.java:1523) at org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.java:279) at org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.java:188) at org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:641) at com.sun.enterprise.web.WebPipeline.invoke(WebPipeline.java:97) at com.sun.enterprise.web.PESessionLockingStandardPipeline.invoke(PESessionLockingStandardPipeline.java:85) at org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:185) at org.apache.catalina.connector.CoyoteAdapter.doService(CoyoteAdapter.java:332) at org.apache.catalina.connector.CoyoteAdapter.service(CoyoteAdapter.java:233) at com.sun.enterprise.v3.services.impl.ContainerMapper.service(ContainerMapper.java:165) at com.sun.grizzly.http.ProcessorTask.invokeAdapter(ProcessorTask.java:791) at com.sun.grizzly.http.ProcessorTask.doProcess(ProcessorTask.java:693) at com.sun.grizzly.http.ProcessorTask.process(ProcessorTask.java:954) at com.sun.grizzly.http.DefaultProtocolFilter.execute(DefaultProtocolFilter.java:170) at com.sun.grizzly.DefaultProtocolChain.executeProtocolFilter(DefaultProtocolChain.java:135) at com.sun.grizzly.DefaultProtocolChain.execute(DefaultProtocolChain.java:102) at com.sun.grizzly.DefaultProtocolChain.execute(DefaultProtocolChain.java:88) at com.sun.grizzly.http.HttpProtocolChain.execute(HttpProtocolChain.java:76) at com.sun.grizzly.ProtocolChainContextTask.doCall(ProtocolChainContextTask.java:53) at com.sun.grizzly.SelectionKeyContextTask.call(SelectionKeyContextTask.java:57) at com.sun.grizzly.ContextTask.run(ContextTask.java:69) at com.sun.grizzly.util.AbstractThreadPool$Worker.doWork(AbstractThreadPool.java:330) at com.sun.grizzly.util.AbstractThreadPool$Worker.run(AbstractThreadPool.java:309) at java.lang.Thread.run(Thread.java:619)

    Read the article

  • PyML 0.7.2 - How to prevent accuracy from dropping after storing/loading a classifier?

    - by Michael Aaron Safyan
    This is a followup from "Save PyML.classifiers.multi.OneAgainstRest(SVM()) object?". The solution to that question was close, but not quite right, (the SparseDataSet is broken, so attempting to save/load with that dataset container type will fail, no matter what. Also, PyML is inconsistent in terms of whether labels should be numbers or strings... it turns out that the oneAgainstRest function is actually not good enough, because the labels need to be strings and simultaneously convertible to floats, because there are places where it is assumed to be a string and elsewhere converted to float) and so after a great deal of hacking and such I was finally able to figure out a way to save and load my multi-class classifier without it blowing up with an error.... however, although it is no longer giving me an error message, it is still not quite right as the accuracy of the classifier drops significantly when it is saved and then reloaded (so I'm still missing a piece of the puzzle). I am currently using the following custom mutli-class classifier for training, saving, and loading: class SVM(object): def __init__(self,features_or_filename,labels=None,kernel=None): if isinstance(features_or_filename,str): filename=features_or_filename; if labels!=None: raise ValueError,"Labels must be None if loading from a file."; with open(os.path.join(filename,"uniquelabels.list"),"rb") as uniquelabelsfile: self.uniquelabels=sorted(list(set(pickle.load(uniquelabelsfile)))); self.labeltoindex={}; for idx,label in enumerate(self.uniquelabels): self.labeltoindex[label]=idx; self.classifiers=[]; for classidx, classname in enumerate(self.uniquelabels): self.classifiers.append(PyML.classifiers.svm.loadSVM(os.path.join(filename,str(classname)+".pyml.svm"),datasetClass = PyML.VectorDataSet)); else: features=features_or_filename; if labels==None: raise ValueError,"Labels must not be None when training."; self.uniquelabels=sorted(list(set(labels))); self.labeltoindex={}; for idx,label in enumerate(self.uniquelabels): self.labeltoindex[label]=idx; points = [[float(xij) for xij in xi] for xi in features]; self.classifiers=[PyML.SVM(kernel) for label in self.uniquelabels]; for i in xrange(len(self.uniquelabels)): currentlabel=self.uniquelabels[i]; currentlabels=['+1' if k==currentlabel else '-1' for k in labels]; currentdataset=PyML.VectorDataSet(points,L=currentlabels,positiveClass='+1'); self.classifiers[i].train(currentdataset,saveSpace=False); def accuracy(self,pts,labels): logger=logging.getLogger("ml"); correct=0; total=0; classindexes=[self.labeltoindex[label] for label in labels]; h=self.hypotheses(pts); for idx in xrange(len(pts)): if h[idx]==classindexes[idx]: logger.info("RIGHT: Actual \"%s\" == Predicted \"%s\"" %(self.uniquelabels[ classindexes[idx] ], self.uniquelabels[ h[idx] ])); correct+=1; else: logger.info("WRONG: Actual \"%s\" != Predicted \"%s\"" %(self.uniquelabels[ classindexes[idx] ], self.uniquelabels[ h[idx] ])) total+=1; return float(correct)/float(total); def prediction(self,pt): h=self.hypothesis(pt); if h!=None: return self.uniquelabels[h]; return h; def predictions(self,pts): h=self.hypotheses(self,pts); return [self.uniquelabels[x] if x!=None else None for x in h]; def hypothesis(self,pt): bestvalue=None; bestclass=None; dataset=PyML.VectorDataSet([pt]); for classidx, classifier in enumerate(self.classifiers): val=classifier.decisionFunc(dataset,0); if (bestvalue==None) or (val>bestvalue): bestvalue=val; bestclass=classidx; return bestclass; def hypotheses(self,pts): bestvalues=[None for pt in pts]; bestclasses=[None for pt in pts]; dataset=PyML.VectorDataSet(pts); for classidx, classifier in enumerate(self.classifiers): for ptidx in xrange(len(pts)): val=classifier.decisionFunc(dataset,ptidx); if (bestvalues[ptidx]==None) or (val>bestvalues[ptidx]): bestvalues[ptidx]=val; bestclasses[ptidx]=classidx; return bestclasses; def save(self,filename): if not os.path.exists(filename): os.makedirs(filename); with open(os.path.join(filename,"uniquelabels.list"),"wb") as uniquelabelsfile: pickle.dump(self.uniquelabels,uniquelabelsfile,pickle.HIGHEST_PROTOCOL); for classidx, classname in enumerate(self.uniquelabels): self.classifiers[classidx].save(os.path.join(filename,str(classname)+".pyml.svm")); I am using the latest version of PyML (0.7.2, although PyML.__version__ is 0.7.0). When I construct the classifier with a training dataset, the reported accuracy is ~0.87. When I then save it and reload it, the accuracy is less than 0.001. So, there is something here that I am clearly not persisting correctly, although what that may be is completely non-obvious to me. Would you happen to know what that is?

