Search Results

Search found 44874 results on 1795 pages for 'format string'.

Page 456/1795 | < Previous Page | 452 453 454 455 456 457 458 459 460 461 462 463  | Next Page >

  • Why not all users can log in to a network computer by using <network computer name>/<user name> form

    - by Haris
    There is a file server in my office that is not connected to my office LAN. In this server there are folders that are shared. This server is connected to a switch and a wireless router. Everyone who wants to access this server uses wireless network connection. They log in to this server by providing user name and password registered to the server. Some people can log in to my office file server by providing user name in (the server name)/(user name) format, while other must use (the server IP address)/(user name) format. Why is it like this? I need everyone can access the file server by providing user name in (the server name)/(user name) format. I have tried to change the %SystemRoot%\system32\drivers\etc\hosts file, as some suggested, but it won't work. Any other suggestion?

    Read the article

  • Convert PDF to Image Batch

    - by tro
    I am working on a solution where I can convert pdf files to images. I am using the following example from codeproject: http://www.codeproject.com/Articles/317700/Convert-a-PDF-into-a-series-of-images-using-Csharp?msg=4134859#xx4134859xx now I tried with the following code to generate from more then 1000 pdf files new images: using Cyotek.GhostScript; using Cyotek.GhostScript.PdfConversion; using System; using System.Collections.Generic; using System.Drawing; using System.IO; using System.Linq; using System.Text; using System.Threading.Tasks; namespace RefClass_PDF2Image { class Program { static void Main(string[] args) { string outputPath = Properties.Settings.Default.outputPath; string pdfPath = Properties.Settings.Default.pdfPath; if (!Directory.Exists(outputPath)) { Console.WriteLine("Der angegebene Pfad " + outputPath + " für den Export wurde nicht gefunden. Bitte ändern Sie den Pfad (outputPath) in der App.Config Datei."); return; } else { Console.WriteLine("Output Pfad: " + outputPath + " gefunden."); } if (!Directory.Exists(pdfPath)) { Console.WriteLine("Der angegebene Pfad " + pdfPath + " zu den PDF Zeichnungen wurde nicht gefunden. Bitte ändern Sie den Pfad (pdfPath) in der App.Config Datei."); return; } else { Console.WriteLine("PDF Pfad: " + pdfPath + " gefunden."); } Pdf2ImageSettings settings = GetPDFSettings(); DateTime start = DateTime.Now; TimeSpan span; Console.WriteLine(""); Console.WriteLine("Extraktion der PDF Zeichnungen wird gestartet: " + start.ToShortTimeString()); Console.WriteLine(""); DirectoryInfo diretoryInfo = new DirectoryInfo(pdfPath); DirectoryInfo[] directories = diretoryInfo.GetDirectories(); Console.WriteLine(""); Console.WriteLine("Es wurden " + directories.Length + " verschiedende Verzeichnisse gefunden."); Console.WriteLine(""); List<string> filenamesPDF = Directory.GetFiles(pdfPath, "*.pdf*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); List<string> filenamesOutput = Directory.GetFiles(outputPath, "*.*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); Console.WriteLine(""); Console.WriteLine("Es wurden " + filenamesPDF.Count + " verschiedende PDF Zeichnungen gefunden."); Console.WriteLine(""); List<string> newFileNames = new List<string>(); int cutLength = pdfPath.Length; for (int i = 0; i < filenamesPDF.Count; i++) { string temp = filenamesPDF[i].Remove(0, cutLength); temp = outputPath + temp; temp = temp.Replace("pdf", "jpg"); newFileNames.Add(temp); } for (int i = 0; i < filenamesPDF.Count; i++) { FileInfo fi = new FileInfo(newFileNames[i]); if (!fi.Exists) { if (!Directory.Exists(fi.DirectoryName)) { Directory.CreateDirectory(fi.DirectoryName); } Bitmap firstPage = new Pdf2Image(filenamesPDF[i], settings).GetImage(); firstPage.Save(newFileNames[i], System.Drawing.Imaging.ImageFormat.Jpeg); firstPage.Dispose(); } //if (i % 20 == 0) //{ // GC.Collect(); // GC.WaitForPendingFinalizers(); //} } Console.ReadLine(); } private static Pdf2ImageSettings GetPDFSettings() { Pdf2ImageSettings settings; settings = new Pdf2ImageSettings(); settings.AntiAliasMode = AntiAliasMode.Medium; settings.Dpi = 150; settings.GridFitMode = GridFitMode.Topological; settings.ImageFormat = ImageFormat.Png24; settings.TrimMode = PdfTrimMode.CropBox; return settings; } } } unfortunately, I always get in the Pdf2Image.cs an out of memory exception. here the code: public Bitmap GetImage(int pageNumber) { Bitmap result; string workFile; //if (pageNumber < 1 || pageNumber > this.PageCount) // throw new ArgumentException("Page number is out of bounds", "pageNumber"); if (pageNumber < 1) throw new ArgumentException("Page number is out of bounds", "pageNumber"); workFile = Path.GetTempFileName(); try { this.ConvertPdfPageToImage(workFile, pageNumber); using (FileStream stream = new FileStream(workFile, FileMode.Open, FileAccess.Read)) { result = new Bitmap(stream); // --->>> here is the out of memory exception stream.Close(); stream.Dispose(); } } finally { File.Delete(workFile); } return result; } how can I fix that to avoid this exception? thanks for any help, tro

