Search Results

Search found 17715 results on 709 pages for 'regular language'.

Page 442/709 | < Previous Page | 438 439 440 441 442 443 444 445 446 447 448 449  | Next Page >

  • NSString: EOL and rangeOfString issues

    - by carloe
    Could someone please tell me if I am missing something here... I am trying to parse individual JSON objects out of a data stream. The data stream is buffered in a regular NSString, and the individual JSON objects are delineated by a EOL marker. if([dataBuffer rangeOfString:@"\n"].location != NSNotFound) { NSString *tmp = [dataBuffer stringByReplacingOccurrencesOfString:@"\n" withString:@"NEWLINE"]; NSLog(@"%@", tmp); } The code above outputs "...}NEWLINE{..." as expected. But if I change the @"\n" in the if-statement above to @"}\n", I get nothing.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Getting Unit Tests to work with Komodo IDE for Python

    - by devoured elysium
    I've tried to run the following code on Komodo IDE (for python): import unittest class MathLibraryTests(unittest.TestCase): def test1Plus1Equals2(self): self.assertEqual(1+1, 2) Then, I created a new test plan, pointing to this project(file) directory and tried to run it the test plan. It seems to run but it doesn't seem to find any tests. If I try to run the following code with the "regular" run command (F7) class MathLibraryTests(unittest.TestCase): def testPlus1Equals2(self): self.assertEqual(1+1, 2) if __name__ == "__main__": unittest.main() it works. I get the following output: ---------------------------------------------------------------------- Ran 1 test in 0.000s OK What might I be doing wrong?

    Read the article

  • question about frequency of updating access

    - by I__
    i have a table in an access database this access database is used on a regular basis, basically from 9-5 someone else has a copy of this exact table. sometimes records are added, sometimes deleted, and sometimes data within the records is updated. i need to update the access database table with the offsite table every hour or so. what is the best algorithm of updating the data? there are about 5000 records. would it severely lock up the table for a few seconds every hour? i would like to publicly apologize for my rude comment to david fenton

    Read the article

  • Numbering Regex Submatches

    - by gentlylisped
    Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

    Read the article

  • Translate a webpage in PHP

    - by Rob
    I'm looking to translate a webpage in PHP 5 so I can save the translation and make it easily accessible via mydomain.com/lang/fr/category/article.html rather than users having to go through google translate. I've found various easy ways to translate text via CURL, however what i'd really like to be able to do is translate an entire webpage but obviously ignore the tags. The problem is that Google Translate messes up all the HTML tags, class names etc Does anyone know of a php class that can translate an entire webpage whilst ignoring the tags? I'm guessing it may be possible via advanced regular expressions or something like that, but i'm not sure. I can't just curl Google's response as i'll have all the extra JS that they put in. Any ideas?

    Read the article

  • Invoking play on a QTMovie causes screensaver to deactivate on Snow Leopard

    - by ressaw
    I'm trying to port a working Leopard screensaver to Snow Leopard but it's deactivating after about half a second. The screensaver seems to deactivate upon invoking play on a QTMovie. And it deactivates both upon -play on the QTMovie object itself, and -play:self on the QTMovieView. If I don't actually call -play on the object, the screensaver does not deactivate and sits still on the first frame of the movie. Setting up the same code in a regular Cocoa Application works fine, and the screensaver also works fine in preview mode in the System Preferences. Any help is greatly appreciated.

    Read the article

  • Lamp with mod_fastcgi

    - by Jonathan
    Hi! I am building a cgi application, and now I would like it to be like an application that stands and parses each connection, with this, I can have all session variables saved in memory instead of saving them to file(or anyother place) and loading them again on a new connection I am using lamp within a linux vmware but I can't seem to find how to install the module for it to work and what to change in the httpd.conf. I tried to compile the module, but I couldn't because my apache isn't a regular instalation, its a lamp already built one, and it seems that the mod needs the apache directory to be compiled. I saw some coding examples out there, so I guess is not that hard once its runing ok with Apache Can you help me with this please? Thanks, Joe

