Search Results

Search found 46727 results on 1870 pages for 'system reflection'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 458/1870 | < Previous Page | 454 455 456 457 458 459 460 461 462 463 464 465  | Next Page >

  • How to find all the file handles by a process programmatically?

    - by kumar
    I have a process "x" which uses "system" C function to start ntpd daemon. I observed that ntpd are passed the open file descriptors of "x". ntpd holds on to the file descriptors even after original file is deleted. for ex: Some log files used by "x" are rotated out after sometime, but "ntpd" has file handle opened for these deleted files. Will it cause any problem? Alternatively I thought of setting "FD_CLOEXEC" flag for all the file descriptors before calling "system" function. But as we are running as an extension library to third process "x"( "x" loads our library based on some condition), there is no easy way to know about all the file descriptors process has opened. One way is to read /proc//fd and set "FD_CLOEXEC" for each file handle and reset it back after "system" function returns. I'm using Linux 2.16. Is there any other easy way to find all the file handlers? Thanks,

    Read the article

  • Parsing String to Time and insert in mysqldatabase

    - by kawtousse
    Goal: Parse a string from an input type text into TIME type to be inserted in MYSQL Database. String start= request.getParameter("startp"); System.out.println("start:" +start); SimpleDateFormat sdf = new SimpleDateFormat("HH:mm:ss"); long ms=0; try { ms = sdf.parse(start).getTime(); System.out.println(" the value of ms is:" +ms); } catch (ParseException e1) { // TODO Auto-generated catch block e1.printStackTrace(); } Time ts = new Time(ms); System.out.println("the value of ts is:" +ts); start:14:12 (value witch i entered actually in the form at the start field named startp) the value of ts is :01:00:00 java.text.ParseException: Unparseable date: "14:12" at java.text.DateFormat.parse(Unknown Source) ms not displayed I ensure that database type of the following parameter is TIME. Thanks.

    Read the article

  • Generate SQL Server Express database from Entity Framework 4 model

    - by Cranialsurge
    I am able to auto-generate a SQL Server CE 4.0 *.sdf file using code-first generation as explained by Scott Guthrie here. The connection string for the same is as follows: <add name="NerdDinners" providerName="System.Data.SqlServerCe.4.0" connectionString="data source=|DataDirectory|NerdDinner.sdf"/> However if I try to generate an mdf instead using the following connection string, it fails to do so with the following error - "The provider did not return a ProviderManifestToken string.". <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="data source=|DataDirectory|NerdDinner.mdf"/> Even directly hooking into a SQLEXPRESS instance using the following connection string fails <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="Data Source=.\SQLEXPRESS;Initial Catalog=NerdDinner;Integrated Security=True"/> Does EF 4 only support SQL CE 4.0 for database creation from a model for now or am I doing something wrong here?

    Read the article

  • Traditional ASP.NET application in subdirectory of an MVC application

    - by David
    Windows Server 2003, IIS6. We're trying to deploy a non-MVC ASP.NET web application as a subdirectory of an MVC application. However the ASP.NET application in the subdirectory is failing with the message "Could not load file or assembly 'System.Web.Mvc, Version=1.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35' or one of its dependencies. The system cannot find the file specified." which is bizarre because it's not an MVC application.

    Read the article

  • Measuring device drivers CPU/IO utilization caused by my program

    - by Lior Kogan
    Sometimes code can utilize device drivers up to the point where the system is unresponsive. Lately I've optimized a WIN32/VC++ code which made the system almost unresponsive. The CPU usage, however, was very low. The reason was 1000's of creations and destruction of GDI objects (pens, brushes, etc.). Once I refactored the code to create all objects only once - the system became responsive again. This leads me to the question: Is there a way to measure CPU/IO usage of device drivers (GPU/disk/etc) for a given program / function / line of code?