    Read the article

  • Matlab Image watermarking question , using both SVD and DWT

    - by Georgek
    Hello all . here is a code that i got over the net ,and it is supposed to embed a watermark of size(50*20) called _copyright.bmp in the Code below . the size of the cover object is (512*512), it is called _lena_std_bw.bmp.What we did here is we did DWT2 2 times for the image , when we reached our second dwt2 cA2 size is 128*128. You should notice that the blocksize and it equals 4, it is used to determine the max msg size based on cA2 according to the following code:max_message=RcA2*CcA2/(blocksize^2). in our current case max_message would equal 128*128/(4^2)=1024. i want to embed a bigger watermark in the 2nd dwt2 and lets say the size of that watermark is 400*10(i can change the dimension using MS PAINT), what i have to do is change the size of the blocksize to 2. so max_message=4096.Matlab gives me 3 errors and they are : ??? Error using == plus Matrix dimensions must agree. Error in == idwt2 at 93 x = upsconv2(a,{Lo_R,Lo_R},sx,dwtEXTM,shift)+ ... % Approximation. Error in == two_dwt_svd_low_low at 88 CAA1 = idwt2(cA22,cH2,cV2,cD2,'haar',[RcA1,CcA1]); The origional Code is (the origional code where blocksize =4): %This algorithm makes DWT for the whole image and after that make DWT for %cH1 and make SVD for cH2 and embed the watermark in every level after SVD %(1) -------------- Embed Watermark ------------------------------------ %Add the watermar W to original image I and give the watermarked image in J %-------------------------------------------------------------------------- % set the gain factor for embeding and threshold for evaluation clc; clear all; close all; % save start time start_time=cputime; % set the value of threshold and alpha thresh=.5; alpha =0.01; % read in the cover object file_name='_lena_std_bw.bmp'; cover_object=double(imread(file_name)); % determine size of watermarked image Mc=size(cover_object,1); %Height Nc=size(cover_object,2); %Width % read in the message image and reshape it into a vector file_name='_copyright.bmp'; message=double(imread(file_name)); T=message; Mm=size(message,1); %Height Nm=size(message,2); %Width % perform 1-level DWT for the whole cover image [cA1,cH1,cV1,cD1] = dwt2(cover_object,'haar'); % determine the size of cA1 [RcA1 CcA1]=size(cA1) % perform 2-level DWT for cA1 [cA2,cH2,cV2,cD2] = dwt2(cA1,'haar'); % determine the size of cA2 [RcA2 CcA2]=size(cA2) % set the value of blocksize blocksize=4 % reshape the watermark to a vector message_vector=round(reshape(message,Mm*Nm,1)./256); W=message_vector; % determine maximum message size based on cA2, and blocksize max_message=RcA2*CcA2/(blocksize^2) % check that the message isn't too large for cover if (length(message) max_message) error('Message too large to fit in Cover Object') end %----------------------- process the image in blocks ---------------------- x=1; y=1; for (kk = 1:length(message_vector)) [cA2u cA2s cA2v]=svd(cA2(y:y+blocksize-1,x:x+blocksize-1)); % if message bit contains zero, modify S of the original image if (message_vector(kk) == 0) cA2s = cA2s*(1 + alpha); % otherwise mask is filled with zeros else cA2s=cA2s; end cA22(y:y+blocksize-1,x:x+blocksize-1)=cA2u*cA2s*cA2v; % move to next block of mask along x; If at end of row, move to next row if (x+blocksize) >= CcA2 x=1; y=y+blocksize; else x=x+blocksize; end end % perform IDWT CAA1 = idwt2(cA22,cH2,cV2,cD2,'haar',[RcA1,CcA1]); watermarked_image= idwt2(CAA1,cH1,cV1,cD1,'haar',[Mc,Nc]); % convert back to uint8 watermarked_image_uint8=uint8(watermarked_image); % write watermarked Image to file imwrite(watermarked_image_uint8,'dwt_watermarked.bmp','bmp'); % display watermarked image figure(1) imshow(watermarked_image_uint8,[]) title('Watermarked Image') %(2) ---------------------------------------------------------------------- %---------- Extract Watermark from attacked watermarked image ------------- %-------------------------------------------------------------------------- % read in the watermarked object file_name='dwt_watermarked.bmp'; watermarked_image=double(imread(file_name)); % determine size of watermarked image Mw=size(watermarked_image,1); %Height Nw=size(watermarked_image,2); %Width % perform 1-level DWT for the whole watermarked image [ca1,ch1,cv1,cd1] = dwt2(watermarked_image,'haar'); % determine the size of ca1 [Rca1 Cca1]=size(ca1); % perform 2-level DWT for ca1 [ca2,ch2,cv2,cd2] = dwt2(ca1,'haar'); % determine the size of ca2 [Rca2 Cca2]=size(ca2); % process the image in blocks % for each block get a bit for message x=1; y=1; for (kk = 1:length(message_vector)) % sets correlation to 1 when patterns are identical to avoid /0 errors % otherwise calcluate difference between the cover image and the % watermarked image [cA2u cA2s cA2v]=svd(cA2(y:y+blocksize-1,x:x+blocksize-1)); [ca2u1 ca2s1 ca2v1]=svd(ca2(y:y+blocksize-1,x:x+blocksize-1)); correlation(kk)=diag(ca2s1-cA2s)'*diag(ca2s1-cA2s)/(alpha*alpha)/(diag(cA2s)*diag(cA2s)); % move on to next block. At and of row move to next row if (x+blocksize) >= Cca2 x=1; y=y+blocksize; else x=x+blocksize; end end % if correlation exceeds average correlation correlation(kk)=correlation(kk)+mean(correlation(1:Mm*Nm)); for kk = 1:length(correlation) if (correlation(kk) > thresh*alpha);%thresh*mean(correlation(1:Mo*No))) message_vector(kk)=0; end end % reshape the message vector and display recovered watermark. figure(2) message=reshape(message_vector(1:Mm*Nm),Mm,Nm); imshow(message,[]) title('Recovered Watermark') % display processing time elapsed_time=cputime-start_time, please do help,its my graduation project and i have been trying this code for along time but failed miserable. Thanks in advance

    Read the article

  • Error 324 (net::ERR_EMPTY_RESPONSE): Unknown error.

    - by Kp
    I get the following error in Chrome every time I try to run my script on a Linux server: Error 324 (net::ERR_EMPTY_RESPONSE): Unknown error. In Firefox it just shows a blank white page. Whenever I run it on my local test server (IIS on Windows 7) it runs exactly the way it should with no errors. I am pretty sure that it is a problem with the imap_open function. error_reporting(E_ALL); echo "test"; // enter gmail username below e.g.-- $m_username = "yourusername"; $m_username = "username"; // enter gmail password below e.g.-- $m_password = "yourpword"; $m_password = "password"; // Enter the mail server to connect to $server = '{imap.gmail.com:993/imap/ssl/novalidate-cert}INBOX'; // enter the number of unread messages you want to display from mailbox or //enter 0 to display all unread messages e.g.-- $m_acs = 0; $m_acs = 10; // How far back in time do you want to search for unread messages - one month = 0 , two weeks = 1, one week = 2, three days = 3, // one day = 4, six hours = 5 or one hour = 6 e.g.-- $m_t = 6; $m_t = 2; //-----------Nothing More to edit below //open mailbox $m_mail = imap_open ($server, $m_username . "@gmail.com", $m_password) // or throw an error or die("ERROR: " . imap_last_error()); // unix time gone by $m_gunixtp = array(2592000, 1209600, 604800, 259200, 86400, 21600, 3600); // Date to start search $m_gdmy = date('d-M-Y', time() - $m_gunixtp[$m_t]); //search mailbox for unread messages since $m_t date $m_search=imap_search ($m_mail, 'ALL'); // Order results starting from newest message rsort($m_search); //if m_acs 0 then limit results if($m_acs 0){ array_splice($m_search, $m_acs); } $read = $_GET[read]; if ($read) { function get_mime_type(&$structure) { $primary_mime_type = array("TEXT", "MULTIPART","MESSAGE", "APPLICATION", "AUDIO","IMAGE", "VIDEO", "OTHER"); if($structure-subtype) { return $primary_mime_type[(int) $structure-type] . '/' .$structure-subtype; } return "TEXT/PLAIN"; } function get_part($stream, $msg_number, $mime_type, $structure = false,$part_number = false) { if(!$structure) { $structure = imap_fetchstructure($stream, $msg_number); } if($structure) { if($mime_type == get_mime_type($structure)) { if(!$part_number) { $part_number = "1"; } $text = imap_fetchbody($stream, $msg_number, $part_number); if($structure->encoding == 3) { return imap_base64($text); } else if($structure->encoding == 4) { return imap_qprint($text); } else { return $text; } } if($structure->type == 1) /* multipart */ { while(list($index, $sub_structure) = each($structure->parts)) { if($part_number) { $prefix = $part_number . '.'; } $data = get_part($stream, $msg_number, $mime_type, $sub_structure,$prefix . ($index + 1)); if($data) { return $data; } } // END OF WHILE } // END OF MULTIPART } // END OF STRUTURE return false; } // END OF FUNCTION // GET TEXT BODY $dataTxt = get_part($m_mail, $read, "TEXT/PLAIN"); // GET HTML BODY $dataHtml = get_part($m_mail, $read, "TEXT/HTML"); if ($dataHtml != "") { $msgBody = $dataHtml; $mailformat = "html"; } else { $msgBody = ereg_replace("\n","",$dataTxt); $mailformat = "text"; } if ($mailformat == "text") { echo "<html><head><title>Messagebody</title></head><body bgcolor=\"white\">$msgBody</body></html>"; } else { echo $msgBody; // It contains all HTML HEADER tags so we don't have to make them. } exit; } //loop it foreach ($m_search as $what_ever) { //get imap header info for obj thang $obj_thang = imap_headerinfo($m_mail, $what_ever); //get body info for obj thang $obj_thangs = imap_body($m_mail, $what_ever); //Then spit it out below.........if you dont swallow echo "Message ID# " . $what_ever . " Date: " . date("F j, Y, g:i a", $obj_thang-udate) . " From: " . $obj_thang-fromaddress . " To: " . $obj_thang-toaddress . " Subject: " . $obj_thang-Subject . " "; } echo "" . $m_empty . ""; //close mailbox imap_close($m_mail); ?

