Search Results

Search found 43200 results on 1728 pages for 'large object pattern'.

Page 456/1728 | < Previous Page | 452 453 454 455 456 457 458 459 460 461 462 463  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Unit Testing functions within repository interfaces - ASP.net MVC3 & Moq

    - by RawryLions
    I'm getting into writing unit testing and have implemented a nice repository pattern/moq to allow me to test my functions without using "real" data. So far so good.. However.. In my repository interface for "Posts" IPostRepository I have a function: Post getPostByID(int id); I want to be able to test this from my Test class but cannot work out how. So far I am using this pattern for my tests: [SetUp] public void Setup() { mock = new Mock<IPostRepository>(); } [Test] public void someTest() { populate(10); //This populates the mock with 10 fake entries //do test here } In my function "someTest" I want to be able to call/test the function GetPostById. I can find the function with mock.object.getpostbyid but the "object" is null. Any help would be appreciated :) iPostRepository: public interface IPostRepository { IQueryable<Post> Posts {get;} void SavePost(Post post); Post getPostByID(int id); }

    Read the article

  • javascript string exec strange behavior

    - by Michael
    have funciton in my object which is called regularly. parse : function(html) { var regexp = /...some pattern.../ var match = regexp.exec(html); while (match != null) { ... match = regexp.exec(html); } ... var r = /...pattern.../g; var m = r.exec(html); } with unchanged html the m returns null each other call. let's say parse(html);// ok parse(html);// m is null!!! parse(html);// ok parse(html);// m is null!!! // ...and so on... is there any index or somrthing that has to be reset on html ... I'm really confused. Why match always returns proper result?

    Read the article

  • Windows Phone 7, MVVM, Silverlight and navigation best practice / patterns and strategies

    - by Matt F
    Whilst building a Windows Phone 7 app. using the MVVM pattern we've struggled to get to grips with a pattern or technique to centralise navigation logic that will fit with MVVM. To give an example, everytime the app. calls our web service we check that the logon token we've assigned the app. earlier hasn't expired. We always return some status to the phone from the web service and one of those might be Enum.AuthenticationExpired. If we receive that I'd imagine we'd alert the user and navigate back to the login screen. (this is one of many examples of status we might receive) Now, wanting to keep things DRY, that sort of logic feels like it should be in one place. Therein lies my question. How should I go about modelling navigation that relies on (essentially) switch or if statements to tell us where to navigate to next without repeating that in every view. Are there recognised patterns or techniques that someone could recommend? Thanks

    Read the article

  • How to display a DateTime with chosen date parts, but in the order of the FormatProvider?

    - by Stephane
    I want to display the date in the order that the culture provides, but with the elements I want only. The DateTime.Tostring() method has a list of patterns that are very useful but I would like a very small change in it. The CultureInfo used in the following the following code are chosen as example, I don't want to rely on a specific list of CultureInfo, if possible var now = DateTime.Now; string nowString = now.ToString("m", CultureInfo.GetCultureInfo("en-us")); Console.WriteLine(nowString); nowString = now.ToString("m", CultureInfo.GetCultureInfo("fr-FR")); Console.WriteLine(nowString); displays : April 12 12 avril I would like a pattern that display the abbreviation of the month and the day, but that keeps the correct order from the specified CultureInfo. using the pattern "MMM dd" will always display the month's abbreviation first, followed by the day, breaking the french order for example. Any way to achieve that without too much custom code?

    Read the article

  • How to combine designable components with dependency injection

    - by Wim Coenen
    When creating a designable .NET component, you are required to provide a default constructor. From the IComponent documentation: To be a component, a class must implement the IComponent interface and provide a basic constructor that requires no parameters or a single parameter of type IContainer. This makes it impossible to do dependency injection via constructor arguments. (Extra constructors could be provided, but the designer would ignore them.) Some alternatives we're considering: Service Locator Don't use dependency injection, instead use the service locator pattern to acquire dependencies. This seems to be what IComponent.Site.GetService is for. I guess we could create a reusable ISite implementation (ConfigurableServiceLocator?) which can be configured with the necessary dependencies. But how does this work in a designer context? Dependency Injection via properties Inject dependencies via properties. Provide default instances if they are necessary to show the component in a designer. Document which properties need to be injected. Inject dependencies with an Initialize method This is much like injection via properties but it keeps the list of dependencies that need to be injected in one place. This way the list of required dependencies is documented implicitly, and the compiler will assists you with errors when the list changes. Any idea what the best practice is here? How do you do it? edit: I have removed "(e.g. a WinForms UserControl)" since I intended the question to be about components in general. Components are all about inversion of control (see section 8.3.1 of the UMLv2 specification) so I don't think that "you shouldn't inject any services" is a good answer. edit 2: It took some playing with WPF and the MVVM pattern to finally "get" Mark's answer. I see now that visual controls are indeed a special case. As for using non-visual components on designer surfaces, I think the .NET component model is fundamentally incompatible with dependency injection. It appears to be designed around the service locator pattern instead. Maybe this will start to change with the infrastructure that was added in .NET 4.0 in the System.ComponentModel.Composition namespace.