    Read the article

  • Forbid access to DVD/CD/USB for some users

    - by alex2k8
    I need to forbid all users except administrators to write into DVD/CD/USB drives on Windows XP. Googled around and there is a way to disable devices completely: Cdrom: HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\cdrom\Start (from 1 to 4) Usb: HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\USBSTOR (from 3 to 4) but I need to disable them only for particular users.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Storing millions of URLs in a database for fast pattern matching

    - by Paras Chopra
    I am developing a web analytics kind of system which needs to log referring URL, landing page URL and search keywords for every visitor on the website. What I want to do with this collected data is to allow end-user to query the data such as "Show me all visitors who came from Bing.com searching for phrase that contains 'red shoes'" or "Show me all visitors who landed on URL that contained 'campaign=twitter_ad'", etc. Because this system will be used on many big websites, the amount of data that needs to log will grow really, really fast. So, my question: a) what would be the best strategy for logging so that scaling the system doesn't become a pain; b) how to use that architecture for rapid querying of arbitrary requests? Is there a special method of storing URLs so that querying them gets faster? In addition to MySQL database that I use, I am exploring (and open to) other alternatives better suited for this task.

    Read the article

  • Can computer crashes and reboots mean weak power supply?

    - by TomA
    Recently I replaced the videocard in my PC for a newer, faster one. All games work perfectly but I get random system crashes and reboots. This happens even when the system is almost idle (browsing, playing music). It never happened with the old card. All drivers are up-to-date. Is it possible that the power supply is not powerful enough for the new card?

    Read the article

  • Problem with running c# application on another PC

    - by draghia-aurelian
    I wrote a Windows Form Application in C# and it works well for my computer. But on another PC, an error occurs when i try to do some stuff. code 1 private void rUNToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in rUNToolStripMenuItem_Click!"); ... } code 2 private void dataPositionToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in dataPositionToolStripMenuItem_Click!"); ... } Running on my computer: code1: MessageBox appears! code2: MessageBox appears! Running on another computer: code1: MessageBox doesn't appear and the error happens! code2: MessageBox appears! The error is: Method not found: "Void Microsoft.CSharp.RuntimeBinder.CSharpGetMemberBider..ctor(System.String.System.Type, System.Collections.Generic.IEnumerable'1)'. This is the PrintScreen with error: Please help me to solve the problem!

    Read the article

  • How I pass a delegate prototype to a method?

    - by Jeff Dahmer
    SO lets say in my class I have: public delegate bool MyFunc(int param); How can I then do this someObj.PassMeADelegateToExamine(this.MyFunc); // not possible!?! SO that I can examine the delegate and perhaps use reflection or something idk to find out it's return type and any params it might have? Basically if I can transform it into an (uncallable) Action object that woul dbe grand

    Read the article

  • SWT Filedialog Open into home folder

    - by Ivan
    I want to open a FileDialog window into the user home folder (i.e. /home/user or /Users/unsername) I read the user home folder, using System.getProperty: String homefolder = System.getProperty(user.home); And the variable containts the correct home folder. But when i set the filterpath in FileDialog, it opens (in linux) only the /home level not entering into the user home dir. This is the source code: FileDialog dialog = new FileDialog(shell); dialog.setText("Choose a certificate"); String platform = SWT.getPlatform(); String homefolder = System.getProperty("user.home"); dialog.setFilterPath(homefolder); Any idea? Here a screenshot:

    Read the article

  • Qt vs .NET - a few comparisons [closed]

    - by Pirate for Profit
    Event Handling In Qt the event handling system you just emit signals when something cool happens and then catch them in slots, for instance emit valueChanged(int percent, bool something); and void MyCatcherObj::valueChanged(int p, bool ok){} blocking them and disconnecting them when needed, doing it across threads... once you get the hang of it, it just seems a lot more natural and intuitive than the way the .NET event handling is set up (you know, object sender, CustomEventArgs e). And I'm not just talking about syntax, because in the end the .NET delegate crap is the bomb. I'm also talking about in more than just reflection (because, yes, .NET obviously has much stronger reflection capabilities). I'm talking about in the way the system feels to a human being. Qt wins hands down i m o. Basically, the footprints make more sense and you can visualize the project easier without the clunky event handling system. I wish I could it explain it better. The only thing is, I do love some of the ease of C# compared to C++ and .NET's assembly architecture. That is a big bonus for modular projects, which are a PITA to do in C++. Database Ease of Doing Crap Also what about datasets and database manipulations. I think .net wins here but I'm not sure. Threading/Conccurency How do you guys think of the threading? In .NET, all I've ever done is make like a list of master worker threads with locks. I like QConcurrentFramework, you don't worry about locks or anything, and with the ease of the signal slot system across threads it's nice to get notified about the progress of things. Memory Usage Also what do you think of the overall memory usage comparison. Is the .NET garbage collector pretty on the ball and quick compared to the instantaneous nature of native memory management? Or does it just let programs leak up a storm and lag the computer then clean it up when it's about to really lag? However, I am a n00b who doesn't know what I'm talking about, please school me on the subject.