    Read the article

  • Trying to create text boxes dynammically and remove them

    - by fari
    I am using VB.NET vb 2008 . I am trying to create text boxes dynammically and remove them here is the code i have written so far Private Sub setTextBox() Dim num As Integer Dim pos As Integer num = Len(word) temp = String.Copy(word) Dim intcount As Integer remove() GuessBox.Visible = True letters.Visible = True pos = 0 'To create the dynamic text box and add the controls For intcount = 0 To num - 1 Txtdynamic = New TextBox Txtdynamic.Width = 20 Txtdynamic.Visible = True Txtdynamic.MaxLength = 1 Txtdynamic.Location = New Point(pos + 5, 0) pos = pos + 30 'set the font size Txtdynamic.Font = New System.Drawing.Font("Verdana", 8.25!, System.Drawing.FontStyle.Regular, System.Drawing.GraphicsUnit.Point, CType(0, Byte)) Txtdynamic.Name = "txtdynamic_" & intcount & "_mycntrl" Txtdynamic.Enabled = False Txtdynamic.Text = "" Panel1.Controls.Add(Txtdynamic) Next Panel1.Visible = True Controls.Add(Panel1) Controls.Add(GuessBox) Controls.Add(letters) letter = "" letters.Text = "" hang_lable.Text = "" tries = 0 End Sub`enter code here` Function remove() For Each ctrl In Panel1.Controls Panel1.Controls.Remove(ctrl) Next End Function I am able to create the textboxes but only a few of them are removed. by using For Each ctrl In Panel1.Controls it doesn't retrieve all the controls and some ae duplicated as well.

    Read the article

  • Intercept web requests from a WebView Flash plugin

    - by starkos
    I've got a desktop browser app which uses a WebView to host a Flash plugin. The Flash plugin makes regular requests to an external website for new data, which it then draws as fancy graphics. I'd like to intercept these web requests and get at the data (so I can display it via Growl, instead of keeping a desktop window around). But best I can tell, requests made by Flash don't get picked up by the normal WebView delegates. Is there another place I can set a hook? I tried installing a custom NSURLCache via [NSURLCache setSharedURLCache] but that never got called. I also tried method swizzling a few of the other classes (like NSCachedURLResponse) but couldn't find a way in. Any ideas? Many thanks!

    Read the article

  • Open C: Directly with `FileStream` without `CreateFile` API

    - by DxCK
    I trying to open C: directly with FileStream without success: new FileStream("C:", FileMode.Open, FileAccess.Read, FileShare.ReadWrite); System.UnauthorizedAccessException was unhandled Message="Access to the path 'C:\' is denied." Source="mscorlib" StackTrace: in System.IO.__Error.WinIOError(Int32 errorCode, String maybeFullPath) in System.IO.FileStream.Init(String path, FileMode mode, FileAccess access, Int32 rights, Boolean useRights, FileShare share, Int32 bufferSize, FileOptions options, SECURITY_ATTRIBUTES secAttrs, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share, Int32 bufferSize, FileOptions options, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share) in ReadingMftNewTest.Program.Main(String[] args) in D:\CS\2008\ReadingMftNewTest\ReadingMftNewTest\Program.cs:line 76 Note that i openning "C:" but the error says "C:\", where did this slash came from? :\ Is there any chance to open C: without using the CreateFile API? I really don't want be depending on WIN32 API because this code should also run on Mono that dont support WIN32 API, but successfully openning devices with regular FileStream (Mono 1 Microsoft 0).

    Read the article

  • Getting "on the wire" Size of Messages in WCF

    - by Mystagogue
    While I'm making SOAP or REST invocations to WCF, I'd like to have the channel stack on either end (client and server) record the on-the-wire size of the data received. So I'm guessing I need to add a custom behavior to the channel stack on either side. That is, on the server side I'd record the IP-header advertised size that was received. On the client side I'd record the IP-header advertised size that was returned from the server. But this presupposes that this information is visible to a custom WCF behavior at the channel stack level. Perhaps it is only visible at the level of ASP.NET (at a layer beneath WCF)? In short, does anyone have any further insight on if and how this information is accessible? I must qualify that this "size" data will be collected in a production environment, as part of regular business logic calls. This question is related to my earlier bandwidth question.

    Read the article

  • Is it possible to force ignore the :hover pseudoclass for iPhone/iPad users?