    Read the article

  • Throwing exception vs returning null value with switch statement

    - by Greg
    So I have function that formats a date to coerce to given enum DateType{CURRENT, START, END} what would be the best way to handling return value with cases that use switch statement public static String format(Date date, DateType datetype) { ..validation checks switch(datetype){ case CURRENT:{ return getFormattedDate(date, "yyyy-MM-dd hh:mm:ss"); } ... default:throw new ("Something strange happend"); } } OR throw excpetion at the end public static String format(Date date, DateType datetype) { ..validation checks switch(datetype){ case CURRENT:{ return getFormattedDate(date, "yyyy-MM-dd hh:mm:ss"); } ... } //It will never reach here, just to make compiler happy throw new IllegalArgumentException("Something strange happend"); } OR return null public static String format(Date date, DateType datetype) { ..validation checks switch(datetype){ case CURRENT:{ return getFormattedDate(date, "yyyy-MM-dd hh:mm:ss"); } ... } return null; } What would be the best practice here ? Also all the enum values will be handled in the case statement

    Read the article

  • WCF - Dynamically Change WebResponseFormat

    - by Brandon
    Is there a way to dynamically change the WebResponseFormat on a method given a parameter passed by the client? I default my WebResponseFormat to XML, but I want to give the client the opportunity to specify a format as JSON or XML and if none is specified, default to XML. Currently I am doing the following: [WebGet(UriTemplate = "objects", BodyStyle = WebMessageBodyStyle.Bare)] [OperationContract] List<SampleObject> GetObjects(); The user can call it via: http://localhost/rest/myservice/objects They then can specify a format by doing: http://localhost/rest/myservice/objects?format=json The problem is that when I try to set the response content type via: WebOperationContext.Current.OutgoingResponse.ContentType = "application/json"; That just returns the XML but the browser attempts to process it like a JSON object instead of serializing the response as JSON. Is this even possible with .NET 3.5 outside of using a Stream as the return value and serializing the response myself? If not, is there a better solution?

    Read the article

  • Extracting text from a file where date -time is the index

    - by Soham
    I have got around 800 files of maximum 55KB-100KB each where the data is in this format Date/Time/Float1/Float2/Float3/Float4/Integer Date is in DD/MM/YYYY format and Time is in the format of HH:MM Here the date ranges from say 1st May to 1June and each day, the Time varies from 09:00 to 15:30. I want to run a program so that, for each file, it extracts the data pertaining to a particular given date and writes to a file. I will not face any problem in writing into directory operations. I am trying to get around, to form a to do a search and extract operation. I dont know, how to do it, would like to have some idea. Thanks Soham

    Read the article

  • JSON Date coming through as Today's date?

    - by Liam
    I'm trying to convert a JSON date to a dd/mm/yyyy format, which I'm managing to do semi-successfully. The problem I'm encountering is that the date from the record in the DB is for example, 2009-06-29 which is returning the usual JSON /Date(1246230000000)/, however, when I try and turn it into the previously mention dd/mm/yyyy format, it's coming through as today's date. The code I'm using to try and do this is: $('input#EmployeeName').result(function(event, data, formatted) { $('#StartDate').html(formatJSONDate(Date(!data ? '' : data.StartDate))); }); function formatJSONDate(jsonDate) { var newDate = dateFormat(jsonDate, "dd/mm/yyyy"); return newDate; } I'm using JavaScript Date Format to try and run the function. Any help is greatly appreciated.

