Search Results

Search found 5852 results on 235 pages for 'ram kumar sharma'.

Page 45/235 | < Previous Page | 41 42 43 44 45 46 47 48 49 50 51 52  | Next Page >

  • Update panel problem

    - by ram
    Here is my code: <body> <form id="form1" runat="server"> <div> <asp:ScriptManager ID="ScriptManager1" runat="server"> </asp:ScriptManager> <asp:UpdatePanel ID="UpdatePanel1" UpdateMode="Conditional" ChildrenAsTriggers="false" runat="server"> <ContentTemplate> <asp:Button ID="Button1" runat="server" Text="Click1" OnClick="Button1_Click" /> <br /> <br /> Last refresh <%=DateTime.Now.ToString() %> <br /> <br /> <asp:UpdatePanel ID="UpdatePanel2" UpdateMode="Conditional" ChildrenAsTriggers="true" runat="server"> <ContentTemplate> <asp:Button ID="Button2" runat="server" Text="Click2" OnClick="Button2_Click" /> <br /> <br /> Last refresh <%=DateTime.Now.ToString() %> <br /> <br /> </ContentTemplate> <Triggers> <asp:AsyncPostBackTrigger ControlID="Button2" EventName="Click" /> </Triggers> </asp:UpdatePanel> </ContentTemplate> <Triggers> <asp:AsyncPostBackTrigger ControlID="Button1" EventName="Click" /> </Triggers> </asp:UpdatePanel> </div> </form> </body> Im using two update panels here, when i click "Button2" then "UpdatePanel2" was refreshed, if i click "Button1" then both update panel were refreshed, but my need is if i click "Button1" then "UpdatePanel1" have to be refreshed. Thanks.

    Read the article

  • How do I secure all the admin actions in all controllers in cakePHP

    - by Gaurav Sharma
    Hello Everyone, I am developing an application using cakePHP v 1.3 on windows (XAMPP). Most of the controllers are baked with the admin routing enabled. I want to secure the admin actions of every controller with a login page. How can I do this without repeating much ? One solution to the problem is that "I check for login information in the admin_index action of every controller" and then show the login screen accordingly. Is there any better way of doing this ? The detault URL to admin (http://localhost/app/admin) is pointing to the index_admin action of users controller (created a new route for this in routes.php file) Thanks

    Read the article

  • insert multiple elements in string in python

    - by Anurag Sharma
    I have to build a string like this { name: "john", url: "www.dkd.com", email: "[email protected]" } where john, www.dkd.com and [email protected] are to be supplied by variables I tried to do the following s1 = "{'name:' {0},'url:' {1},'emailid:' {2}}" s1.format("john","www.dkd.com","[email protected]") I am getting the following error Traceback (most recent call last): File "<stdin>", line 1, in <module> KeyError: "'name" Dont able to understand what I am doing wrong

    Read the article

  • Issue in exec method

    - by mukul sharma
    Hi all, I am a having two python files file1.py and file2.py. I am using exec() to get the method/Variables defined in the file2.py. file1.py have a class as given below class one: def init(self): self.HOOK = None exec(file2.py) self.HOOK = Generate ### call the hook method #### self.HOOK() file2.py looks like as (There is no class define in file2.py) def Generate() do 1 do 2 Hello() def hello() print "hello" Now the problem is as When i run script it is giving a error global name Hello not found. If i remove Hello() from Generate method in file2.py then its work fine. I cant use import file2.py in file1.py,because in file2.py the only one method name (Generate) is fix (its taken as requirement). So apart from Genarate method user can define any method and can call this in generate method, because this approach is not working so i have to write whole code into generate method only and code is also repetitive. Any help is really appreciable...

    Read the article

  • How to determine if an event is already subscribed

    - by Ram
    Hi, In my .NET application I am subscribing to events from another class. The subscription is conditional. I am subscribing to events when the control is visible and de-subscribing it when it become invisible. However in some conditions I do not want to de-subscribe the event even if the control is not visible as I want the result of an operation which is happening on background thread . Is there any way through which I can determine if a that class has already subscribed to that event. I know we can do it in the class which will raise that event by checking event with null but I don not know how to do it in a class which will subscribe to that event.

    Read the article

  • How to trigger a postback using JQuery Droppable plugin ?