    Read the article

  • Sorting based on existing elements in xslt

    - by Teelo
    Hi , I want to sort in xslt based on existing set of pattern . Let me explain with the code: <Types> <Type> <Names> <Name>Ryan</Name> </Names> <Address>2344</Address> </Type> <Type> <Names> </Name>Timber</Name> </Names> <Address>1234</Address> </Type> <Type> <Names> </Name>Bryan</Name> </Names> <Address>34</Address> </Type> </Types> Right now I m just calling it and getting it like (all hyperlinks) Ryan Timber Bryan Now I don't want sorting on name but I have existing pattern how I want it to get displayed.Like Timber Bryan Ryan (Also I don't want to lose the url attached to my names earlier while doing this) I was thinking of putting earlier value in some array and sort based on the other array where I will store my existing pattern. But I am not sure how to achieve that.. My xslt looks like this now(there can be duplicate names also) <xsl:for-each select="/Types/Type/Names/Name/text()[generate-id()=generate-id(key('Name',.)[1])]"> <xsl:call-template name="typename"> </xsl:call-template> </xsl:for-each> <xsl:template name="typename"> <li> <a href="somelogicforurl"> <xsl:value-of select="."/> </a> </li> </xsl:template> I am using xsl 1.0

    Read the article

  • handle when callback to a dealloced delegate?

    - by athanhcong
    Hi all, I implemented the delegate-callback pattern between two classes without retaining the delegate. But in some cases, the delegate is dealloced. (My case is that I have a ViewController is the delegate object, and when the user press back button to pop that ViewController out of the NavigationController stack) Then the callback method get BAD_EXE: if (self.delegate != nil && [self.delegate respondsToSelector:selector]) { [self.delegate performSelector:selector withObject:self withObject:returnObject]; } I know the delegate-callback pattern is implemented in a lot of application. What is your solution for this?

    Read the article

  • linq-to-sql "an attempt has been made to attach or add an entity that is not new"?

    - by Curtis White
    I've been getting several errors: cannot add an entity with a key that is already in use An attempt has been made to attach or add an entity that is not new, perhaps having been loaded from another datacontext In case 1, this stems from trying to set the key for an entity versus the entity. In case 2, I'm not attaching an entity but I am doing this: MyParent.Child = EntityFromOtherDataContext; I've been using using the pattern of wrap everything with a using datacontext. In my case, I am using this in a web forms scenario, and obviously moving the datacontext object to a class wide member variables solves this. My questions are thus 2 fold: How can I get rid of these errors and not have to structure my program in an odd way or pass the datacontext around while keeping the local-wrap pattern? I assume I could make another hit to the database but that seems very inefficient. Would most people recommend that moving the datacontext to the class wide scope is desirable for web pages?

    Read the article

  • Sharing beans from contextListener -- dispatcher servlet

    - by Ernest
    Hello! ok, i have another question now. I have a bunch of beans loaded succesfully in applicationContext.xml, which loads from web.xml: contextConfigLocation applicationContext.xml org.springframework.web.context.ContextLoaderListener Here are is the bean defined in applicationContext.xml that i want to share: it loads other beans (DAOs) which are initialized with hibernet. I need to acces catalogFacadeTarget from the dispatcherServlet, declared in web.xml: dispatcher org.springframework.web.servlet.DispatcherServlet 1 <servlet-mapping> <servlet-name>dispatcher</servlet-name> <url-pattern>*.htm</url-pattern> </servlet-mapping> and configured dispatcher-servlet.xml like this: welcome There! in the property called catalogFacadeImpl. If you need the entire applicationCOntext.xml, web.xml, and dispatcher-servlet.xml please let me know. From what i read, i should be able to share beans if i declared them in the contextConfigLocation configuration file. Thank you very much in advance.

    Read the article

  • Python: using a regular expression to match one line of HTML

    - by skylarking
    This simple Python method I put together just checks to see if Tomcat is running on one of our servers. import urllib2 import re import sys def tomcat_check(): tomcat_status = urllib2.urlopen('http://10.1.1.20:7880') results = tomcat_status.read() pattern = re.compile('<body>Tomcat is running...</body>',re.M|re.DOTALL) q = pattern.search(results) if q == []: notify_us() else: print ("Tomcat appears to be running") sys.exit() If this line is not found : <body>Tomcat is running...</body> It calls : notify_us() Which uses SMTP to send an email message to myself and another admin that Tomcat is no longer runnning on the server... I have not used the re module in Python before...so I am assuming there is a better way to do this... I am also open to a more graceful solution with Beautiful Soup ... but haven't used that either.. Just trying to keep this as simple as possible...

    Read the article

  • Using free function as pseudo-constructors to exploit template parameter deduction

    - by Poita_
    Is it a common pattern/idiom to use free functions as pseudo-constructors to avoid having to explicitly specify template parameters? For example, everyone knows about std::make_pair, which uses its parameters to deduce the pair types: template <class A, class B> std::pair<A, B> make_pair(A a, B b) { return std::pair<A, B>(a, b); } // This allows you to call make_pair(1, 2), // instead of having to type pair<int, int>(1, 2) // as you can't get type deduction from the constructor. I find myself using this quite often, so I was just wondering if many other people use it, and if there is a name for this pattern?