    Read the article

  • Python - Number of Significant Digits in results of division

    - by russ
    Newbie here. I have the following code: myADC = 128 maxVoltage = 5.0 maxADC = 255.0 VoltsPerADC = maxVoltage/maxADC myVolts = myADC * VoltsPerADC print "myADC = {0: >3}".format(myADC) print "VoltsPerADC = {0: >7}".format(VoltsPerADC) print VoltsPerADC print "myVolts = {0: >7}".format(myVolts) print myVolts This outputs the following: myADC = 128 VoltsPerADC = 0.0196078 0.0196078431373 myVolts = 2.5098 2.50980392157 I have been searching for an explanation of how the number of significant digits is determined by default, but have had trouble locating an explanation that makes sense to me. This link link text suggests that by default the "print" statement prints numbers to 10 significant figures, but that does not seem to be the case in my results. How are the number of significant digits/precision determined? Can someone shed some light on this for me. Thanks in advance for your time and patience.

    Read the article

  • creating a Menu from SQLite values in Java

    - by shanahobo86
    I am trying to create a ListMenu using data from an SQLite database to define the name of each MenuItem. So in a class called menu.java I have defined the array String classes [] = {}; which should hold each menu item name. In a DBAdapter class I created a function so the user can insert info to a table (This all works fine btw). public long insertContact(String name, String code, String location, String comments, int days, int start, int end, String type) { ContentValues initialValues = new ContentValues(); initialValues.put(KEY_NAME, name); initialValues.put(KEY_CODE, code); initialValues.put(KEY_LOCATION, location); initialValues.put(KEY_COMMENTS, comments); initialValues.put(KEY_DAYS, days); initialValues.put(KEY_START, start); initialValues.put(KEY_END, end); initialValues.put(KEY_TYPE, type); return db.insert(DATABASE_TABLE, null, initialValues); } It would be the Strings inserted into KEY_NAME that I need to populate that String array with. Does anyone know if this is possible? Thanks so much for the help guys. If I implement that function by Sam/Mango the program crashes, am I using it incorrectly or is the error due to the unknown size of the array? DBAdapter db = new DBAdapter(this); String classes [] = db.getClasses(); edit: I should mention that if I manually define the array: String classes [] = {"test1", "test2", "test3", etc}; It works fine. The error is a NullPointerException Here's the logcat (sorry about the formatting). I hadn't initialized with db = helper.getReadableDatabase(); in the getClasses() function but unfortunately it didn't fix the problem. 11-11 22:53:39.117: D/dalvikvm(17856): Late-enabling CheckJNI 11-11 22:53:39.297: D/TextLayoutCache(17856): Using debug level: 0 - Debug Enabled: 0 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libGLES_android.so 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libEGL_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv1_CM_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv2_adreno200.so 11-11 22:53:39.387: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:39.407: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c66d000 size:36593664 offset:32825344 fd:65 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: D/OpenGLRenderer(17856): Enabling debug mode 0 11-11 22:53:39.477: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5ecd3000 size:40361984 offset:36593664 fd:68 11-11 22:53:40.507: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61451000 size:7254016 offset:3485696 fd:71 11-11 22:53:41.077: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:41.077: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c4c000 size:7725056 offset:7254016 fd:74 11-11 22:53:41.097: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x623aa000 size:8196096 offset:7725056 fd:80 11-11 22:53:41.937: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x62b7b000 size:8667136 offset:8196096 fd:83 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61c4c000 size:7725056 offset:7254016 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x623aa000 size:8196096 offset:7725056 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x62b7b000 size:8667136 offset:8196096 11-11 22:53:42.167: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:42.177: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c5d000 size:17084416 offset:13316096 fd:74 11-11 22:53:42.317: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x63853000 size:20852736 offset:17084416 fd:80 11-11 22:53:42.357: D/OpenGLRenderer(17856): Flushing caches (mode 0) 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5c66d000 size:36593664 offset:32825344 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5ecd3000 size:40361984 offset:36593664 11-11 22:53:42.367: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61451000 size:7254016 offset:3485696 11-11 22:53:42.757: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c56d000 size:24621056 offset:20852736 fd:65 11-11 22:53:44.247: D/AndroidRuntime(17856): Shutting down VM 11-11 22:53:44.247: W/dalvikvm(17856): threadid=1: thread exiting with uncaught exception (group=0x40ac3210) 11-11 22:53:44.257: E/AndroidRuntime(17856): FATAL EXCEPTION: main 11-11 22:53:44.257: E/AndroidRuntime(17856): java.lang.RuntimeException: Unable to instantiate activity ComponentInfo{niall.shannon.timetable/niall.shannon.timetable.menu}: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1891) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1992) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.access$600(ActivityThread.java:127) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1158) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Handler.dispatchMessage(Handler.java:99) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Looper.loop(Looper.java:137) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.main(ActivityThread.java:4441) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invokeNative(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invoke(Method.java:511) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:823) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:590) 11-11 22:53:44.257: E/AndroidRuntime(17856): at dalvik.system.NativeStart.main(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): Caused by: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.content.ContextWrapper.openOrCreateDatabase(ContextWrapper.java:221) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.database.sqlite.SQLiteOpenHelper.getWritableDatabase(SQLiteOpenHelper.java:157) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.DBAdapter.getClasses(DBAdapter.java:151) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.menu.<init>(menu.java:15) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstanceImpl(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstance(Class.java:1319) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.Instrumentation.newActivity(Instrumentation.java:1023) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1882) 11-11 22:53:44.257: E/AndroidRuntime(17856): ... 11 more 11-11 22:53:46.527: I/Process(17856): Sending signal. PID: 17856 SIG: 9