    Read the article

  • Singleton code linker errors in vc 9.0. Runs fine in linux compiled with gcc

    - by user306560
    I have a simple logger that is implemented as a singleton. It works like i want when I compile and run it with g++ in linux but when I compile in Visual Studio 9.0 with vc++ I get the following errors. Is there a way to fix this? I don't mind changing the logger class around, but I would like to avoid changing how it is called. 1>Linking... 1>loggerTest.obj : error LNK2005: "public: static class Logger * __cdecl Logger::getInstance(void)" (?getInstance@Logger@@SAPAV1@XZ) already defined in Logger.obj 1>loggerTest.obj : error LNK2005: "public: void __thiscall Logger::log(class std::basic_string<char,struct std::char_traits<char>,class std::allocator<char> > const &)" (?log@Logger@@QAEXABV?$basic_string@DU?$char_traits@D@std@@V?$allocator@D@2@@std@@@Z) already defined in Logger.obj 1>loggerTest.obj : error LNK2005: "public: void __thiscall Logger::closeLog(void)" (?closeLog@Logger@@QAEXXZ) already defined in Logger.obj 1>loggerTest.obj : error LNK2005: "private: static class Logger * Logger::_instance" (?_instance@Logger@@0PAV1@A) already defined in Logger.obj 1>Logger.obj : error LNK2001: unresolved external symbol "private: static class std::basic_string<char,struct std::char_traits<char>,class std::allocator<char> > Logger::_path" (?_path@Logger@@0V?$basic_string@DU?$char_traits@D@std@@V?$allocator@D@2@@std@@A) 1>loggerTest.obj : error LNK2001: unresolved external symbol "private: static class std::basic_string<char,struct std::char_traits<char>,class std::allocator<char> > Logger::_path" (?_path@Logger@@0V?$basic_string@DU?$char_traits@D@std@@V?$allocator@D@2@@std@@A) 1>Logger.obj : error LNK2001: unresolved external symbol "private: static class boost::mutex Logger::_mutex" (?_mutex@Logger@@0Vmutex@boost@@A) 1>loggerTest.obj : error LNK2001: unresolved external symbol "private: static class boost::mutex Logger::_mutex" (?_mutex@Logger@@0Vmutex@boost@@A) 1>Logger.obj : error LNK2001: unresolved external symbol "private: static class std::basic_ofstream<char,struct std::char_traits<char> > Logger::_log" (?_log@Logger@@0V?$basic_ofstream@DU?$char_traits@D@std@@@std@@A) 1>loggerTest.obj : error LNK2001: unresolved external symbol "private: static class std::basic_ofstream<char,struct std::char_traits<char> > Logger::_log" (?_log@Logger@@0V?$basic_ofstream@DU?$char_traits@D@std@@@std@@A) The code, three files Logger.h Logger.cpp test.cpp #ifndef __LOGGER_CPP__ #define __LOGGER_CPP__ #include "Logger.h" Logger* Logger::_instance = 0; //string Logger::_path = "log"; //ofstream Logger::_log; //boost::mutex Logger::_mutex; Logger* Logger::getInstance(){ { boost::mutex::scoped_lock lock(_mutex); if(_instance == 0) { _instance = new Logger; _path = "log"; } } //mutex return _instance; } void Logger::log(const std::string& msg){ { boost::mutex::scoped_lock lock(_mutex); if(!_log.is_open()){ _log.open(_path.c_str()); } if(_log.is_open()){ _log << msg.c_str() << std::endl; } } } void Logger::closeLog(){ Logger::_log.close(); } #endif ` ... #ifndef __LOGGER_H__ #define __LOGGER_H__ #include <iostream> #include <string> #include <fstream> #include <boost/thread/mutex.hpp> #include <boost/thread.hpp> using namespace std; class Logger { public: static Logger* getInstance(); void log(const std::string& msg); void closeLog(); protected: Logger(){} private: static Logger* _instance; static string _path; static bool _logOpen; static ofstream _log; static boost::mutex _mutex; //check mutable }; #endif test.cpp ` #include <iostream> #include "Logger.cpp" using namespace std; int main(int argc, char *argv[]) { Logger* log = Logger::getInstance(); log->log("hello world\n"); return 0; }