    Read the article

  • Using glDrawElements does not draw my .obj file

    - by Hallik
    I am trying to correctly import an .OBJ file from 3ds Max. I got this working using glBegin() & glEnd() from a previous question on here, but had really poor performance obviously, so I am trying to use glDrawElements now. I am importing a chessboard, its game pieces, etc. The board, each game piece, and each square on the board is stored in a struct GroupObject. The way I store the data is like this: struct Vertex { float position[3]; float texCoord[2]; float normal[3]; float tangent[4]; float bitangent[3]; }; struct Material { float ambient[4]; float diffuse[4]; float specular[4]; float shininess; // [0 = min shininess, 1 = max shininess] float alpha; // [0 = fully transparent, 1 = fully opaque] std::string name; std::string colorMapFilename; std::string bumpMapFilename; std::vector<int> indices; int id; }; //A chess piece or square struct GroupObject { std::vector<Material *> materials; std::string objectName; std::string groupName; int index; }; All vertices are triangles, so there are always 3 points. When I am looping through the faces f section in the obj file, I store the v0, v1, & v2 in the Material-indices. (I am doing v[0-2] - 1 to account for obj files being 1-based and my vectors being 0-based. So when I get to the render method, I am trying to loop through every object, which loops through every material attached to that object. I set the material information and try and use glDrawElements. However, the screen is black. I was able to draw the model just fine when I looped through each distinct material with all the indices associated with that material, and it drew the model fine. This time around, so I can use the stencil buffer for selecting GroupObjects, I changed up the loop, but the screen is black. Here is my render loop. The only thing I changed was the for loop(s) so they go through each object, and each material in the object in turn. void GLEngine::drawModel() { glEnable(GL_BLEND); glBlendFunc(GL_SRC_ALPHA, GL_ONE_MINUS_SRC_ALPHA); // Vertex arrays setup glEnableClientState( GL_VERTEX_ARRAY ); glVertexPointer(3, GL_FLOAT, model.getVertexSize(), model.getVertexBuffer()->position); glEnableClientState( GL_NORMAL_ARRAY ); glNormalPointer(GL_FLOAT, model.getVertexSize(), model.getVertexBuffer()->normal); glClientActiveTexture( GL_TEXTURE0 ); glEnableClientState( GL_TEXTURE_COORD_ARRAY ); glTexCoordPointer(2, GL_FLOAT, model.getVertexSize(), model.getVertexBuffer()->texCoord); glUseProgram(blinnPhongShader); objects = model.getObjects(); // Loop through objects... for( int i=0 ; i < objects.size(); i++ ) { ModelOBJ::GroupObject *object = objects[i]; // Loop through materials used by object... for( int j=0 ; j<object->materials.size() ; j++ ) { ModelOBJ::Material *pMaterial = object->materials[j]; glMaterialfv(GL_FRONT_AND_BACK, GL_AMBIENT, pMaterial->ambient); glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, pMaterial->diffuse); glMaterialfv(GL_FRONT_AND_BACK, GL_SPECULAR, pMaterial->specular); glMaterialf(GL_FRONT_AND_BACK, GL_SHININESS, pMaterial->shininess * 128.0f); // Draw faces, letting OpenGL loop through them glDrawElements( GL_TRIANGLES, pMaterial->indices.size(), GL_UNSIGNED_INT, &pMaterial->indices ); } } if (model.hasNormals()) glDisableClientState(GL_NORMAL_ARRAY); if (model.hasTextureCoords()) { glClientActiveTexture(GL_TEXTURE0); glDisableClientState(GL_TEXTURE_COORD_ARRAY); } if (model.hasPositions()) glDisableClientState(GL_VERTEX_ARRAY); glBindTexture(GL_TEXTURE_2D, 0); glUseProgram(0); glDisable(GL_BLEND); } I don't know what I am missing that's important. If it's also helpful, here is where I read a 'f' face line and store the info in the obj importer in the pMaterial-indices. else if (sscanf(buffer, "%d/%d/%d", &v[0], &vt[0], &vn[0]) == 3) // v/vt/vn { fscanf(pFile, "%d/%d/%d", &v[1], &vt[1], &vn[1]); fscanf(pFile, "%d/%d/%d", &v[2], &vt[2], &vn[2]); v[0] = (v[0] < 0) ? v[0] + numVertices - 1 : v[0] - 1; v[1] = (v[1] < 0) ? v[1] + numVertices - 1 : v[1] - 1; v[2] = (v[2] < 0) ? v[2] + numVertices - 1 : v[2] - 1; currentMaterial->indices.push_back(v[0]); currentMaterial->indices.push_back(v[1]); currentMaterial->indices.push_back(v[2]); Again, this worked drawing it all together only separated by materials, so I haven't changed code anywhere else except added the indices to the materials within objects, and the loop in the draw method. Before everything was showing up black, now with the setup as above, I am getting an unhandled exception write violation on the glDrawElements line. I did a breakpoint there, and there are over 600 elements in the pMaterial-indices array, so it's not empty, it has indices to use. When I set the glDrawElements like this, it gives me the black screen but no errors glDrawElements( GL_TRIANGLES, pMaterial->indices.size(), GL_UNSIGNED_INT, &pMaterial->indices[0] ); I have also tried adding this when I loop through the faces on import if ( currentMaterial->startIndex == -1 ) currentMaterial->startIndex = v[0]; currentMaterial->triangleCount++; And when drawing... //in draw method glDrawElements( GL_TRIANGLES, pMaterial->triangleCount * 3, GL_UNSIGNED_INT, model.getIndexBuffer() + pMaterial->startIndex );

    Read the article

  • PHP regex help -- reverse search?

    - by Ian Silber
    So, I have a regex that searches for HTML tags and modifies them slightly. It's working great, but I need to do something special with the last closing HTML tag I find. Not sure of the best way to do this. I'm thinking some sort of reverse reg ex, but haven't found a way to do that. Here's my code so far: $html = "<div id="test"><p style="hello_world">This is a test.</p></div>"; $pattern = array('/<([A-Z][A-Z0-9]*)(\b[^>]*)>/i'); $replace = array('<tag>'); $html = preg_replace($pattern,$replace,$html); // Outputs: <tag><tag>This is a test</p></div> I'd like to replace the last occurance of "" with something special, say for example, "". Any ideas?