    Read the article

  • Howto extract text from a file where date -time is the index

    - by Soham
    I have got around 800 files of maximum 55KB-100KB each where the data is in this format Date/Time/Float1/Float2/Float3/Float4/Integer Date is in DD/MM/YYYY format and Time is in the format of HH:MM Here the date ranges from say 1st May to 1June and each day, the Time varies from 09:00 to 15:30. I want to run a program so that, for each file, it extracts the data pertaining to a particular given date and writes to a file. I will not face any problem in writing into directory operations. I am trying to get around, to form a to do a search and extract operation. I dont know, how to do it, would like to have some idea. Thanks Soham

    Read the article

  • C Language: Why I cannot transfer file from server to client?

    - by user275753
    I want to ask, why I cannot transfer file from server to client? When I start to send the file from server, the client side program will have problem. So, I spend some times to check the code, But I still cannot find out the problem Can anyone point out the problem for me? thanks a lot! [client side code] include include include include include include include define SA struct sockaddr define S_PORT 5678 define MAXLEN 1000 define true 1 void errexit(const char *format, ...) { va_list args; va_start(args, format); vfprintf(stderr, format, args); va_end(args); WSACleanup(); exit(1); } int main(int argc, char *argv []) { WSADATA wsadata; SOCKET sockfd; int number,message; char outbuff[MAXLEN],inbuff[MAXLEN]; char PWD_buffer[_MAX_PATH]; struct sockaddr_in servaddr; FILE *fp; int numbytes; char buf[2048]; if (WSAStartup(MAKEWORD(2,2), &wsadata) != 0) errexit("WSAStartup failed\n"); if (argc != 2) errexit("client IPaddress"); if ( (sockfd = socket(AF_INET, SOCK_STREAM, 0)) == INVALID_SOCKET ) errexit("socket error: error number %d\n", WSAGetLastError()); memset(&servaddr, 0, sizeof(servaddr)); servaddr.sin_family = AF_INET; servaddr.sin_port = htons(S_PORT); if ( (servaddr.sin_addr.s_addr = inet_addr(argv[1])) == INADDR_NONE) errexit("inet_addr error: error number %d\n", WSAGetLastError()); if (connect(sockfd, (SA *) &servaddr, sizeof(servaddr)) == SOCKET_ERROR) errexit("connect error: error number %d\n", WSAGetLastError()); if ( (fp = fopen("C:\\users\\pc\\desktop\\COPY.c", "wb")) == NULL){ perror("fopen"); exit(1); } printf("Still NO PROBLEM!\n"); //Receive file from server while(1){ numbytes = read(sockfd, buf, sizeof(buf)); printf("read %d bytes, ", numbytes); if(numbytes == 0){ printf("\n"); break; } numbytes = fwrite(buf, sizeof(char), numbytes, fp); printf("fwrite %d bytes\n", numbytes); } fclose(fp); close(sockfd); return 0; } server side code include include include include include include include include define SA struct sockaddr define S_PORT 5678 define MAXLEN 1000 void errexit(const char *format, ...) { va_list args; va_start(args, format); vfprintf(stderr, format, args); va_end(args); WSACleanup(); exit(1); } int main(int argc, char *argv []) { WSADATA wsadata; SOCKET listenfd, connfd; int number, message, numbytes; int h, i, j, alen; int nread; struct sockaddr_in servaddr, cliaddr; FILE *in_file, *out_file, *fp; char buf[4096]; if (WSAStartup(MAKEWORD(2,2), &wsadata) != 0) errexit("WSAStartup failed\n"); listenfd = socket(AF_INET, SOCK_STREAM, 0); if (listenfd == INVALID_SOCKET) errexit("cannot create socket: error number %d\n", WSAGetLastError()); memset(&servaddr, 0, sizeof(servaddr)); servaddr.sin_family = AF_INET; servaddr.sin_addr.s_addr = htonl(INADDR_ANY); servaddr.sin_port = htons(S_PORT); if (bind(listenfd, (SA *) &servaddr, sizeof(servaddr)) == SOCKET_ERROR) errexit("can't bind to port %d: error number %d\n", S_PORT, WSAGetLastError()); if (listen(listenfd, 5) == SOCKET_ERROR) errexit("can't listen on port %d: error number %d\n", S_PORT, WSAGetLastError()); alen = sizeof(SA); connfd = accept(listenfd, (SA *) &cliaddr, &alen); if (connfd == INVALID_SOCKET) errexit("accept failed: error number %d\n", WSAGetLastError()); printf("accept one client from %s!\n", inet_ntoa(cliaddr.sin_addr)); fp = fopen ("client.c", "rb"); // open file stored in server if (fp == NULL) { printf("\nfile NOT exist"); } //Sending file while(!feof(fp)){ numbytes = fread(buf, sizeof(char), sizeof(buf), fp); printf("fread %d bytes, ", numbytes); numbytes = write(connfd, buf, numbytes); printf("Sending %d bytes\n",numbytes); } fclose (fp); closesocket(listenfd); closesocket(connfd); return 0; }