    Read the article

  • Routing and Remote Access Service won't start after full disk

    - by NKCSS
    The HDD of the server was out of disk space, and after a reboot, RRAS won't start anymore on my 2008 R2 server. Error Details: Log Name: System Source: RemoteAccess Date: 2/5/2012 9:39:52 PM Event ID: 20153 Task Category: None Level: Error Keywords: Classic User: N/A Computer: Windows14111.<snip> Description: The currently configured accounting provider failed to load and initialize successfully. The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error. Event Xml: <Event xmlns="http://schemas.microsoft.com/win/2004/08/events/event"> <System> <Provider Name="RemoteAccess" /> <EventID Qualifiers="0">20153</EventID> <Level>2</Level> <Task>0</Task> <Keywords>0x80000000000000</Keywords> <TimeCreated SystemTime="2012-02-05T20:39:52.000Z" /> <EventRecordID>12148869</EventRecordID> <Channel>System</Channel> <Computer>Windows14111.<snip></Computer> <Security /> </System> <EventData> <Data>The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error.</Data> <Binary>2C030000</Binary> </EventData> </Event> I think it has something to do with a corrupt config file, but I am unsure of what to do. I Removed the RRAS role, rebooted, and re-added, but it keeps failing with the same error. Thanks in advance. [UPDATE] If i set the accounting provider from 'Windows' to '' the service starts but VPN won't work. Any ideas how this can be repaired?

    Read the article

  • Enable access for assistive device programmatically

    - by Dheeraj
    Hi All, I want to enable Access for assistive devices in System Preferences programmatically. But Problem is that my application is not running as root user and i do not want my application to be as root user and also should not ask for any authentication in between. I want to tap all keyboard events globally. I am using CGEventTapCreate() for the same.In the documentation of CGEventTapCreate() API it is mentioned that, Event taps receive key up and key down events if one of the following conditions is true: The current process is running as the root user. Access for assistive devices is enabled. In Mac OS X v10.4 & later, you can enable this feature using System Preferences, Universal Access panel, Keyboard view. I tried manually by checking the Enable Access for assistive devices from System Preference and it gives me expected output. So is there any way to do the same via program without asking for authentication and also application is not running as root user? Thanks, Dheeraj.

    Read the article

  • Assigning the Tag Property of a Control in WPF

    - by jmayor
    If I have 7 checkBoxes, one for each day of the week, Can I assing in XAML the Tag property to each one of the the System.DayOfWeek enumeration value? <StackPanel > <StackPanel.Resources> <system:DayOfWeek x:Key="Monday" >Monday</system:DayOfWeek> </StackPanel.Resources> <CheckBox Name="chkMo" Tag="{StaticResource Monday}">Mo</CheckBox> ... </StackPanel> Is there a way to assign directly the enum value to the tag without using resources?

    Read the article

  • Make a Phone ring from BASH through a HUAWEI e220

    - by microspino
    Hello, I have a Debian Linux system with a HUAWEI e220 on /dev/ttyUSB0. I'd like to make It ring a generic GSM phone for just one time. I'm doing this because I'd like to build an embedded system that fires some special behavior by a single GSM phone ring. How can I do It? I've tried wvdial but I receive always a "NO CARRIER" answer when I try to send It an "ATDT XXX-phone-number-to-dial-XXX" command.

    Read the article

  • Problem regarding listShuttle component in richFaces ?