    Read the article

  • capturing video from ip camera

    - by Ruby
    I am trying to capture video from ip camera into my application , its giving exception com.sun.image.codec.jpeg.ImageFormatException: Not a JPEG file: starts with 0x0d 0x0a at sun.awt.image.codec.JPEGImageDecoderImpl.readJPEGStream(Native Method) at sun.awt.image.codec.JPEGImageDecoderImpl.decodeAsBufferedImage(Unknown Source) at test.AxisCamera1.readJPG(AxisCamera1.java:130) at test.AxisCamera1.readMJPGStream(AxisCamera1.java:121) at test.AxisCamera1.readStream(AxisCamera1.java:100) at test.AxisCamera1.run(AxisCamera1.java:171) at java.lang.Thread.run(Unknown Source) its giving exception at image = decoder.decodeAsBufferedImage(); Here is the code i am trying private static final long serialVersionUID = 1L; public boolean useMJPGStream = true; public String jpgURL = "http://ip here/video.cgi/jpg/image.cgi?resolution=640×480"; public String mjpgURL = "http://ip here /video.cgi/mjpg/video.cgi?resolution=640×480"; DataInputStream dis; private BufferedImage image = null; public Dimension imageSize = null; public boolean connected = false; private boolean initCompleted = false; HttpURLConnection huc = null; Component parent; /** Creates a new instance of AxisCamera */ public AxisCamera1(Component parent_) { parent = parent_; } public void connect() { try { URL u = new URL(useMJPGStream ? mjpgURL : jpgURL); huc = (HttpURLConnection) u.openConnection(); // System.out.println(huc.getContentType()); InputStream is = huc.getInputStream(); connected = true; BufferedInputStream bis = new BufferedInputStream(is); dis = new DataInputStream(bis); if (!initCompleted) initDisplay(); } catch (IOException e) { // incase no connection exists wait and try // again, instead of printing the error try { huc.disconnect(); Thread.sleep(60); } catch (InterruptedException ie) { huc.disconnect(); connect(); } connect(); } catch (Exception e) { ; } } public void initDisplay() { // setup the display if (useMJPGStream) readMJPGStream(); else { readJPG(); disconnect(); } imageSize = new Dimension(image.getWidth(this), image.getHeight(this)); setPreferredSize(imageSize); parent.setSize(imageSize); parent.validate(); initCompleted = true; } public void disconnect() { try { if (connected) { dis.close(); connected = false; } } catch (Exception e) { ; } } public void paint(Graphics g) { // used to set the image on the panel if (image != null) g.drawImage(image, 0, 0, this); } public void readStream() { // the basic method to continuously read the // stream try { if (useMJPGStream) { while (true) { readMJPGStream(); parent.repaint(); } } else { while (true) { connect(); readJPG(); parent.repaint(); disconnect(); } } } catch (Exception e) { ; } } public void readMJPGStream() { // preprocess the mjpg stream to remove the // mjpg encapsulation readLine(3, dis); // discard the first 3 lines readJPG(); readLine(2, dis); // discard the last two lines } public void readJPG() { // read the embedded jpeg image try { JPEGImageDecoder decoder = JPEGCodec.createJPEGDecoder(dis); image = decoder.decodeAsBufferedImage(); } catch (Exception e) { e.printStackTrace(); disconnect(); } } public void readLine(int n, DataInputStream dis) { // used to strip out the // header lines for (int i = 0; i < n; i++) { readLine(dis); } } public void readLine(DataInputStream dis) { try { boolean end = false; String lineEnd = "\n"; // assumes that the end of the line is marked // with this byte[] lineEndBytes = lineEnd.getBytes(); byte[] byteBuf = new byte[lineEndBytes.length]; while (!end) { dis.read(byteBuf, 0, lineEndBytes.length); String t = new String(byteBuf); System.out.print(t); // uncomment if you want to see what the // lines actually look like if (t.equals(lineEnd)) end = true; } } catch (Exception e) { e.printStackTrace(); } } public void run() { System.out.println("in Run..................."); connect(); readStream(); } @SuppressWarnings("deprecation") public static void main(String[] args) { JFrame jframe = new JFrame(); jframe.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); AxisCamera1 axPanel = new AxisCamera1(jframe); new Thread(axPanel).start(); jframe.getContentPane().add(axPanel); jframe.pack(); jframe.show(); } } Any suggestions what I am doing wrong here??

    Read the article

  • Click edit button twice in gridview asp.net c# issue

    - by Supriyo Banerjee
    I have a gridview created on a page where I want to provide an edit button for the user to click in. However the issue is the grid view row becomes editable only while clicking the edit button second time. Not sure what is going wrong here, any help would be appreciated. One additional point is my grid view is displayed on the page only on a click of a button and is not there on page_load event hence. Posting the code snippets: //MY Aspx code <Columns> <asp:TemplateField HeaderText="Slice" SortExpression="name"> <ItemTemplate> <asp:Label ID="lblslice" Text='<%# Eval("slice") %>' runat="server"></asp:Label> </ItemTemplate> <EditItemTemplate> <asp:Label ID="lblslice" Text='<%# Eval("slice") %>' runat="server"></asp:Label> </EditItemTemplate> </asp:TemplateField> <asp:TemplateField HeaderText="Metric" SortExpression="Description"> <ItemTemplate> <asp:Label ID="lblmetric" Text='<%# Eval("metric")%>' runat="server"></asp:Label> </ItemTemplate> <EditItemTemplate> <asp:Label ID="lblmetric" Text='<%# Eval("metric")%>' runat="server"></asp:Label> </EditItemTemplate> </asp:TemplateField> <asp:TemplateField HeaderText="Original" SortExpression="Type"> <ItemTemplate> <asp:Label ID="lbloriginal" Text='<%# Eval("Original")%>' runat="server"></asp:Label> </ItemTemplate> <EditItemTemplate> <asp:Label ID="lbloriginal" Text='<%# Eval("Original")%>' runat="server"></asp:Label> </EditItemTemplate> </asp:TemplateField> <asp:TemplateField HeaderText="WOW" SortExpression="Market"> <ItemTemplate> <asp:Label ID="lblwow" Text='<%# Eval("WOW")%>' runat="server"></asp:Label> </ItemTemplate> <EditItemTemplate> <asp:Label ID="lblwow" Text='<%# Eval("WOW")%>' runat="server"></asp:Label> </EditItemTemplate> </asp:TemplateField> <asp:TemplateField HeaderText="Change" SortExpression="Market" > <ItemTemplate> <asp:Label ID="lblChange" Text='<%# Eval("Change")%>' runat="server"></asp:Label> </ItemTemplate> <EditItemTemplate> <asp:TextBox ID="TxtCustomerID" Text='<%# Eval("Change") %> ' runat="server"></asp:TextBox> </EditItemTemplate> </asp:TemplateField> <asp:CommandField HeaderText="Edit" ShowEditButton="True" /> </Columns> </asp:GridView> //My code behind: protected void Page_Load(object sender, EventArgs e) { } public void populagridview1(string slice,string fromdate,string todate,string year) { SqlCommand cmd; SqlDataAdapter da; DataSet ds; cmd = new SqlCommand(); cmd.CommandType = CommandType.StoredProcedure; cmd.CommandText = "usp_geteventchanges"; cmd.Connection = conn; conn.Open(); SqlParameter param1 = new SqlParameter("@slice", slice); cmd.Parameters.Add(param1); SqlParameter param2 = new SqlParameter("@fromdate", fromdate); cmd.Parameters.Add(param2); SqlParameter param3 = new SqlParameter("@todate", todate); cmd.Parameters.Add(param3); SqlParameter param4 = new SqlParameter("@year", year); cmd.Parameters.Add(param4); da = new SqlDataAdapter(cmd); ds = new DataSet(); da.Fill(ds, "Table"); GridView1.DataSource = ds; GridView1.DataBind(); conn.Close(); } protected void ImpactCalc(object sender, EventArgs e) { populagridview1(ddl_slice.SelectedValue, dt_to_integer(Picker1.Text), dt_to_integer(Picker2.Text), Txt_Year.Text); } protected void GridView1_RowEditing(object sender, GridViewEditEventArgs e) { gvEditIndex = e.NewEditIndex; Gridview1.DataBind(); } My page layout This edit screen appears after clicking edit twice.. the grid view gets displayed on hitting the Calculate impact button. The data is from a backend stored procedure which is fired on clicking the Calculate impact button

    Read the article

  • PyML 0.7.2 - How to prevent accuracy from dropping after stroing/loading a classifier?