    Read the article

  • In C, how do you capture a group with regex?

    - by Sylvain
    Hi, I'm trying to extract a string from another using regex. I'm using the POSIX regex functions (regcomp, regexec ...), and I fail at capturing a group ... For instance, let the pattern be something as simple as "MAIL FROM:<(.*)>" (with REG_EXTENDED cflags) I want to capture everything between '<' and '' My problem is that regmatch_t gives me the boundaries of the whole pattern (MAIL FROM:<...) instead of just what's between the parenthesis ... What am I missing ? Thanks in advance,

    Read the article

  • Better exception for non-exhaustive patterns in case

    - by toofarsideways
    Is there a way to get GHCi to produce better exception messages when it finds at runtime that a call has produced value that does not match the function's pattern matching? It currently gives the line numbers of the function which produced the non-exhaustive pattern match which though helpful at times does require a round of debugging which at times I feel is doing the same set of things over and over. So before I tried to put together a solution I wanted to see if something else exists. An exception message that in addition to giving the line numbers shows what kind of call it attempted to make? Is this even possible?

    Read the article

  • How to Command Query Responsibility Segregation (CQRS) with ASP.NET MVC?

    - by Jeffrey
    I have been reading about Command Query Responsibility Segregation (CQRS). I sort of wonder how would this work with ASP.NET MVC? I get the idea of CQRS conceptually it sounds nice and sure does introduce some complexities (event and messaging pattern) compared to the "normal/common" approach . Also the idea of CQRS sort of against the use of ORM in some ways. I am trying to think how I could use this pattern in the coming projects so if anyone has experience in combining CQRS with ASP.NET MVC and NHibernate please give some concrete examples to help me better understand CQRS and use with ASP.NET MVC. Thanks!

    Read the article

  • PDF text search and split library

    - by Horace Ho
    I am look for a server side PDF library (or command line tool) which can: split a multi-page PDF file into individual PDF files, based on a search result of the PDF file content Examples: Search "Page ???" pattern in text and split the big PDF into 001.pdf, 002,pdf, ... ???.pdf A server program will scan the PDF, look for the search pattern, save the page(s) which match the patten, and save the file in the disk. It will be nice with integration with PHP / Ruby. Command line tool is also acceptable. It will be a server side (linux or win32) batch processing tool. GUI/login is not supported. i18n support will be nice but no required. Thanks~

    Read the article

  • Find Methods in a c# File programmatically

    - by sajad
    Hi Friends, I want to write a code to search for method defination and methods called in a c# file. So obviously my pattern should search for text like 1.public void xyz(blahtype blahvalue); 2.string construct = SearchData(blahvalue); Has anyone done similar to this, is Regex helpful in this case. if yes provide me the pattern. Any other workarounds. I dont know reflection(will it help in my case) Thanks, you guys gave it a try, i did not know this wud be so complex. All i wanted to do was suppose i have method like this public method1(int val) { method2(); method3(); } void method2(int val2) { method4() } i wanted to construct a string as Method1:Method2:method4 and Method1:Method3.... I guess its really complex

    Read the article

  • Cumulative +1/-1 Cointoss crashes on 1000 iterations. Please advise; c++ boost random libraries