    - by Hari
    I am a newbee for Richfaces components, When i am using the <rich:listShuttle> the Arraylist specified in the targetValue is now getting updated with the latest data? Kindly help MyJSF File <a4j:region> <rich:listShuttle sourceValue="#{bean.selectItems}" id="one" targetValue="#{bean.selectItemsone}" var="items" listsHeight="150" sourceListWidth="130" targetListWidth="130" sourceCaptionLabel="Intial Items" targetCaptionLabel="Selected Items" converter="Listconverter"> <rich:column> <h:outputText value="#{items.value}"></h:outputText> </rich:column> </rich:listShuttle> </a4j:region> <a4j:region> <a4j:commandButton value="Submit" action="#{bean.action}" /> </a4j:region> My Managed Bean enter code here private List<String> selectedData; private List<BeanItems> selectItems; private List<BeanItems> selectItemsone; public String action() { System.out.println(selectItems); System.out.println(selectItemsone); System.out.println("Select Item List"); Iterator<BeanItems> iterator = selectItems.iterator(); while (iterator.hasNext()) { BeanItems item = (BeanItems) iterator.next(); System.out.println(item.getValue()); } System.out.println("/nSelect Item one list "); Iterator<BeanItems> iterator2 = selectItemsone.iterator(); while (iterator2.hasNext()) { BeanItems item = (BeanItems) iterator2.next(); System.out.println(item.getValue()); } return ""; } public void setSelectedData(List<String> selectedData) { this.selectedData = selectedData; } public List<String> getSelectedData() { return selectedData; } /** * @return the selectItems */ public List<BeanItems> getSelectItems() { if (selectItems == null) { selectItems = new ArrayList<BeanItems>(); selectItems.add(new BeanItems("value4", "label4")); selectItems.add(new BeanItems("value5", "label5")); selectItems.add(new BeanItems("value6", "label6")); selectItems.add(new BeanItems("value7", "label7")); selectItems.add(new BeanItems("value8", "label8")); selectItems.add(new BeanItems("value9", "label9")); selectItems.add(new BeanItems("value10", "label10")); } return selectItems; } /** * @return the selectItemsone */ public List<BeanItems> getSelectItemsone() { if (selectItemsone == null) { selectItemsone = new ArrayList<BeanItems>(); selectItemsone.add(new BeanItems("value1", "label1")); selectItemsone.add(new BeanItems("value2", "label2")); selectItemsone.add(new BeanItems("value3", "label3")); } return selectItemsone; } My Converter Class enter code here public Object getAsObject(FacesContext context, UIComponent component,String value) { int index = value.indexOf(':'); return new BeanItems(value.substring(0, index), value.substring(index + 1)); } public String getAsString(FacesContext context, UIComponent component,Object value) { BeanItems beanItems = (BeanItems) value; return beanItems.getValue() + ":" + beanItems.getData(); } My BeanItems Class enter code here private String data; //Getter & setter private String value; //Getter & setter public BeanItems() { } public BeanItems(String value, String data) { this.value = value; this.data = data; } public int hashCode() { final int prime = 31; int result = 1; result = prime * result + ((data == null) ? 0 : data.hashCode()); result = prime * result + ((value == null) ? 0 : value.hashCode()); return result; } public boolean equals(Object obj) { if (this == obj) return true; if (obj == null) return false; if (getClass() != obj.getClass()) return false; final BeanItems other = (BeanItems) obj; if (data == null) { if (other.data != null) return false; } else if (!data.equals(other.data)) return false; if (value == null) { if (other.value != null) return false; } else if (!value.equals(other.value)) return false; return true; }

    Read the article

  • NDepend: How to not display 'tier' assemblies in dependency graph?

    - by Edward Buatois
    I was able to do this in an earlier version of nDepend by going to tools-options and setting which assemblies would be part of the analysis (and ignore the rest). The latest version of the trial version of nDepend lets me set it, but it seems to ignore the setting and always analyze all assemblies whether I want it to or not. I tried to delete the "tier" assemblies by moving them over to the "application assemblies" list, but when I delete them out of there, they just get added back to the "tier" list, which I can't ignore. I don't want my dependency graph to contain assemblies like "system," "system.xml," and "system.serialization!" I want only MY assemblies in the dependency graph! Or is that a paid-version feature now? Is there a way to do what I'm talking about?

    Read the article

  • What's wrong with this SQL Server query ?