    - by Michael Aaron Safyan
    This is a followup from "Save PyML.classifiers.multi.OneAgainstRest(SVM()) object?". The solution to that question was close, but not quite right, (the SparseDataSet is broken, so attempting to save/load with that dataset container type will fail, no matter what. Also, PyML is inconsistent in terms of whether labels should be numbers or strings... it turns out that the oneAgainstRest function is actually not good enough, because the labels need to be strings and simultaneously convertible to floats, because there are places where it is assumed to be a string and elsewhere converted to float) and so after a great deal of hacking and such I was finally able to figure out a way to save and load my multi-class classifier without it blowing up with an error.... however, although it is no longer giving me an error message, it is still not quite right as the accuracy of the classifier drops significantly when it is saved and then reloaded (so I'm still missing a piece of the puzzle). I am currently using the following custom mutli-class classifier for training, saving, and loading: class SVM(object): def __init__(self,features_or_filename,labels=None,kernel=None): if isinstance(features_or_filename,str): filename=features_or_filename; if labels!=None: raise ValueError,"Labels must be None if loading from a file."; with open(os.path.join(filename,"uniquelabels.list"),"rb") as uniquelabelsfile: self.uniquelabels=sorted(list(set(pickle.load(uniquelabelsfile)))); self.labeltoindex={}; for idx,label in enumerate(self.uniquelabels): self.labeltoindex[label]=idx; self.classifiers=[]; for classidx, classname in enumerate(self.uniquelabels): self.classifiers.append(PyML.classifiers.svm.loadSVM(os.path.join(filename,str(classname)+".pyml.svm"),datasetClass = PyML.VectorDataSet)); else: features=features_or_filename; if labels==None: raise ValueError,"Labels must not be None when training."; self.uniquelabels=sorted(list(set(labels))); self.labeltoindex={}; for idx,label in enumerate(self.uniquelabels): self.labeltoindex[label]=idx; points = [[float(xij) for xij in xi] for xi in features]; self.classifiers=[PyML.SVM(kernel) for label in self.uniquelabels]; for i in xrange(len(self.uniquelabels)): currentlabel=self.uniquelabels[i]; currentlabels=['+1' if k==currentlabel else '-1' for k in labels]; currentdataset=PyML.VectorDataSet(points,L=currentlabels,positiveClass='+1'); self.classifiers[i].train(currentdataset,saveSpace=False); def accuracy(self,pts,labels): logger=logging.getLogger("ml"); correct=0; total=0; classindexes=[self.labeltoindex[label] for label in labels]; h=self.hypotheses(pts); for idx in xrange(len(pts)): if h[idx]==classindexes[idx]: logger.info("RIGHT: Actual \"%s\" == Predicted \"%s\"" %(self.uniquelabels[ classindexes[idx] ], self.uniquelabels[ h[idx] ])); correct+=1; else: logger.info("WRONG: Actual \"%s\" != Predicted \"%s\"" %(self.uniquelabels[ classindexes[idx] ], self.uniquelabels[ h[idx] ])) total+=1; return float(correct)/float(total); def prediction(self,pt): h=self.hypothesis(pt); if h!=None: return self.uniquelabels[h]; return h; def predictions(self,pts): h=self.hypotheses(self,pts); return [self.uniquelabels[x] if x!=None else None for x in h]; def hypothesis(self,pt): bestvalue=None; bestclass=None; dataset=PyML.VectorDataSet([pt]); for classidx, classifier in enumerate(self.classifiers): val=classifier.decisionFunc(dataset,0); if (bestvalue==None) or (val>bestvalue): bestvalue=val; bestclass=classidx; return bestclass; def hypotheses(self,pts): bestvalues=[None for pt in pts]; bestclasses=[None for pt in pts]; dataset=PyML.VectorDataSet(pts); for classidx, classifier in enumerate(self.classifiers): for ptidx in xrange(len(pts)): val=classifier.decisionFunc(dataset,ptidx); if (bestvalues[ptidx]==None) or (val>bestvalues[ptidx]): bestvalues[ptidx]=val; bestclasses[ptidx]=classidx; return bestclasses; def save(self,filename): if not os.path.exists(filename): os.makedirs(filename); with open(os.path.join(filename,"uniquelabels.list"),"wb") as uniquelabelsfile: pickle.dump(self.uniquelabels,uniquelabelsfile,pickle.HIGHEST_PROTOCOL); for classidx, classname in enumerate(self.uniquelabels): self.classifiers[classidx].save(os.path.join(filename,str(classname)+".pyml.svm")); I am using the latest version of PyML (0.7.2, although PyML.__version__ is 0.7.0). When I construct the classifier with a training dataset, the reported accuracy is ~0.87. When I then save it and reload it, the accuracy is less than 0.001. So, there is something here that I am clearly not persisting correctly, although what that may be is completely non-obvious to me. Would you happen to know what that is?

    Read the article

  • problem in displaying list using array adapters

    - by Rahul Varma
    Hi, I am trying to display the list of songs using array adapters. But the problem is i couldnt display the list and only empty screen with preset background is showing up. Here's the code...All the thee are seperate classes... Plz help me... public class SongsAdapter extends ArrayAdapter<SongsList>{ private Context context; TextView tvTitle; TextView tvMovie; TextView tvSinger; String s; public SongsAdapter(Context context, int resource, int textViewResourceId, String title) { super(context, resource, textViewResourceId); this.context=context; } public View getView(int position, View convertView, ViewGroup parent) { final int i=position; List<SongsList> listSongs = new ArrayList<SongsList>(); String title = listSongs.get(i).gettitleName().toString(); String album = listSongs.get(i).getmovieName().toString(); String artist = listSongs.get(i).getsingerName().toString(); String imgal = listSongs.get(i).gettitleName().toString(); LayoutInflater inflater = ((Activity) context).getLayoutInflater(); View v = inflater.inflate(R.layout.row, null); tvTitle=(TextView)v.findViewById(R.id.text2); tvMovie=(TextView)v.findViewById(R.id.text3); tvSinger=(TextView)v.findViewById(R.id.text1); tvTitle.setText(title); tvMovie.setText(album); tvSinger.setText(artist); final ImageView im=(ImageView)v.findViewById(R.id.image); s="http://www.gorinka.com/"+imgal; String imgPath=s; AsyncImageLoaderv asyncImageLoaderv=new AsyncImageLoaderv(); Bitmap cachedImage = asyncImageLoaderv.loadDrawable(imgPath, new AsyncImageLoaderv.ImageCallback() { public void imageLoaded(Bitmap imageDrawable, String imageUrl) { im.setImageBitmap(imageDrawable); } }); im.setImageBitmap(cachedImage); return v; } public class imageloader implements Runnable{ private String ss; private ImageView im; public imageloader(String s, ImageView im) { this.ss=s; this.im=im; Thread thread = new Thread(this); thread.start(); } public void run(){ try { HttpGet httpRequest = null; httpRequest = new HttpGet(ss); HttpClient httpclient = new DefaultHttpClient(); HttpResponse response = (HttpResponse) httpclient.execute(httpRequest); HttpEntity entity = response.getEntity(); BufferedHttpEntity bufHttpEntity = new BufferedHttpEntity(entity); InputStream is = bufHttpEntity.getContent(); Bitmap bm = BitmapFactory.decodeStream(is); Log.d("img","img"); is.close(); im.setImageBitmap(bm); } catch (Exception t) { Log.e("bitmap url", "Exception in updateStatus()", t); } } } } public class SongsList { private String titleName; private String movieName; private String singerName; private String imagePath; private String mediaPath; // Constructor for the SongsList class public SongsList(String titleName, String movieName, String singerName,String imagePath,String mediaPath ) { super(); this.titleName = titleName; this.movieName = movieName; this.singerName = singerName; this.imagePath = imagePath; this.mediaPath = mediaPath; } public String gettitleName() { return titleName; } public void settitleName(String titleName) { this.titleName = titleName; } public String getmovieName() { return movieName; } public void setmovieName(String movieName) { this.movieName = movieName; } public String getsingerName() { return singerName; } public void setsingerName(String singerName) { this.singerName = singerName; } public String getimagePath() { return imagePath; } public void setimagePath(String imagePath) { this.imagePath = imagePath; } public String getmediaPath() { return mediaPath; } public void setmediaPath(String mediaPath) { this.mediaPath = mediaPath; } } public class MusicListActivity extends Activity { @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.openadiuofile); ListView list = (ListView)findViewById(R.id.list1); SongsAdapter adapter = new SongsAdapter(this,R.layout.row, R.id.text2, null); list.setAdapter(adapter); } }