    - by user1731972
    following some former advice Multithreaded application, am I doing it right? I think I have a threadsafe number generator using boost, but my program crashes when I input 1000 iterations. The output .csv file when graphed looks right, but I'm not sure why it's crashing. It's using _beginthread, and everyone is telling me I should use the more (convoluted) _beingthreadex, which I'm not familiar with. If someone could recommend an example, I would greatly appreciate it. Also... someone pointed out I should be applying a second parameter to my _beginthread for the array counting start positions, but I have no idea how to pass more than one parameter, other than attempting to use a structure, and I've read structure's and _beginthread don't get along (although, I could just use the boost threads...) #include <process.h> #include <windows.h> #include <iostream> #include <fstream> #include <time.h> #include <random> #include <boost/random.hpp> //for srand48_r(time(NULL), &randBuffer); which doesn't work #include <stdio.h> #include <stdlib.h> //#include <thread> using namespace std; using namespace boost; using namespace boost::random; void myThread0 (void *dummy ); void myThread1 (void *dummy ); void myThread2 (void *dummy ); void myThread3 (void *dummy ); //for random seeds void initialize(); //from http://stackoverflow.com/questions/7114043/random-number-generation-in-c11-how-to-generate-how-do-they-work uniform_int_distribution<> two(1,2); typedef std::mt19937 MyRNG; // the Mersenne Twister with a popular choice of parameters uint32_t seed_val; // populate somehow MyRNG rng1; // e.g. keep one global instance (per thread) MyRNG rng2; // e.g. keep one global instance (per thread) MyRNG rng3; // e.g. keep one global instance (per thread) MyRNG rng4; // e.g. keep one global instance (per thread) //only needed for shared variables //CRITICAL_SECTION cs1,cs2,cs3,cs4; // global int main() { ofstream myfile; myfile.open ("coinToss.csv"); int rNum; long numRuns; long count = 0; int divisor = 1; float fHolder = 0; long counter = 0; float percent = 0.0; //? //unsigned threadID; //HANDLE hThread; initialize(); HANDLE hThread[4]; const int size = 100000; int array[size]; printf ("Runs (uses multiple of 100,000) "); cin >> numRuns; for (int a = 0; a < numRuns; a++) { hThread[0] = (HANDLE)_beginthread( myThread0, 0, (void*)(array) ); hThread[1] = (HANDLE)_beginthread( myThread1, 0, (void*)(array) ); hThread[2] = (HANDLE)_beginthread( myThread2, 0, (void*)(array) ); hThread[3] = (HANDLE)_beginthread( myThread3, 0, (void*)(array) ); //waits for threads to finish before continuing WaitForMultipleObjects(4, hThread, TRUE, INFINITE); //closes handles I guess? CloseHandle( hThread[0] ); CloseHandle( hThread[1] ); CloseHandle( hThread[2] ); CloseHandle( hThread[3] ); //dump array into calculations //average array into fHolder //this could be split into threads as well for (int p = 0; p < size; p++) { counter += array[p] == 2 ? 1 : -1; //cout << array[p] << endl; //cout << counter << endl; } //this fHolder calculation didn't work //fHolder = counter / size; //so I had to use this cout << counter << endl; fHolder = counter; fHolder = fHolder / size; myfile << fHolder << endl; } } void initialize() { //seed value needs to be supplied //rng1.seed(seed_val*1); rng1.seed((unsigned int)time(NULL)); rng2.seed(((unsigned int)time(NULL))*2); rng3.seed(((unsigned int)time(NULL))*3); rng4.seed(((unsigned int)time(NULL))*4); }; void myThread0 (void *param) { //EnterCriticalSection(&cs1); //aquire the critical section object int *i = (int *)param; for (int x = 0; x < 25000; x++) { //doesn't work, part of merssene twister //i[x] = next(); i[x] = two(rng1); //original srand //i[x] = rand() % 2 + 1; //doesn't work for some reason. //uint_dist2(rng); //i[x] = qrand() % 2 + 1; //cout << i[x] << endl; } //LeaveCriticalSection(&cs1); // release the critical section object } void myThread1 (void *param) { //EnterCriticalSection(&cs2); //aquire the critical section object int *i = (int *)param; for (int x = 25000; x < 50000; x++) { //param[x] = rand() % 2 + 1; i[x] = two(rng2); //i[x] = rand() % 2 + 1; //cout << i[x] << endl; } //LeaveCriticalSection(&cs2); // release the critical section object } void myThread2 (void *param) { //EnterCriticalSection(&cs3); //aquire the critical section object int *i = (int *)param; for (int x = 50000; x < 75000; x++) { i[x] = two(rng3); //i[x] = rand() % 2 + 1; //cout << i[x] << endl; } //LeaveCriticalSection(&cs3); // release the critical section object } void myThread3 (void *param) { //EnterCriticalSection(&cs4); //aquire the critical section object int *i = (int *)param; for (int x = 75000; x < 100000; x++) { i[x] = two(rng4); //i[x] = rand() % 2 + 1; //cout << i[x] << endl; } //LeaveCriticalSection(&cs4); // release the critical section object }

    Read the article

  • Am I just not understanding TDD unit testing (Asp.Net MVC project)?

    - by KallDrexx
    I am trying to figure out how to correctly and efficiently unit test my Asp.net MVC project. When I started on this project I bought the Pro ASP.Net MVC, and with that book I learned about TDD and unit testing. After seeing the examples, and the fact that I work as a software engineer in QA in my current company, I was amazed at how awesome TDD seemed to be. So I started working on my project and went gun-ho writing unit tests for my database layer, business layer, and controllers. Everything got a unit test prior to implementation. At first I thought it was awesome, but then things started to go downhill. Here are the issues I started encountering: I ended up writing application code in order to make it possible for unit tests to be performed. I don't mean this in a good way as in my code was broken and I had to fix it so the unit test pass. I mean that abstracting out the database to a mock database is impossible due to the use of linq for data retrieval (using the generic repository pattern). The reason is that with linq-sql or linq-entities you can do joins just by doing: var objs = select p from _container.Projects select p.Objects; However, if you mock the database layer out, in order to have that linq pass the unit test you must change the linq to be var objs = select p from _container.Projects join o in _container.Objects on o.ProjectId equals p.Id select o; Not only does this mean you are changing your application logic just so you can unit test it, but you are making your code less efficient for the sole purpose of testability, and getting rid of a lot of advantages using an ORM has in the first place. Furthermore, since a lot of the IDs for my models are database generated, I proved to have to write additional code to handle the non-database tests since IDs were never generated and I had to still handle those cases for the unit tests to pass, yet they would never occur in real scenarios. Thus I ended up throwing out my database unit testing. Writing unit tests for controllers was easy as long as I was returning views. However, the major part of my application (and the one that would benefit most from unit testing) is a complicated ajax web application. For various reasons I decided to change the app from returning views to returning JSON with the data I needed. After this occurred my unit tests became extremely painful to write, as I have not found any good way to write unit tests for non-trivial json. After pounding my head and wasting a ton of time trying to find a good way to unit test the JSON, I gave up and deleted all of my controller unit tests (all controller actions are focused on this part of the app so far). So finally I was left with testing the Service layer (BLL). Right now I am using EF4, however I had this issue with linq-sql as well. I chose to do the EF4 model-first approach because to me, it makes sense to do it that way (define my business objects and let the framework figure out how to translate it into the sql backend). This was fine at the beginning but now it is becoming cumbersome due to relationships. For example say I have Project, User, and Object entities. One Object must be associated to a project, and a project must be associated to a user. This is not only a database specific rule, these are my business rules as well. However, say I want to do a unit test that I am able to save an object (for a simple example). I now have to do the following code just to make sure the save worked: User usr = new User { Name = "Me" }; _userService.SaveUser(usr); Project prj = new Project { Name = "Test Project", Owner = usr }; _projectService.SaveProject(prj); Object obj = new Object { Name = "Test Object" }; _objectService.SaveObject(obj); // Perform verifications There are many issues with having to do all this just to perform one unit test. There are several issues with this. For starters, if I add a new dependency, such as all projects must belong to a category, I must go into EVERY single unit test that references a project, add code to save the category then add code to add the category to the project. This can be a HUGE effort down the road for a very simple business logic change, and yet almost none of the unit tests I will be modifying for this requirement are actually meant to test that feature/requirement. If I then add verifications to my SaveProject method, so that projects cannot be saved unless they have a name with at least 5 characters, I then have to go through every Object and Project unit test to make sure that the new requirement doesn't make any unrelated unit tests fail. If there is an issue in the UserService.SaveUser() method it will cause all project, and object unit tests to fail and it the cause won't be immediately noticeable without having to dig through the exceptions. Thus I have removed all service layer unit tests from my project. I could go on and on, but so far I have not seen any way for unit testing to actually help me and not get in my way. I can see specific cases where I can, and probably will, implement unit tests, such as making sure my data verification methods work correctly, but those cases are few and far between. Some of my issues can probably be mitigated but not without adding extra layers to my application, and thus making more points of failure just so I can unit test. Thus I have no unit tests left in my code. Luckily I heavily use source control so I can get them back if I need but I just don't see the point. Everywhere on the internet I see people talking about how great TDD unit tests are, and I'm not just talking about the fanatical people. The few people who dismiss TDD/Unit tests give bad arguments claiming they are more efficient debugging by hand through the IDE, or that their coding skills are amazing that they don't need it. I recognize that both of those arguments are utter bullocks, especially for a project that needs to be maintainable by multiple developers, but any valid rebuttals to TDD seem to be few and far between. So the point of this post is to ask, am I just not understanding how to use TDD and automatic unit tests?