    - by christophercamps
    I have some css menus on my site that expand with :hover (without js) This works in a semi-broken way on iDevices, for example a tap will activate the :hover rule and expand the menu, but then tapping elsewhere doesn't remove the :hover. Also if there is a link inside the element that is :hover'ed, you have to tap twice to activate the link (first tap triggers :hover, second tap triggers link). I've been able to make things work nicely on iphone by binding the touchstart event. The problem is that sometimes mobile safari still chooses to trigger the :hover rule from the css instead of my touchstart events! I know this is the problem because when I disable all the :hover rules manually in the css, mobile safari works great (but regular browsers obviously don't anymore). Is there a way to dynamically "cancel" :hover rules for certain elements when the user is on mobile safari? I'm using jQuery.

    Read the article

  • How can I build a Truth Table Generator?

    - by KingNestor
    I'm looking to write a Truth Table Generator as a personal project. There are several web-based online ones here and here. (Example screenshot of an existing Truth Table Generator) I have the following questions: How should I go about parsing expressions like: ((P = Q) & (Q = R)) = (P = R) Should I use a parser generator like ANTLr or YACC, or use straight regular expressions? Once I have the expression parsed, how should I go about generating the truth table? Each section of the expression needs to be divided up into its smallest components and re-built from the left side of the table to the right. How would I evaluate something like that? Can anyone provide me with tips concerning the parsing of these arbitrary expressions and eventually evaluating the parsed expression?

    Read the article

  • How to use Zend Cache with SimpleXML objects?

    - by Jeremy Hicks
    I'm trying to cache the user timeline of a Twitter feed using Zend_Service_Twitter which returns its results as a SimpleXML object. Unfortunately the regular serialize functions (which Zend Cache uses) don't play nice with SimpleXMl objects. I found this http://www.mail-archive.com/[email protected]/msg18133.html. So it looks like I'll need to create some kind of custom frontend for Zend Cache to be able to change the serialize function used. Anybody ever done this already or can point me where to look to start?

    Read the article

  • WinUSB application or User-Mode Driver as a filter driver for USB Analysis/Sniffer/Trending

    - by Robert
    A question to maybe some who have worked extensively with WinUSB APIs or use mode USB drivers - Does anyone know if the WinUSB API or a user mode driver can be used as a passive observer of USB connections, capturing notification of interrupts, control requests, data transfers...etc without interfering with other applications (such as iTunes) which would obviously require concurrent access to the device at the same time my application is monitoring the connection and displaying data on it? Or do you pretty much have to write a kernel-mode filter driver and inject yourself in the USB stack in order to make that happen? In the past, there have been a few credible options (libusb-win32 and usbsnoop to be specific) though both are built around the old DDK, not the Windows Driver Foundation, and are not really supported on a regular basis any more. I'm hesitant to build something significant around them, as a result.

    Read the article

  • How to get a service to listen on port 80 on Windows Server 2003

    - by Miky D
    I've coded a custom windows service that listens on TCP port 80 but when I try to install it on a Windows Server 2003 machine it fails to start because some other service is already listening on that port. So far I've disabled the IIS Admin service and the HTTP SSL service but no luck. When I run netstat -a -n -o | findstr 0.0:80 it gives me the process id 4 as the culprit, but when I look at the running processes that process id points to the "System" process. What can I do to get the System process to stop listening on port 80 and get my service to listen instead? P.S. I should point out that the service runs fine if I install it on my Windows XP or Windows 7 development boxes. Also, I should specify that this has nothing to do with it being a service. I've tried starting a regular application that attempts to bing to port 80 on the Windows Server 2003 with the same outcome - it fails because another application is already bound to that port.

    Read the article

  • Does DataType DataAnnotation Check the Expression?

    - by Jason
    I am currently using DataAnnotations within my ASP.NET MVC website to ensure data is properly validated. One question I wanted to verify (I think I know the answer, but I can't find verification online) - does the DataType DataAnnotation perform regular expression checks to ensure that you have received a valid e-mail/phone/currency/etc? [Required(ErrorMessage = "Price required")] [DataType(DataType.Currency, ErrorMessage = "Not a valid price")] [Range(0, double.MaxValue, ErrorMessage = "Price must be greater than 0.")] public decimal Price { get; set; } I believe the answer is no (meaning I have to provide my own, custom, RegularExpressionAttribute), but I wanted to double check before I do that for various field types.