    Read the article

  • Neural Network Always Produces Same/Similar Outputs for Any Input

    - by l33tnerd
    I have a problem where I am trying to create a neural network for Tic-Tac-Toe. However, for some reason, training the neural network causes it to produce nearly the same output for any given input. I did take a look at Artificial neural networks benchmark, but my network implementation is built for neurons with the same activation function for each neuron, i.e. no constant neurons. To make sure the problem wasn't just due to my choice of training set (1218 board states and moves generated by a genetic algorithm), I tried to train the network to reproduce XOR. The logistic activation function was used. Instead of using the derivative, I multiplied the error by output*(1-output) as some sources suggested that this was equivalent to using the derivative. I can put the Haskell source on HPaste, but it's a little embarrassing to look at. The network has 3 layers: the first layer has 2 inputs and 4 outputs, the second has 4 inputs and 1 output, and the third has 1 output. Increasing to 4 neurons in the second layer didn't help, and neither did increasing to 8 outputs in the first layer. I then calculated errors, network output, bias updates, and the weight updates by hand based on http://hebb.mit.edu/courses/9.641/2002/lectures/lecture04.pdf to make sure there wasn't an error in those parts of the code (there wasn't, but I will probably do it again just to make sure). Because I am using batch training, I did not multiply by x in equation (4) there. I am adding the weight change, though http://www.faqs.org/faqs/ai-faq/neural-nets/part2/section-2.html suggests to subtract it instead. The problem persisted, even in this simplified network. For example, these are the results after 500 epochs of batch training and of incremental training. Input |Target|Output (Batch) |Output(Incremental) [1.0,1.0]|[0.0] |[0.5003781562785173]|[0.5009731800870864] [1.0,0.0]|[1.0] |[0.5003740346965251]|[0.5006347214672715] [0.0,1.0]|[1.0] |[0.5003734471544522]|[0.500589332376345] [0.0,0.0]|[0.0] |[0.5003674110937019]|[0.500095157458231] Subtracting instead of adding produces the same problem, except everything is 0.99 something instead of 0.50 something. 5000 epochs produces the same result, except the batch-trained network returns exactly 0.5 for each case. (Heck, even 10,000 epochs didn't work for batch training.) Is there anything in general that could produce this behavior? Also, I looked at the intermediate errors for incremental training, and the although the inputs of the hidden/input layers varied, the error for the output neuron was always +/-0.12. For batch training, the errors were increasing, but extremely slowly and the errors were all extremely small (x10^-7). Different initial random weights and biases made no difference, either. Note that this is a school project, so hints/guides would be more helpful. Although reinventing the wheel and making my own network (in a language I don't know well!) was a horrible idea, I felt it would be more appropriate for a school project (so I know what's going on...in theory, at least. There doesn't seem to be a computer science teacher at my school). EDIT: Two layers, an input layer of 2 inputs to 8 outputs, and an output layer of 8 inputs to 1 output, produces much the same results: 0.5+/-0.2 (or so) for each training case. I'm also playing around with pyBrain, seeing if any network structure there will work. Edit 2: I am using a learning rate of 0.1. Sorry for forgetting about that. Edit 3: Pybrain's "trainUntilConvergence" doesn't get me a fully trained network, either, but 20000 epochs does, with 16 neurons in the hidden layer. 10000 epochs and 4 neurons, not so much, but close. So, in Haskell, with the input layer having 2 inputs & 2 outputs, hidden layer with 2 inputs and 8 outputs, and output layer with 8 inputs and 1 output...I get the same problem with 10000 epochs. And with 20000 epochs. Edit 4: I ran the network by hand again based on the MIT PDF above, and the values match, so the code should be correct unless I am misunderstanding those equations. Some of my source code is at http://hpaste.org/42453/neural_network__not_working; I'm working on cleaning my code somewhat and putting it in a Github (rather than a private Bitbucket) repository. All of the relevant source code is now at https://github.com/l33tnerd/hsann.

    Read the article

  • How do I use texture-mapping in a simple ray tracer?

    - by fastrack20
    I am attempting to add features to a ray tracer in C++. Namely, I am trying to add texture mapping to the spheres. For simplicity, I am using an array to store the texture data. I obtained the texture data by using a hex editor and copying the correct byte values into an array in my code. This was just for my testing purposes. When the values of this array correspond to an image that is simply red, it appears to work close to what is expected except there is no shading. The bottom right of the image shows what a correct sphere should look like. This sphere's colour using one set colour, not a texture map. Another problem is that when the texture map is of something other than just one colour pixels, it turns white. My test image is a picture of water, and when it maps, it shows only one ring of bluish pixels surrounding the white colour. When this is done, it simply appears as this: Here are a few code snippets: Color getColor(const Object *object,const Ray *ray, float *t) { if (object->materialType == TEXTDIF || object->materialType == TEXTMATTE) { float distance = *t; Point pnt = ray->origin + ray->direction * distance; Point oc = object->center; Vector ve = Point(oc.x,oc.y,oc.z+1) - oc; Normalize(&ve); Vector vn = Point(oc.x,oc.y+1,oc.z) - oc; Normalize(&vn); Vector vp = pnt - oc; Normalize(&vp); double phi = acos(-vn.dot(vp)); float v = phi / M_PI; float u; float num1 = (float)acos(vp.dot(ve)); float num = (num1 /(float) sin(phi)); float theta = num /(float) (2 * M_PI); if (theta < 0 || theta == NAN) {theta = 0;} if (vn.cross(ve).dot(vp) > 0) { u = theta; } else { u = 1 - theta; } int x = (u * IMAGE_WIDTH) -1; int y = (v * IMAGE_WIDTH) -1; int p = (y * IMAGE_WIDTH + x)*3; return Color(TEXT_DATA[p+2],TEXT_DATA[p+1],TEXT_DATA[p]); } else { return object->color; } }; I call the colour code here in Trace: if (object->materialType == MATTE) return getColor(object, ray, &t); Ray shadowRay; int isInShadow = 0; shadowRay.origin.x = pHit.x + nHit.x * bias; shadowRay.origin.y = pHit.y + nHit.y * bias; shadowRay.origin.z = pHit.z + nHit.z * bias; shadowRay.direction = light->object->center - pHit; float len = shadowRay.direction.length(); Normalize(&shadowRay.direction); float LdotN = shadowRay.direction.dot(nHit); if (LdotN < 0) return 0; Color lightColor = light->object->color; for (int k = 0; k < numObjects; k++) { if (Intersect(objects[k], &shadowRay, &t) && !objects[k]->isLight) { if (objects[k]->materialType == GLASS) lightColor *= getColor(objects[k], &shadowRay, &t); // attenuate light color by glass color else isInShadow = 1; break; } } lightColor *= 1.f/(len*len); return (isInShadow) ? 0 : getColor(object, &shadowRay, &t) * lightColor * LdotN; } I left out the rest of the code as to not bog down the post, but it can be seen here. Any help is greatly appreciated. The only portion not included in the code, is where I define the texture data, which as I said, is simply taken straight from a bitmap file of the above image. Thanks.