    Read the article

  • Java Time Zone When Parsing DateFormat

    - by shipmaster
    I had code that parses date as follows: String ALT_DATE_TIME_FORMAT = "yyyy-MM-dd'T'HH:mm:ss.SSSZ"; SimpleDateFormat sdf = new SimpleDateFormat( ALT_DATE_TIME_FORMAT); Date date = sdf.parse(requiredTimeStamp); And it was working fine, suddenly, this stopped working. It turns out an admin made some config changes on the server and the date is currently being returned as "2010-12-27T10:50:44.000-08:00" which is not parse-able by the above pattern. I have two questions: The first would be what pattern would parse the date being returned by the JVM in the format above (specifically, just '-08:00' as the time zone)? And second, where exactly would one change such settings on a linux RHEL 5 server so that we are aware of such changes in the future?

    Read the article

  • WPF - Handling events from user control in View Model

    - by Vitaly
    I’m building a WPF application using MVVM pattern (both are new technologies for me). I use user controls for simple bits of reusable functionality that doesn’t contain business logic, and MVVM pattern to build application logic. Suppose a view contains my user control that fires events, and I want to add an event handler to that event. That event handler should be in the view model of the view, because it contains business logic. The question is – view and the view model are connected only by binding; how do I connect an event handler using binding? Is it even possible (I suspect not)? If not – how should I handle events from a control in the view model? Maybe I should use commands or INotifyPropertyChanged?

    Read the article

  • How do I remove the time from printpreview dialog?