    Read the article

  • how to use monthNames in jqgrid when validating date?

    - by Sasha
    Hi all. In my jqgrid when i am clicking on add new record i have date field prepopulated with current date. Format of the date is yyyy-MMM-d (e.g. 2010-Jan-23). Date is required field and when i click submit button it fails validation and displays error that this date is invalid, and it wants Y-m-d format. How can i check my value with jqgrid? In other words how to make jqgrid accept the following date format when validating 2010-Jan-23? Thanks.

    Read the article

  • Android ksoap nested soap objects in request gives error in response

    - by Smalesy
    I'm trying to do the following soap request on Android using KSOAP. It contains a list of nested soap objects. However, I must be doing something wrong as I get an error back. The request I am trying to generate is as follows: <?xml version="1.0" encoding="utf-8"?> <soap12:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://www.w3.org/2003/05/soap-envelope"> <soap12:Body> <SetAttendanceMarks xmlns="http://hostname.net/"> <strSessionToken>string</strSessionToken> <LessonMarks> <Count>int</Count> <LessonMarks> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> </LessonMarks> </LessonMarks> </SetAttendanceMarks> </soap12:Body> </soap12:Envelope> My code is as follows: public boolean setAttendanceMarks(List<Mark> list) throws Exception { boolean result = false; String methodName = "SetAttendanceMarks"; String soapAction = getHost() + "SetAttendanceMarks"; SoapObject lessMarksN = new SoapObject(getHost(), "LessonMarks"); for (Mark m : list) { PropertyInfo smProp =new PropertyInfo(); smProp.setName("LessonMark"); smProp.setValue(m); smProp.setType(Mark.class); lessMarksN.addProperty(smProp); } PropertyInfo cProp =new PropertyInfo(); cProp.setName("Count"); cProp.setValue(list.size()); cProp.setType(Integer.class); SoapObject lessMarks = new SoapObject(getHost(), "LessonMarks"); lessMarks.addProperty(cProp); lessMarks.addSoapObject(lessMarksN); PropertyInfo sProp =new PropertyInfo(); sProp.setName("strSessionToken"); sProp.setValue(mSession); sProp.setType(String.class); SoapObject request = new SoapObject(getHost(), methodName); request.addProperty(sProp); request.addSoapObject(lessMarks); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(getURL()); androidHttpTransport.debug = true; androidHttpTransport.call(soapAction, envelope); String a = androidHttpTransport.requestDump; String b = androidHttpTransport.responseDump; SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; SoapObject res = (SoapObject) resultsRequestSOAP.getProperty(0); String resultStr = res.getPropertyAsString("Result"); if (resultStr.contentEquals("OK")) { result = true; } return result; } The error I get is as follows: <?xml version="1.0" encoding="utf-8"?><soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <soap:Body> <soap:Fault> <soap:Code> <soap:Value>soap:Sender</soap:Value> </soap:Code> <soap:Reason> <soap:Text xml:lang="en">Server was unable to read request. ---&gt; There is an error in XML document (1, 383). ---&gt; The specified type was not recognized: name='LessonMarks', namespace='http://gsdregapp.net/', at &lt;LessonMarks xmlns='http://gsdregapp.net/'&gt;.</soap:Text> </soap:Reason> <soap:Detail /> </soap:Fault> </soap:Body> </soap:Envelope> Can anybody tell me what I am doing wrong? I will be most grateful for any assistance!