    Read the article

  • Reworking my singly linked list

    - by Stradigos
    Hello everyone, thanks for taking the time to stop by my question. Below you will find my working SLL, but I want to make more use of C# and, instead of having two classes, SLL and Node, I want to use Node's constructors to do all the work (To where if you pass a string through the node, the constructor will chop it up into char nodes). The problem is, after an a few hours of tinkering, I'm not really getting anywhere... using System; using System.Collections.Generic; using System.Text; using System.IO; namespace PalindromeTester { class Program { static void Main(string[] args) { SLL mySLL = new SLL(); mySLL.add('a'); mySLL.add('b'); mySLL.add('c'); mySLL.add('d'); mySLL.add('e'); mySLL.add('f'); Console.Out.WriteLine("Node count = " + mySLL.count); mySLL.reverse(); mySLL.traverse(); Console.Out.WriteLine("\n The header is: " + mySLL.gethead); Console.In.ReadLine(); } class Node { private char letter; private Node next; public Node() { next = null; } public Node(char c) { this.data = c; } public Node(string s) { } public char data { get { return letter; } set { letter = value; } } public Node nextNode { get { return next; } set { next = value; } } } class SLL { private Node head; private int totalNode; public SLL() { head = null; totalNode = 0; } public void add(char s) { if (head == null) { head = new Node(); head.data = s; } else { Node temp; temp = new Node(); temp.data = s; temp.nextNode = head; head = temp; } totalNode++; } public int count { get { return totalNode; } } public char gethead { get { return head.data; } } public void traverse() { Node temp = head; while(temp != null) { Console.Write(temp.data + " "); temp = temp.nextNode; } } public void reverse() { Node q = null; Node p = this.head; while(p!=null) { Node r=p; p=p.nextNode; r.nextNode=q; q=r; } this.head = q; } } } } Here's what I have so far in trying to work it into Node's constructors: using System; using System.Collections.Generic; using System.Text; using System.IO; namespace PalindromeTester { class Program { static void Main(string[] args) { //Node myList = new Node(); //TextReader tr = new StreamReader("data.txt"); //string line; //while ((line = tr.ReadLine()) != null) //{ // Console.WriteLine(line); //} //tr.Close(); Node myNode = new Node("hello"); Console.Out.WriteLine(myNode.count); myNode.reverse(); myNode.traverse(); // Console.Out.WriteLine(myNode.gethead); Console.In.ReadLine(); } class Node { private char letter; private Node next; private Node head; private int totalNode; public Node() { head = null; totalNode = 0; } public Node(char c) { if (head == null) { head = new Node(); head.data = c; } else { Node temp; temp = new Node(); temp.data = c; temp.nextNode = head; head = temp; } totalNode++; } public Node(string s) { foreach (char x in s) { new Node(x); } } public char data { get { return letter; } set { letter = value; } } public Node nextNode { get { return next; } set { next = value; } } public void reverse() { Node q = null; Node p = this.head; while (p != null) { Node r = p; p = p.nextNode; r.nextNode = q; q = r; } this.head = q; } public void traverse() { Node temp = head; while (temp != null) { Console.Write(temp.data + " "); temp = temp.nextNode; } } public int count { get { return totalNode; } } } } } Ideally, the only constructors and methods I would be left with are Node(), Node(char c), Node(string s), Node reserve() and I'll be reworking traverse into a ToString overload. Any suggestions?

    Read the article

  • Hibernate error: cannot resolve table

    - by Roman
    I'm trying to make work the example from hibernate reference. I've got simple table Pupil with id, name and age fields. I've created correct (as I think) java-class for it according to all java-beans rules. I've created configuration file - hibernate.cfg.xml, just like in the example from reference. I've created hibernate mapping for one class Pupil, and here is the error occured. <hibernate-mapping> <class name="Pupil" table="pupils"> ... </class> </hibernate-mapping> table="pupils" is red in my IDE and I see message "cannot resolve table pupils". I've also founded very strange note in reference which says that most users fail with the same problem trying to run the example. Ah.. I'm very angry with this example.. IMHO if authors know that there is such problem they should add some information about it. But, how should I fix it? I don't want to deal with Ant here and with other instruments used in example. I'm using MySql 5.0, but I think it doesn't matter. UPD: source code Pupil.java - my persistent class package domain; public class Pupil { private Integer id; private String name; private Integer age; protected Pupil () { } public Pupil (String name, int age) { this.age = age; this.name = name; } public Integer getId () { return id; } public void setId (Integer id) { this.id = id; } public String getName () { return name; } public void setName (String name) { this.name = name; } public Integer getAge () { return age; } public void setAge (Integer age) { this.age = age; } public String toString () { return "Pupil [ name = " + name + ", age = " + age + " ]"; } } Pupil.hbm.xml is mapping for this class <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="domain" > <class name="Pupil" table="pupils"> <id name="id"> <generator class="native" /> </id> <property name="name" not-null="true"/> <property name="age"/> </class> </hibernate-mapping> hibernate.cfg.xml - configuration for hibernate <hibernate-configuration> <session-factory> <!-- Database connection settings --> <property name="connection.driver_class">com.mysql.jdbc.Driver</property> <property name="connection.url">jdbc:mysql://localhost/hbm_test</property> <property name="connection.username">root</property> <property name="connection.password">root</property> <property name="connection.pool_size">1</property> <property name="dialect">org.hibernate.dialect.MySQL5Dialect</property> <property name="current_session_context_class">thread</property> <property name="show_sql">true</property> <mapping resource="domain/Pupil.hbm.xml"/> </session-factory> </hibernate-configuration> HibernateUtils.java package utils; import org.hibernate.SessionFactory; import org.hibernate.HibernateException; import org.hibernate.cfg.Configuration; public class HibernateUtils { private static final SessionFactory sessionFactory; static { try { sessionFactory = new Configuration ().configure ().buildSessionFactory (); } catch (HibernateException he) { System.err.println (he); throw new ExceptionInInitializerError (he); } } public static SessionFactory getSessionFactory () { return sessionFactory; } } Runner.java - class for testing hibernate import org.hibernate.Session; import java.util.*; import utils.HibernateUtils; import domain.Pupil; public class Runner { public static void main (String[] args) { Session s = HibernateUtils.getSessionFactory ().getCurrentSession (); s.beginTransaction (); List pups = s.createQuery ("from Pupil").list (); for (Object obj : pups) { System.out.println (obj); } s.getTransaction ().commit (); HibernateUtils.getSessionFactory ().close (); } } My libs: antlr-2.7.6.jar, asm.jar, asm-attrs.jar, cglib-2.1.3.jar, commons-collections-2.1.1.jar, commons-logging-1.0.4.jar, dom4j-1.6.1.jar, hibernate3.jar, jta.jar, log4j-1.2.11.jar, mysql-connector-java-5.1.7-bin.jar Compile error: cannot resolve table pupils