    - by Albo Best
    Here is my code: Imports System.Data.OleDb Imports System.Drawing.Printing Namespace Print Public Class Form1 Inherits System.Windows.Forms.Form Dim PrintC As PrinterClass Dim conn As OleDb.OleDbConnection Dim connectionString As String = "Provider=Microsoft.Jet.OLEDB.4.0;Data Source=..\\db1.mdb" Dim sql As String = String.Empty Dim ds As DataSet Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load FillDataGrid() '//create printerclass object PrintC = New PrinterClass(PrintDocument1, dataGrid) End Sub Private Sub FillDataGrid() Try Dim dt As New DataTable Dim ds As New DataSet ds.Tables.Add(dt) Dim da As New OleDbDataAdapter con.Open() da = New OleDbDataAdapter("SELECT * from klient ", con) da.Fill(dt) con.Close() dataGrid.DataSource = dt.DefaultView Dim dTable As DataTable For Each dTable In ds.Tables Dim dgStyle As DataGridTableStyle = New DataGridTableStyle dgStyle.MappingName = dTable.TableName dataGrid.TableStyles.Add(dgStyle) Next ' DataGrid settings dataGrid.CaptionText = "TE GJITHE KLIENTET" dataGrid.HeaderFont = New Font("Verdana", 12) dataGrid.TableStyles(0).GridColumnStyles(0).Width = 60 dataGrid.TableStyles(0).GridColumnStyles(1).Width = 140 dataGrid.TableStyles(0).GridColumnStyles(2).Width = 140 dataGrid.TableStyles(0).GridColumnStyles(3).Width = 140 dataGrid.TableStyles(0).GridColumnStyles(4).Width = 140 dataGrid.TableStyles(0).GridColumnStyles(5).HeaderText = "" dataGrid.TableStyles(0).GridColumnStyles(5).Width = -1 Catch ex As Exception MessageBox.Show(ex.Message) End Try End Sub Private Sub btnPrint_Click(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles btnPrint.Click 'create printerclass object PrintC = New PrinterClass(PrintDocument1, dataGrid) PrintDocument1.Print() End Sub Private Sub btnPreview_Click(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles btnPreview.Click 'create printerclass object PrintC = New PrinterClass(PrintDocument1, dataGrid) ''preview Dim ps As New PaperSize("A4", 840, 1150) ps.PaperName = PaperKind.A4 PrintDocument1.DefaultPageSettings.PaperSize = ps PrintPreviewDialog1.WindowState = FormWindowState.Normal PrintPreviewDialog1.StartPosition = FormStartPosition.CenterScreen PrintPreviewDialog1.ClientSize = New Size(600, 600) PrintPreviewDialog1.ShowDialog() End Sub Private Sub PrintDocument1_PrintPage(ByVal sender As System.Object, ByVal e As System.Drawing.Printing.PrintPageEventArgs) Handles PrintDocument1.PrintPage 'print grid Dim morepages As Boolean = PrintC.Print(e.Graphics) If (morepages) Then e.HasMorePages = True End If End Sub End Class End Namespace This is how data looks in DataGrid (that's perfect)... and here is how it looks when I click PrintPreview. (I don't want the time to appear there, the "12:00:00" part. in database the date is stored as Short Date (10-Dec-12) Can somebody suggest a way around that? Imports System Imports System.Windows.Forms Imports System.Drawing Imports System.Drawing.Printing Imports System.Collections Imports System.Data Namespace Print Public Class PrinterClass '//clone of Datagrid Dim PrintGrid As Grid '//printdocument for initial printer settings Private PrintDoc As PrintDocument '//defines whether the grid is ordered right to left Private bRightToLeft As Boolean '//Current Top Private CurrentY As Single = 0 '//Current Left Private CurrentX As Single = 0 '//CurrentRow to print Private CurrentRow As Integer = 0 '//Page Counter Public PageCounter As Integer = 0 '/// <summary> '/// Constructor Class '/// </summary> '/// <param name="pdocument"></param> '/// <param name="dgrid"></param> Public Sub New(ByVal pdocument As PrintDocument, ByVal dgrid As DataGrid) 'MyBase.new() PrintGrid = New Grid(dgrid) PrintDoc = pdocument '//The grid columns are right to left bRightToLeft = dgrid.RightToLeft = RightToLeft.Yes '//init CurrentX and CurrentY CurrentY = pdocument.DefaultPageSettings.Margins.Top CurrentX = pdocument.DefaultPageSettings.Margins.Left End Sub Public Function Print(ByVal g As Graphics, ByRef currentX As Single, ByRef currentY As Single) As Boolean '//use predefined area currentX = currentX currentY = currentY PrintHeaders(g) Dim Morepages As Boolean = PrintDataGrid(g) currentY = currentY currentX = currentX Return Morepages End Function Public Function Print(ByVal g As Graphics) As Boolean CurrentX = PrintDoc.DefaultPageSettings.Margins.Left CurrentY = PrintDoc.DefaultPageSettings.Margins.Top PrintHeaders(g) Return PrintDataGrid(g) End Function '/// <summary> '/// Print the Grid Headers '/// </summary> '/// <param name="g"></param> Private Sub PrintHeaders(ByVal g As Graphics) Dim sf As StringFormat = New StringFormat '//if we want to print the grid right to left If (bRightToLeft) Then CurrentX = PrintDoc.DefaultPageSettings.PaperSize.Width - PrintDoc.DefaultPageSettings.Margins.Right sf.FormatFlags = StringFormatFlags.DirectionRightToLeft Else CurrentX = PrintDoc.DefaultPageSettings.Margins.Left End If Dim i As Integer For i = 0 To PrintGrid.Columns - 1 '//set header alignment Select Case (CType(PrintGrid.Headers.GetValue(i), Header).Alignment) Case HorizontalAlignment.Left 'left sf.Alignment = StringAlignment.Near Case HorizontalAlignment.Center sf.Alignment = StringAlignment.Center Case HorizontalAlignment.Right sf.Alignment = StringAlignment.Far End Select '//advance X according to order If (bRightToLeft) Then '//draw the cell bounds (lines) and back color g.FillRectangle(New SolidBrush(PrintGrid.HeaderBackColor), CurrentX - PrintGrid.Headers(i).Width, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height) g.DrawRectangle(New Pen(PrintGrid.LineColor), CurrentX - PrintGrid.Headers(i).Width, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height) '//draw the cell text g.DrawString(PrintGrid.Headers(i).CText, PrintGrid.Headers(i).Font, New SolidBrush(PrintGrid.HeaderForeColor), New RectangleF(CurrentX - PrintGrid.Headers(i).Width, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height), sf) '//next cell CurrentX -= PrintGrid.Headers(i).Width Else '//draw the cell bounds (lines) and back color g.FillRectangle(New SolidBrush(PrintGrid.HeaderBackColor), CurrentX, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height) g.DrawRectangle(New Pen(PrintGrid.LineColor), CurrentX, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height) '//draw the cell text g.DrawString(PrintGrid.Headers(i).CText, PrintGrid.Headers(i).Font, New SolidBrush(PrintGrid.HeaderForeColor), New RectangleF(CurrentX, CurrentY, PrintGrid.Headers(i).Width, PrintGrid.Headers(i).Height), sf) '//next cell CurrentX += PrintGrid.Headers(i).Width End If Next '//reset to beginning If (bRightToLeft) Then '//right align CurrentX = PrintDoc.DefaultPageSettings.PaperSize.Width - PrintDoc.DefaultPageSettings.Margins.Right Else '//left align CurrentX = PrintDoc.DefaultPageSettings.Margins.Left End If '//advance to next row CurrentY = CurrentY + CType(PrintGrid.Headers.GetValue(0), Header).Height End Sub Private Function PrintDataGrid(ByVal g As Graphics) As Boolean Dim sf As StringFormat = New StringFormat PageCounter = PageCounter + 1 '//if we want to print the grid right to left If (bRightToLeft) Then CurrentX = PrintDoc.DefaultPageSettings.PaperSize.Width - PrintDoc.DefaultPageSettings.Margins.Right sf.FormatFlags = StringFormatFlags.DirectionRightToLeft Else CurrentX = PrintDoc.DefaultPageSettings.Margins.Left End If Dim i As Integer For i = CurrentRow To PrintGrid.Rows - 1 Dim j As Integer For j = 0 To PrintGrid.Columns - 1 '//set cell alignment Select Case (PrintGrid.Cell(i, j).Alignment) '//left Case HorizontalAlignment.Left sf.Alignment = StringAlignment.Near Case HorizontalAlignment.Center sf.Alignment = StringAlignment.Center '//right Case HorizontalAlignment.Right sf.Alignment = StringAlignment.Far End Select '//advance X according to order If (bRightToLeft) Then '//draw the cell bounds (lines) and back color g.FillRectangle(New SolidBrush(PrintGrid.BackColor), CurrentX - PrintGrid.Cell(i, j).Width, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height) g.DrawRectangle(New Pen(PrintGrid.LineColor), CurrentX - PrintGrid.Cell(i, j).Width, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height) '//draw the cell text g.DrawString(PrintGrid.Cell(i, j).CText, PrintGrid.Cell(i, j).Font, New SolidBrush(PrintGrid.ForeColor), New RectangleF(CurrentX - PrintGrid.Cell(i, j).Width, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height), sf) '//next cell CurrentX -= PrintGrid.Cell(i, j).Width Else '//draw the cell bounds (lines) and back color g.FillRectangle(New SolidBrush(PrintGrid.BackColor), CurrentX, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height) g.DrawRectangle(New Pen(PrintGrid.LineColor), CurrentX, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height) '//draw the cell text '//Draw text by alignment g.DrawString(PrintGrid.Cell(i, j).CText, PrintGrid.Cell(i, j).Font, New SolidBrush(PrintGrid.ForeColor), New RectangleF(CurrentX, CurrentY, PrintGrid.Cell(i, j).Width, PrintGrid.Cell(i, j).Height), sf) '//next cell CurrentX += PrintGrid.Cell(i, j).Width End If Next '//reset to beginning If (bRightToLeft) Then '//right align CurrentX = PrintDoc.DefaultPageSettings.PaperSize.Width - PrintDoc.DefaultPageSettings.Margins.Right Else '//left align CurrentX = PrintDoc.DefaultPageSettings.Margins.Left End If '//advance to next row CurrentY += PrintGrid.Cell(i, 0).Height CurrentRow += 1 '//if we are beyond the page margin (bottom) then we need another page, '//return true If (CurrentY > PrintDoc.DefaultPageSettings.PaperSize.Height - PrintDoc.DefaultPageSettings.Margins.Bottom) Then Return True End If Next Return False End Function End Class End Namespace