    - by Sandeep K Ram
    Hi, This is my script for the draggable and droppable <script type="text/javascript"> $(function() { $(".Source li").draggable({ appendTo: "body", helper: "clone", revert: "invalid" }); $(".Destination ").droppable({ activeClass: "ui-state-default", hoverClass: "ui-state-hover", accept: ".Source li", drop: function(event, ui) { $(this).find(".placeholder").remove(); $("#Hf1").val(ui.draggable.text()); $("#TxtItemId").val($("#Hf1").val()); } }); }); </script> Now I want to access the value of the "TxtItemId" control in the code-behind through a postback. How do I go about doing this ? BTW, this is for a scenario where a person will drag an item from a panel into a shopping cart and I need to capture the Id of the dropped item and trigger a postback after the drop to update the quantity of that item in the cart.

    Read the article

  • display HTML content from database with formatting in it

    - by Gaurav Sharma
    Hi all, I have used wmd-editor in my cakephp v1.3 application. The config which I have written is as follows: wmd_options = { output: "HTML", lineLength: 40, buttons: "bold italic | link blockquote code image | ol ul heading hr", autostart: true }; When I submit the form the HTML in the wmd enabled textarea is saved in the database with htmlentities() done to the text then I am displaying it with html_entity_decode() method. but the text is displayed as it is including the HTML coding like this <p><strong>hello dear friends</strong></p>\n\n<pre><code>I want to make sure that everything that you type is visible clearly.\nadasfafas\n</code></pre>\n\n<blockquote>\n <p>sadgsagasdgxcbxcbxc</p>\n</blockquote>\n\n<p><em>sadfgsgasdsgasgs</em></p>\n\n<p><b><a href="http://kumu.in">this is the link</a></b></p> Please help me solve this problem Thanks

    Read the article

  • How to expose MEX when I need the service to have NTLM authentication

    - by Ram Amos
    I'm developing a WCF service that is RESTful and SOAP, now both of them needs to be with NTLM authentication. I also want to expose a MEX endpoint so that others can easily reference the service and work with it. Now when I set IIS to require windows authentication I can use the REST service and make calls to the service succesfully, but when I want to reference the service with SVCUTIL it throws an error that it requires to be anonymous. Here's my web.config: <system.serviceModel> <serviceHostingEnvironment aspNetCompatibilityEnabled="true" multipleSiteBindingsEnabled="true"/> <bindings> <basicHttpBinding> <binding name="basicHttpBinding" maxReceivedMessageSize="214748563" maxBufferSize="214748563" maxBufferPoolSize="214748563"> <security mode="TransportCredentialOnly"> <transport clientCredentialType="Ntlm"> </transport> </security> </binding> </basicHttpBinding> <webHttpBinding> <binding name="webHttpBinding" maxReceivedMessageSize="214748563" maxBufferSize="214748563" maxBufferPoolSize="214748563"> <security mode="TransportCredentialOnly"> <transport clientCredentialType="Ntlm"> </transport> </security> </binding> </webHttpBinding> <mexHttpBinding> <binding name="mexHttpBinding"></binding> </mexHttpBinding> </bindings> <standardEndpoints> <webHttpEndpoint> <standardEndpoint name="" automaticFormatSelectionEnabled="true" helpEnabled="True"> </standardEndpoint> </webHttpEndpoint> </standardEndpoints> <services> <service name="Intel.ResourceScheduler.Service" behaviorConfiguration="Meta"> <clear /> <endpoint address="soap" name="SOAP" binding="basicHttpBinding" contract="Intel.ResourceScheduler.Service.IResourceSchedulerService" listenUriMode="Explicit" /> <endpoint address="" name="rest" binding="webHttpBinding" behaviorConfiguration="REST" contract="Intel.ResourceScheduler.Service.IResourceSchedulerService" /> <endpoint address="mex" name="mex" binding="mexHttpBinding" behaviorConfiguration="" contract="IMetadataExchange" /> </service> </services> <behaviors> <endpointBehaviors> <behavior name="REST"> <webHttp /> </behavior> <behavior name="WCFBehavior"> <dataContractSerializer maxItemsInObjectGraph="2147483647" /> </behavior> </endpointBehaviors> <serviceBehaviors> <behavior name="Meta"> <serviceMetadata httpGetEnabled="true"/> </behavior> <behavior name="REST"> <dataContractSerializer maxItemsInObjectGraph="2147483647" /> </behavior> <behavior name="WCFBehavior"> <serviceMetadata httpGetEnabled="true"/> <dataContractSerializer maxItemsInObjectGraph="2147483647" /> </behavior> <behavior name=""> <!-- To avoid disclosing metadata information, set the value below to false and remove the metadata endpoint above before deployment --> <serviceMetadata httpGetEnabled="true" /> <!-- To receive exception details in faults for debugging purposes, set the value below to true. Set to false before deployment to avoid disclosing exception information --> <serviceDebug includeExceptionDetailInFaults="false" /> </behavior> </serviceBehaviors> </behaviors> Any help will be appreciated.