    Read the article

  • Setting a breakpoint in a T4 template

    - by Dave Swersky
    I'm trying to debug the execution of a T4 template in Visual Studio 2008. All the information I'm finding on debugging T4 templates in Visual Studio 2008 say that you can set a breakpoint (red dot) in the template as if it were a regular code file. I have the Clarius T4 code highlighter installed, so my T4 template is colored, but I can't set a breakpoint. When I click in the margin nothing happens. I've tried Debugger.Break(), and it launches a new instance of VS.NET, but it can't load the code from my template. I get a dialog that says "There is no source code available for the current location." This happens if I have the same project loaded in the another instance of if I spin up a new instance. What gives?

    Read the article

  • Efficient data structure design

    - by Sway
    Hi there, I need to match a series of user inputed words against a large dictionary of words (to ensure the entered value exists). So if the user entered: "orange" it should match an entry "orange' in the dictionary. Now the catch is that the user can also enter a wildcard or series of wildcard characters like say "or__ge" which would also match "orange" The key requirements are: * this should be as fast as possible. * use the smallest amount of memory to achieve it. If the size of the word list was small I could use a string containing all the words and use regular expressions. however given that the word list could contain potentially hundreds of thousands of enteries I'm assuming this wouldn't work. So is some sort of 'tree' be the way to go for this...? Any thoughts or suggestions on this would be totally appreciated! Thanks in advance, Matt

    Read the article

  • Javascript substrings multiline replace by RegExp

    - by Radek Šimko
    Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

    Read the article

  • Should you remove all warnings in your Verilog or VHDL design? Why or why not?

    - by Brian Carlton
    In (regular) software I have worked at companies where the gcc option -Wall is used to show all warnings. Then they need to be dealt with. With non-trivial FPGA/ASIC design in Verilog or VHDL there are often many many warnings. Should I worry about all of them? Do you have any specific techniques to suggest? My flow is mainly for FPGAs (Altera and Xilinx in particular), but I assume the same rules would apply to ASIC design, possibly more so due to the inability to change the design after it is built.

    Read the article

  • How can I replace only the last occurence of an number in a string with php?

    - by Shawn
    How would you change this: a-10-b-19-c into something like this: a-10-b-20-c using regular expressions in PHP? The only solution I've found so far is: reverse the original string - "c-91-b-01-a" find the first number - "91" reverse it - "19" turn in into a number (parseInt) - 19 add 1 to it (+1) - 20 turn it into a string again (toString) - "20" reverse it again - "02" replace the original match with this new number - "c-02-b-01-a" reverse the string - "a-10-b-20-c" I was hoping someone on SO would have a simpler way to do this... Anyone?

    Read the article

  • Forumotion profile customization using jQuery based on URL

    - by Harvengure
    The idea is have a jQuery snippet (I like Jquery...I can understand it better then regular javascript) that will detect that when it has been run on a profile with a url such as "http://customize.forum-motion.com/profile.forum?mode=viewprofile&u=1" (just as an example)...then upon detecting that it is a url of a profile...fetch data from a specific (and most likely hidden) element before wrapping that data in css tags and appending it to the heady of the current document. In short I'm trying to figure out how to make a sort of profile customization system where users can create their own css. The biggest problem I am having so far is figuring out how to make it so that the snippet can figure out what URL its being run on. Is there a function that can do this in jQuery at all?

    Read the article

  • Editing a BrowserField's History

    - by Woody
    I have a BrowserField in my app, which works great. It intercept NavigationRequests to links on my website which go to external sites, and brings up a new windows to display those in the regular Browser, which also works great. The problem I have is that if a user clicks a link to say "www.google.com", my app opens that up in a new browser, but also logs it into the BrowserHistory. So if they click back, away from google, they arrive back at my app, but then if they hit back again, the BrowserHistory would land them on the same page they were on (Because going back from Google doesn't move back in the history) I've tried to find a way to edit the BrowserField's BrowserHistory, but this doesn't seem possible. Short of creating my own class for logging the browsing history, is there anything I can do? If I didn't do a good job explaining the problem, don't hesitate for clarification. Thanks

    Read the article

< Previous Page | 438 439 440 441 442 443 444 445 446 447 448 449  | Next Page >