    Read the article

  • ForceContext Queries method twice?

    - by azz0r
    Hello, I'm doing a per minute script, to output the xml that a server will read, I am used forceContext. <?php class My_Controller_Action_Helper_ForceContext extends Zend_Controller_Action_Helper_ContextSwitch { public function initContext($format = null) { $request = $this->getRequest(); $action = $request->getActionName(); $context = $this->getActionContexts($action); //check if this is the only context if(count($context) === 1) { $format = $context[0]; } return parent::initContext($format); } } class Video_PerMinuteController extends Zend_Controller_Action { function init() { $contextSwitch = $this->_helper->getHelper('ForceContext'); $contextSwitch->addActionContext('transaction', 'xml')->initContext(); In my method, it gets the current minute count, adds 1, then saves. So I can clearly see when its accessed more than once in a minute. If I comment out the second contextSwitch line, it only goes up 1, if Its not, it displays the xml page but adds 2 minutes (being called twice somehow). Any ideas?

    Read the article

  • How to save some values from an array in a controller in Rails?

    - by Alfred Nerstu
    I've got a links array that I'm saving to a database. The problem is that the records aren't saved in the order of the array ie links[1] is saved before links[2] and so on... This is a example from the view file: <p> <label for="links_9_label">Label</label> <input id="links_9_name" name="links[9][name]" size="30" type="text" /> <input id="links_9_url" name="links[9][url]" size="30" type="text" /> </p> And this is my controller: def create @links = params[:links].values.collect { |link| @user.links.new(link) } respond_to do |format| if @links.all?(&:valid?) @links.each(&:save!) flash[:notice] = 'Links were successfully created.' format.html { redirect_to(links_url) } else format.html { render :action => "new" } end end end Thanks in advance! Alfred

    Read the article

  • adding visual effects to RJS before action rendered

    - by Sam
    I just started using RJS which is awesome however I am used to putting visual effects in the link_to_remote and such and I'm not sure how to trigger actions before and after remotes are triggered. Take this link for example: HTML <span id="<%= "edit_comment_link_#{comment.id.to_s}"%>" style="float:left;"> <%= link_to_remote "edit", {:update => "comment_#{comment.id.to_s}", :url => edit_post_comment_path(comment.post, comment), :method => :get}%> | </span> Controller: def edit @comment = Comment.find(params[:id]) respond_to do |format| #format.html render edit_comment_path(@comment) format.js end end RJS: page.replace_html "edit_comment_link_#{@comment.id.to_s}", "currently editing | " So is RJS mainly for after actions are rendered visual effects such as a spinner should be put into the link_to_remote with call_backs? Is this a good way of doing things?

    Read the article

  • pass an ID with hyperlik but cant get this ID value from a fk in one table when i click in insert