    - by ClixNCash
    What's wrong this T-SQL query : Protected Sub Button1_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles Button1.Click Dim SQLData As New System.Data.SqlClient.SqlConnection("Data Source=.\SQLEXPRESS;AttachDbFilename=|DataDirectory|\Database.mdf;Integrated Security=True;User Instance=True") Dim cmdSelect As New System.Data.SqlClient.SqlCommand("SELECT COUNT(*) FROM Table1 WHERE Name ='" + TextBox1.Text + "'", SQLData) SQLData.Open() If cmdSelect.ExecuteScalar > 0 Then Label1.Text = "You have already voted this service" Return End If Dim con As New SqlConnection Dim cmd As New SqlCommand con.Open() cmd.Connection = con cmd.CommandText = "INSERT INTO Tabel1 (Name) VALUES('" & Trim(Label1.Text) & "')" cmd.ExecuteNonQuery() Label1.Text = "Thank You !" SQLData.Close() End Sub

    Read the article

  • What is the Worst Depiction of Computer Use in a Movie

    - by Robert Cartaino
    You know the type: "It's a Unix system. I know this" -- in Jurassic park where a computer-genius girl sees a computer and quickly takes over like a 3-D video game, flying through the file system to shut down the park. [video link to the scene] So what's your favorite movie gaff that shows Hollywood can be completely clueless when it comes to portraying technology?

    Read the article

  • building mono from svn - android target

    - by Jeremy Bell
    There were patches made to mono on trunk svn to support android. My understanding is that essentially instead of Koush's system which builds mono using the android NDK build system directly, these patches add support for the android NDK using the regular mono configure.sh process. I'd like to play around with this patch, but not being an expert in the mono build system, I have no idea how to tell it to target the android NDK, or even where to look. I've been able to build mono from SVN using the default target (linux) on Ubuntu, but no documentation on how to target android was given with the patches. Since anyone not submitting or reviewing a patch is generally ignored on the mono mailing list, I figured I'd post the question here.

    Read the article

  • Why do some games randomly turn my screen a random solid color?

    - by Emlena.PhD
    When playing some games my computer will randomly have an error that I cannot fix without turning it off and back on again. The screen changes to one solid color, which varies (off the top of my head I can remember seeing solid green, magenta, etc..) and the sound blares a single tone. The sound sometimes briefly restores and I can still hear the game sounds and even hear and still be heard by people in my Mumble channel, but the screen doesn't right itself so I'm still blind. What's more is this happens in some games but not in others. While the game is actually running, not while I'm still in the menu. However, it does happen if I'm afk or idle but the game world is still rendering. Games where the error occurs: League of Legends World of Warcraft Trine The Sims 2 Dungeon Defenders Safe games: games where it has never occurred: Tribes: Ascend Star Wars: the Old Republic Battlefield 3 So relatively older games cause the problem while newer games do not? I cannot predict when it will happen, it just seems random. However, if it happens and I try playing the same game further after restart it does appear to occur more frequently after the first time. But if I switch to a safe game it doesn't continue happening. Both of my RAM sticks appear fine, flipped position or either one on their own and games still run, computer still boots. I would think over-heating, but then why not all games? ALso, sometimes it happens immediately after I start playing, within seconds of the 3D world booting up. I'm looking to upgrade very soon so I want to figure out what component or software is fubar and replace/repair it. Any suggestions or recommendations of tools would be helpful. Below is some system information. Dxdiag does not detect any problems. Operating System: Windows 7 Home Premium 64-bit (6.1, Build 7601) Service Pack 1 (7601.win7sp1_gdr.120305-1505) System Manufacturer: Gigabyte Technology Co., Ltd. System Model: EP45-UD3R BIOS: Award Modular BIOS v6.00PG Processor: Intel(R) Core(TM)2 Duo CPU E8500 @ 3.16GHz (2 CPUs), ~3.2GHz Memory: 4096MB RAM DirectX Version: DirectX 11 DxDiag Version: 6.01.7601.17514 64bit Unicode Graphics card name: NVIDIA GeForce GTX 285 Driver Version: 8.17.12.9610 (error has occurred w/several driver versions) Sound: I do not have a sound card, been using motherboard's built in sound)

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 454 455 456 457 458 459 460 461 462 463 464 465  | Next Page >