    Read the article

  • how to check the read write status of storing media in python

    - by mukul sharma
    Hi All, How can i check the read/ write permission of the file storing media? ie assume i have to write some file inside a directory and that directory may be available on read only media like (cd or dvd)or etc. So how can i check that storing media ( cd, hard disk) having a read only or read write both permission. I am using windows xp os. Thanks.

    Read the article

  • A strategy to troubleshoot/ fix application crashes in Windows?

    - by Manav Sharma
    All, Over a period of time I have observed that fixing issues related to application crash is a discipline in itself. Some people have this nice way of attacking such problems. Ranging from Viewing the 'Event Viewer' to running Static/ Dynamic memory analysis tools to some of their 'personal favorites', these people have developed this art. Can we share articles/ links/ personal approaches that we use to understand/ troubleshoot/ fix such issues? Thanks

    Read the article

  • Checking for Error during execution of a procedure in oracle

    - by Sumit Sharma
    create or replace procedure proc_advertisement(CustomerID in Number, NewspaperID in number, StaffID in Number, OrderDate in date, PublishDate in date, Type in varchar, Status in varchar, Units in number) is begin insert into PMS.Advertisement(CustomerID, NewspaperID, StaffID, OrderDate, PublishDate, Type, Status, Units) values(CustomerID,NewspaperID, StaffID, OrderDate, PublishDate, Type, Status, Units); dbms_output.put_line('Advertisement Order Placed Successfully'); end; How to check for if any error has occurred during the execution of the procedure and if any error has occurred then I wish to display an error message.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • cahoots - zend framework application is not running

    - by Gaurav Sharma
    hello everyone, I downloaded cahoots from sourceforge.net. It is a zend framework application. Very nicely done and I must say that it should be a nice tutorial for everyone who is struggling to learn Zend framework. But my problem is that even after reading the instructions this application is still not running. The application just doesn't run at all giving an error message. I have tried my best. no success :( Also I wanted to execute the application as "http://localhost/cahoots" but it runs by this URL "http://localhost/cahoots/public". why is it so.? I am using XAMPP v 1.7.1 with mod-rewrite enabled. Please guide me through the process. Any good tutorials on zend framework with zend tool would be appreciable. I want to learn this framework. Thanks

    Read the article

  • blitting issue when blitting to wxGCDC from a wxMemoryDC

    - by mukul sharma
    Hi All, I have loaded a wxBitmap (with transparency .png) in memoryDC now when i am blitting the data from the memoryDc to GCDC that time in transparent part its giving the black color. But if remove the GCDC and use normal ClientDC for display purpose there is no such problem happening, but i cannot remove the wxGCDC because this is only support the transparency in color drawing. Any solution or workaround really helpful. Thanks in advanced

    Read the article

  • reply to a comment via email and directly post it on the website commenting system

    - by Gaurav Sharma
    Hello Everybody, I have developed a website using PHP and MYSQL. The website has a commenting system through which registered users of the website can post comments on the feedback posted by different users. When a comment is posted for a feedback an email is sent to the user who posted that feedback notifying him of new comments on his feedback. Now what I want is that a feedback owner should be able to post a new comment in response to that comment by simply replying to the email that has been sent by the website. I hope I was able to explain my query properly. If it needs any improvement in explanation, I would be glad to know and make changes accordingly Thanks

    Read the article

  • present a static page url as different url which is SEO friendly

    - by Gaurav Sharma
    Hi, I have developed a site, which has some static pages. Like explore, home, feedback. The link for these goes as follows website.com/views/explore.php website.com/index.php website.com/views/feedback.php I want to write a different SEO URL for each of the URL mentioned above. Is it possible ? i.e. for example website.com/views/explore.php should be convereted/visible as website.com/explore website.com/views/feedback.php should be convereted/visible as website.com/give/feedback and so on

    Read the article

< Previous Page | 41 42 43 44 45 46 47 48 49 50 51 52  | Next Page >