    - by susan
    Something strange happened in my codes, actually I have a hyperlink that pass ID value in a query string to second page.in second page i have 2 sql datasource that both these sql datasources should get this id value and pass it to a filter parameter to show sth in datalist. so in another word I have a first page that has an hyperlink read ID value from a datasource and pass it to second page.its like below: <asp:HyperLink ID="HyperLink1" runat="server" NavigateUrl='<%# "~/forumpage.aspx?ID="+Eval("ID")%>'><%#Eval("title")%> </asp:HyperLink> then in second page i have one sql datasource with a query like this ...where ID=@id and get this id in query string from db.it work great . but i have problem with second sql datasource in second page it has a query sth like below:...forms.question_id=@id then in sql reference both to query string as ID that get by first page in hyperlink. but when i click in insert button show me error with fk. error:Error:The INSERT statement conflicted with the FOREIGN KEY constraint "FK_forumreply_forumquestions". The conflict occurred in database "forum", table "dbo.forumquestions", column 'ID'. The statement has been terminated. my tables (question(ID,user_id(fk),Cat_id(fk),title,bodytext) (reply(ID,userr_id(fk),questionn_id(fk),titlereply,bodytestreply); When by hand in cb i gave a number in questionn_id like 1 it show me successful but when it want read from a filter by datasource this field face with problem. plzzzz help i really need skip from this part.and cause i am new i guess I cant understand the logic way clearly. <asp:SqlDataSource ID="sdsreply" runat="server" ConnectionString="<%$ ConnectionStrings:forumConnectionString %>" SelectCommand="SELECT forumreply.ID, forumreply.userr_id, forumreply.questionn_id, forumreply.bodytextreply, forumreply.datetimereply, forumquestions.ID AS Expr1, forumusers.ID AS Expr2, forumusers.username FROM forumquestions INNER JOIN forumreply ON forumquestions.ID = forumreply.questionn_id INNER JOIN forumusers ON forumquestions.user_id = forumusers.ID AND forumreply.userr_id = forumusers.ID where forumreply.questionn_id=@questionn_id"> <SelectParameters> <asp:QueryStringParameter Name="questionn_id" QueryStringField="ID" /> </SelectParameters> </asp:SqlDataSource> it is cb for second page in insert button: { if (Session["userid"] != null) { lblreply.Text = Session["userid"].ToString(); } else { Session["userid"]=null; } if (HttpContext.Current.User.Identity.IsAuthenticated) { lblshow.Text = string.Empty; string d = HttpContext.Current.User.Identity.Name; lblshow.Text =d + "???? ??? ?????." ; foreach (DataListItem item in DataList2.Items) { Label questionn_idLabel = (Label)item.FindControl("questionn_idLabel"); Label userr_idLabel = (Label)item.FindControl("userr_idLabel"); lbltest.Text = string.Empty; lbltest.Text = questionn_idLabel.Text; lblreply.Text = string.Empty; lblreply.Text = userr_idLabel.Text; } } else { lblshow.Text = "??? ??? ??? ??? ?? ?? ?????? ???? ???? ???? ????? ??? ??? ? ??? ????? ???????."; } } { if(HttpContext.Current.User.Identity.IsAuthenticated) { if (Page.IsValid) { SqlConnection con = new SqlConnection(ConfigurationManager.ConnectionStrings["forumConnectionString"].ConnectionString); try { con.Open(); SqlCommand cmd = new SqlCommand("insert into forumreply (userr_id,questionn_id,bodytextreply,datetimereply)values(@userr_id,@questionn_id,@bodytextreply,@datetimereply)", con); cmd.Parameters.AddWithValue("userr_id",lblreply.Text); cmd.Parameters.AddWithValue("questionn_id",lbltest.Text); cmd.Parameters.AddWithValue("bodytextreply",txtbody.Text); cmd.Parameters.AddWithValue("datetimereply",DateTime.Now ); cmd.ExecuteNonQuery(); } catch (Exception exp) { Response.Write("<b>Error:</b>"); Response.Write(exp.Message); } finally { con.Close(); } lblmsg.Text = "???? ??? ?? ?????? ??? ?????.thx"; lblshow.Visible = false; //lbltxt.Text = txtbody.Text; txtbody.Text = string.Empty; } } else { lblmsg.Text = string.Empty; Session["rem"] = Request.UrlReferrer.AbsoluteUri; Response.Redirect("~/login.aspx"); } }

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • PHP: Odd behaviour with date_sunset function

    - by Svish
    I'm having a look at the date_sunset function in PHP and have met an issue that I find a bit strange. I have this piece of code: $sunset = date_sunset(mktime(0, 0, 0, 5, 14, 2010), $format, // Format 55.596041, // Latitude 12.992495, // Longitude 90, // Zenith 2 // GMT Offset ); For the three different formats, that would give me: SUNFUNCS_RET_STRING 21:05 SUNFUNCS_RET_DOUBLE 21.095732016315 SUNFUNCS_RET_TIMESTAMP 1273863944 // H:i:s O -> 19:05:44 +0000 Why is the timestamp format ignoring the gmt offset? Is is supposed to be like that? If so what is the reason behind that?

    Read the article

  • Can't DER encode and BER decode RSA public key

    - by Mildred
    I have problems using Crypto++ to save a RSA public key (that I obtained loading a private key file in PKCS#8 format). When decoding the key, I always get a BERDecodeErr exception. Here is the code I am using: CryptoPP::RSASSA_PKCS1v15_SHA_Signer _signer; CryptoPP::RSASSA_PKCS1v15_SHA_Verifier _verifier; CryptoPP::ByteQueue bytes; //_signer.AccessPublicKey().Save(bytes); // seem to save private key instead _signer.AccessKey().DEREncodePublicKey(bytes); //_verifier.AccessKey().Load(bytes); //_verifier.AccessKey().BERDecodePublicKey(bytes, 0, 0); _verifier.AccessPublicKey().Load(bytes); I also tried with the instructions commented above, without success. How do you do to save or open the public key? The public key looks like this in hex format, is there a tool to check its format / validity (regarding what crypto++ supports) ? 3081890281810097e24f2e95504a397e90fbc56d1b330ab2ab97a0d326007b890e40013f9e1d9bd9 f54b0c0840782ddae19b5b4595d8f8b9ffe0d2120174fcbc39585c5867cd2dfba69f8e540caa2c52 de8f08278a34e9249120500117f0ba756c5bb2be660013160db9f82f75deb7ccf63742a9e945da6c cf30c2b109b73342daaabd02b872e50203010001