    Read the article

  • Overwhelmed by design patterns... where to begin?

    - by Pete
    I am writing a simple prototype code to demonstrate & profile I/O schemes (HDF4, HDF5, HDF5 using parallel IO, NetCDF, etc.) for a physics code. Since focus is on IO, the rest of the program is very simple: class Grid { public: floatArray x,y,z; }; class MyModel { public: MyModel(const int &nip1, const int &njp1, const int &nkp1, const int &numProcs); Grid grid; map<string, floatArray> plasmaVariables; }; Where floatArray is a simple class that lets me define arbitrary dimensioned arrays and do mathematical operations on them (i.e. x+y is point-wise addition). Of course, I could use better encapsulation (write accessors/setters, etc.), but that's not the concept I'm struggling with. For the I/O routines, I am envisioning applying simple inheritance: Abstract I/O class defines read & write functions to fill in the "myModel" object HDF4 derived class HDF5 HDF5 using parallel IO NetCDF etc... The code should read data in any of these formats, then write out to any of these formats. In the past, I would add an AbstractIO member to myModel and create/destroy this object depending on which I/O scheme I want. In this way, I could do something like: myModelObj.ioObj->read('input.hdf') myModelObj.ioObj->write('output.hdf') I have a bit of OOP experience but very little on the Design Patterns front, so I recently acquired the Gang of Four book "Design Patterns: Elements of Reusable Object-Oriented Software". OOP designers: Which pattern(s) would you recommend I use to integrate I/O with the myModel object? I am interested in answering this for two reasons: To learn more about design patterns in general Apply what I learn to help refactor an large old crufty/legacy physics code to be more human-readable & extensible. I am leaning towards applying the Decerator pattern to myModel, so I can attach the I/O responsibilities dynamically to myModel (i.e. whether to use HDF4, HDF5, etc.). However, I don't feel very confident that this is the best pattern to apply. Reading the Gang of Four book cover-to-cover before I start coding feels like a good way to develop an unhealthy caffeine addiction. What patterns do you recommend?

    Read the article

< Previous Page | 452 453 454 455 456 457 458 459 460 461 462 463  | Next Page >