    Read the article

  • Servlet dispatcher is currently unavailable

    - by theJava
    <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:p="http://www.springframework.org/schema/p" xsi:schemaLocation="http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans.xsd"> <bean id="viewResolver" class="org.springframework.web.servlet.view.InternalResourceViewResolver" p:prefix="/WEB-INF/jsp/" p:suffix=".jsp" /> <bean id="myDataSource" class="org.apache.commons.dbcp.BasicDataSource" destroy-method="close"> <property name="driverClassName" value="com.mysql.jdbc.Driver"/> <property name="url" value="jdbc:mysql://127.0.0.1:3306/spring"/> <property name="username" value="monty"/> <property name="password" value="indian"/> </bean> <bean id="mySessionFactory" class="org.springframework.orm.hibernate3.annotation.AnnotationSessionFactoryBean"> <property name="dataSource" ref="myDataSource" /> <property name="annotatedClasses"> <list> <value>uk.co.vinoth.spring.domain.User</value> </list> </property> <property name="hibernateProperties"> <props> <prop key="hibernate.dialect">org.hibernate.dialect.MySQLDialect</prop> <prop key="hibernate.show_sql">true</prop> <prop key="hibernate.hbm2ddl.auto">create</prop> </props> </property> </bean> <bean id="myUserDAO" class="uk.co.vinoth.spring.dao.UserDAOImpl"> <property name="sessionFactory" ref="mySessionFactory"/> </bean> <bean name="/user/*.htm" class="uk.co.vinoth.spring.web.UserController" > <property name="userDAO" ref="myUserDAO" /> </bean> </beans> The above is my bean configuration, why do i get error when i run my application. My logs folder is empty... org.apache.catalina.loader.StandardClassLoader@122c9df org.springframework.web.servlet.DispatcherServlet java.lang.ClassNotFoundException: org.springframework.web.servlet.DispatcherServlet at org.apache.catalina.loader.WebappClassLoader.loadClass(WebappClassLoader.java:1436) at org.apache.catalina.loader.WebappClassLoader.loadClass(WebappClassLoader.java:1282) at org.apache.catalina.core.StandardWrapper.loadServlet(StandardWrapper.java:1068) at org.apache.catalina.core.StandardWrapper.load(StandardWrapper.java:966) at org.apache.catalina.core.StandardContext.loadOnStartup(StandardContext.java:3996) at org.apache.catalina.core.StandardContext.start(StandardContext.java:4266) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1014) at org.apache.catalina.core.StandardHost.start(StandardHost.java:736) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1014) at org.apache.catalina.core.StandardEngine.start(StandardEngine.java:443) at org.apache.catalina.core.StandardService.start(StandardService.java:448) at org.apache.catalina.core.StandardServer.start(StandardServer.java:700) at org.apache.catalina.startup.Catalina.start(Catalina.java:552) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at org.apache.catalina.startup.Bootstrap.start(Bootstrap.java:295) at org.apache.catalina.startup.Bootstrap.main(Bootstrap.java:433) Dec 22, 2010 3:44:48 PM org.apache.catalina.core.StandardContext loadOnStartup SEVERE: Servlet /interMedix threw load() exception java.lang.ClassNotFoundException: org.springframework.web.servlet.DispatcherServlet at org.apache.catalina.loader.WebappClassLoader.loadClass(WebappClassLoader.java:1436) at org.apache.catalina.loader.WebappClassLoader.loadClass(WebappClassLoader.java:1282) at org.apache.catalina.core.StandardWrapper.loadServlet(StandardWrapper.java:1068) at org.apache.catalina.core.StandardWrapper.load(StandardWrapper.java:966) at org.apache.catalina.core.StandardContext.loadOnStartup(StandardContext.java:3996) at org.apache.catalina.core.StandardContext.start(StandardContext.java:4266) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1014) at org.apache.catalina.core.StandardHost.start(StandardHost.java:736) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1014) at org.apache.catalina.core.StandardEngine.start(StandardEngine.java:443) at org.apache.catalina.core.StandardService.start(StandardService.java:448) at org.apache.catalina.core.StandardServer.start(StandardServer.java:700) at org.apache.catalina.startup.Catalina.start(Catalina.java:552) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at org.apache.catalina.startup.Bootstrap.start(Bootstrap.java:295) at org.apache.catalina.startup.Bootstrap.main(Bootstrap.java:433) Dec 22, 2010 3:44:48 PM org.apache.coyote.http11.Http11BaseProtocol start INFO: Starting Coyote HTTP/1.1 on http-8181 Dec 22, 2010 3:44:48 PM org.apache.jk.common.ChannelSocket init INFO: JK: ajp13 listening on /0.0.0.0:8009 Dec 22, 2010 3:44:48 PM org.apache.jk.server.JkMain start INFO: Jk running ID=0 time=0/27 config=null Dec 22, 2010 3:44:48 PM org.apache.catalina.storeconfig.StoreLoader load INFO: Find registry server-registry.xml at classpath resource Dec 22, 2010 3:44:49 PM org.apache.catalina.startup.Catalina start INFO: Server startup in 558 ms Dec 22, 2010 3:44:50 PM org.apache.catalina.core.StandardWrapperValve invoke INFO: Servlet dispatcher is currently unavailable Dec 22, 2010 3:50:18 PM org.apache.catalina.core.StandardWrapperValve invoke INFO: Servlet dispatcher is currently unavailable But i have added spring-web-mvc to my class path which does contain this class file.

    Read the article

  • Animation issue caused by C# parameters passed by reference rather than value, but where?

    - by Jordan Roher
    I'm having trouble with sprite animation in XNA that appears to be caused by a struct passed as a reference value. But I'm not using the ref keyword anywhere. I am, admittedly, a C# noob, so there may be some shallow bonehead error in here, but I can't see it. I'm creating 10 ants or bees and animating them as they move across the screen. I have an array of animation structs, and each time I create an ant or bee, I send it the animation array value it requires (just [0] or [1] at this time). Deep inside the animation struct is a timer that is used to change frames. The ant/bee class stores the animation struct as a private variable. What I'm seeing is that each ant or bee uses the same animation struct, the one I thought I was passing in and copying by value. So during Update(), when I advance the animation timer for each ant/bee, the next ant/bee has its animation timer advanced by that small amount. If there's 1 ant on screen, it animates properly. 2 ants, it runs twice as fast, and so on. Obviously, not what I want. Here's an abridged version of the code. How is BerryPicking's ActorAnimationGroupData[] getting shared between the BerryCreatures? class BerryPicking { private ActorAnimationGroupData[] animations; private BerryCreature[] creatures; private Dictionary<string, Texture2D> creatureTextures; private const int maxCreatures = 5; public BerryPickingExample() { this.creatures = new BerryCreature[maxCreatures]; this.creatureTextures = new Dictionary<string, Texture2D>(); } public void LoadContent() { // Returns data from an XML file Reader reader = new Reader(); animations = reader.LoadAnimations(); CreateCreatures(); } // This is called from another function I'm not including because it's not relevant to the problem. // In it, I remove any creature that passes outside the viewport by setting its creatures[] spot to null. // Hence the if(creatures[i] == null) test is used to recreate "dead" creatures. Inelegant, I know. private void CreateCreatures() { for (int i = 0; i < creatures.Length; i++) { if (creatures[i] == null) { // In reality, the name selection is randomized creatures[i] = new BerryCreature("ant"); // Load content and texture (which I create elsewhere) creatures[i].LoadContent( FindAnimation(creatures[i].Name), creatureTextures[creatures[i].Name]); } } } private ActorAnimationGroupData FindAnimation(string animationName) { int yourAnimation = -1; for (int i = 0; i < animations.Length; i++) { if (animations[i].name == animationName) { yourAnimation = i; break; } } return animations[yourAnimation]; } public void Update(GameTime gameTime) { for (int i = 0; i < creatures.Length; i++) { creatures[i].Update(gameTime); } } } class Reader { public ActorAnimationGroupData[] LoadAnimations() { ActorAnimationGroupData[] animationGroup; XmlReader file = new XmlTextReader(filename); // Do loading... // Then later file.Close(); return animationGroup; } } class BerryCreature { private ActorAnimation animation; private string name; public BerryCreature(string name) { this.name = name; } public void LoadContent(ActorAnimationGroupData animationData, Texture2D sprite) { animation = new ActorAnimation(animationData); animation.LoadContent(sprite); } public void Update(GameTime gameTime) { animation.Update(gameTime); } } class ActorAnimation { private ActorAnimationGroupData animation; public ActorAnimation(ActorAnimationGroupData animation) { this.animation = animation; } public void LoadContent(Texture2D sprite) { this.sprite = sprite; } public void Update(GameTime gameTime) { animation.Update(gameTime); } } struct ActorAnimationGroupData { // There are lots of other members of this struct, but the timer is the only one I'm worried about. // TimerData is another struct private TimerData timer; public ActorAnimationGroupData() { timer = new TimerData(2); } public void Update(GameTime gameTime) { timer.Update(gameTime); } } struct TimerData { public float currentTime; public float maxTime; public TimerData(float maxTime) { this.currentTime = 0; this.maxTime = maxTime; } public void Update(GameTime gameTime) { currentTime += (float)gameTime.ElapsedGameTime.TotalSeconds; if (currentTime >= maxTime) { currentTime = maxTime; } } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 438 439 440 441 442 443 444 445 446 447 448 449  | Next Page >