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • HttpRequestValidationexception on Asp.Net MVC

    - by elranu
    I’m getting an HttpRequestValidationexception with this error message: “A potentially dangerous Request.Form value was detected from the client”. But I have AllowHtml on the property that I’m getting the error. The problem is that later in my code I’m getting the following property to know in witch format I will show my view ControllerContext.HttpContext.Request.Params.AllKeys.Contains("format"). And on this “Param Getter” I’m getting the error. Let’s say my code is similar to the following: public class House { [AllowHtml] public string Text { get; set; } public string Name { get; set; } } [HttpPost, ValidateAntiForgeryToken] public ActionResult CreateTopic(House h) { //business code if(ControllerContext.HttpContext.Request.Params.AllKeys.Contains("format")) { Return view; } } How can I solve this? I already try with the ValidateInput(false) attribute on the controller action method. Any idea?

    Read the article

  • ActionView::MissingTemplate after Rails 3.1 upgrade

    - by jonallard
    After upgrading to Rails 3.1.0 and following David Rice's instructions, all of my controllers strangely can't find their views anymore. # rails s # Started GET "/units" for 127.0.0.1 at 2011-09-04 07:52:23 -0400 Unit Load (0.1ms) SELECT "units".* FROM "units" ActionView::MissingTemplate (Missing template units/index, application/index with {:handlers=>[:erb, :builder], :formats=>[:html], :locale=>[:en, :en]}. Searched in: ): app/controllers/units_controller.rb:9:in `index' units_controller.rb: # GET /units # GET /units.xml def index @units = Unit.all respond_to do |format| format.html # index.html.erb format.xml { render :xml => @units } end end Of course, the view is there (/app/views/units/index.html.erb; it was working before the upgrade). I feel this is a stupid error, what am I missing here?

    Read the article

  • Ruby on Rails - where to write business logic while processing a request? (newbie)

    - by Genadinik
    I am learning Ruby on Rails. I made a simple link like this: <%= link_to "Alex Link", alexes_path(@alex) %> then I routed it in routes.rb like this: resources :alexes get "home/index" then I am a bit unclear, but I think it goes to this part of the controller: def index #@alexes = Alex.all respond_to do |format| format.html # index.html.erb format.json { render json: @alexes } end end Am I correct that it goes to this part of the controller? Then nothing much happens and it goes to the next page which is index.html.rb under views\alexes So what I am wondering is - if I needed to do some business logic, would I write that in the controller snippet? Where inside the snippet? An example would be nice to take a look. Also, I would like to connect to a MongoDb database. Would I also write that in the middle of the controller? Thanks!

    Read the article

  • Criteria hibernate

    - by apb
    my code session.createCriteria(Input.class); DateFormat format = new SimpleDateFormat("yyyy-MM-dd hh:mm:ss"); Date startDate = (Date)format.parse("2005-01-01 00:00:00"); Date endDate = (Date)format.parse("2005-03-03 00:00:00"); crit.add(Expression.between ("inputDate", new Date(startDate.getTime()), new Date(endDate.getTime()))); This code return a list, but there is no element present in it. i think it doesn't match the condition. Anybody help.

    Read the article

  • How does git-diff generate hunk descriptions?

    - by RobM
    (git version 1.6.5.7) When I run git diff the output has a nice scope hint after the line numbers for my Python scripts, e.g.: diff --git a/file.py b/file.py index 024f5bb..c3b5c56 100644 --- a/file.py +++ b/file.py @@ -14,6 +14,8 @@ TITF: Test Infrastructure Tags Format ... @@ -1507,13 +1533,16 @@ class Tags( object ): ... Note that the line numbers are followed by TITF: Test Infrastructure Tags Format and class Tags( object ):. The first patch applies to module scope and the description TITF: Test Infrastructure Tags Format is the module's description. The second patch applies to a method of the Tags class. How does git generate these descriptions? How can I tweak them to show the method name that the patch applies to?

    Read the article

< Previous Page | 452 453 454 455 456 457 458 459 460 461 462 463  | Next Page >