Search Results

Search found 22358 results on 895 pages for 'django raw query'.

Page 459/895 | < Previous Page | 455 456 457 458 459 460 461 462 463 464 465 466  | Next Page >

  • How can I use "Dependency Injection" in simple php functions, and should I bother?

    - by Tchalvak
    I hear people talking about dependency injection and the benefit of it all the time, but I don't really understand it. I'm wondering if it's a solution to the "I pass database connections as arguments all the time" problem. I tried reading wikipedia's entry on it, but the example is written in Java so I don't solidly understand the difference it is trying to make clear. ( http://en.wikipedia.org/wiki/Dependency_injection ). I read this dependency-injection-in-php article ( http://www.potstuck.com/2009/01/08/php-dependency-injection/ ), and it seems like the objective is to not pass dependencies to an object directly, but to cordon off the creation of an object along with the creation of it's dependencies. I'm not sure how to apply that in a using php functions context, though. Additionally, is the following Dependency Injection, and should I bother trying to do dependency injection in a functional context? Version 1: (the kind of code that I create, but don't like, every day) function get_data_from_database($database_connection){ $data = $database_connection->query('blah'); return $data; } Version 2: (don't have to pass a database connection, but perhaps not dependency injection?) function get_database_connection(){ static $db_connection; if($db_connection){ return $db_connection; } else { // create db_connection ... } } function get_data_from_database(){ $conn = get_database_connection(); $data = $conn->query('blah'); return $data; } $data = get_data_from_database(); Version 3: (the creation of the "object"/data is separate, and the database code is still, so perhaps this would count as dependency injection?) function factory_of_data_set(){ static $db_connection; $data_set = null; $db_connection = get_database_connection(); $data_set = $db_connection->query('blah'); return $data_set; } $data = factory_of_data_set(); Anyone have a good resource or just insight that makes the method and benefit -crystal- clear?

    Read the article

  • SQL Server: Output an XML field as tabular data using a stored procedure

    - by Pawan
    I am using a table with an XML data field to store the audit trails of all other tables in the database. That means the same XML field has various XML information. For example my table has two records with XML data like this: 1st record: <client> <name>xyz</name> <ssn>432-54-4231</ssn> </client> 2nd record: <emp> <name>abc</name> <sal>5000</sal> </emp> These are the two sample formats and just two records. The table actually has many more XML formats in the same field and many records in each format. Now my problem is that upon query I need these XML formats to be converted into tabular result sets. What are the options for me? It would be a regular task to query this table and generate reports from it. I want to create a stored procedure to which I can pass that I need to query "<emp>" or "<client>", then my stored procedure should return tabular data.

    Read the article

  • SqlCe odd results why? -- Same SQL, different results in different apps. Issue with

    - by NitroxDM
    When I run this SQl in my mobile app I get zero rows. select * from inventory WHERE [ITEMNUM] LIKE 'PUMP%' AND [LOCATION] = 'GARAGE' When I run the same SQL in Query Analyzer 3.5 using the same database I get my expected one row. Why the difference? Here is the code I'm using in the mobile app: SqlCeCommand cmd = new SqlCeCommand(Query); cmd.Connection = new SqlCeConnection("Data Source="+filePath+";Persist Security Info=False;"); DataTable tmpTable = new DataTable(); cmd.Connection.Open(); SqlCeDataReader tmpRdr = cmd.ExecuteReader(); if (tmpRdr.Read()) tmpTable.Load(tmpRdr); tmpRdr.Close(); cmd.Connection.Close(); return tmpTable; UPDATE: For the sake of trying I used the code found in one of the answers found here and it works as expected. So my code looks like this: SqlCeConnection conn = new SqlCeConnection("Data Source=" + filePath + ";Persist Security Info=False;"); DataTable tmpTable = new DataTable(); SqlCeDataAdapter AD = new SqlCeDataAdapter(Query, conn); AD.Fill(tmpTable); The issue appears to be with the SqlCeDataReader. Hope this helps someone else out!

    Read the article

  • Why i cant save a long text on my MySQL database?

    - by DomingoSL
    im trying to save to my data base a long text (about 2500 chars) input by my users using a web form and passed to the server using php. When i look in phpmyadmin, the text gets crop. How can i config my table in order to get the complete text? This is my table config: CREATE TABLE `extra_879` ( `id` bigint(20) NOT NULL auto_increment, `id_user` bigint(20) NOT NULL, `title` varchar(300) NOT NULL, `content` varchar(3000) NOT NULL, PRIMARY KEY (`id`), UNIQUE KEY `id_user` (`id_user`) ) ENGINE=MyISAM DEFAULT CHARSET=latin1 AUTO_INCREMENT=4 ; Take a look of the field content that have a limit of 3000 chars, but the texts always gets crop at 690 chars. Thanks for any help! EDIT: I found the problem but i dont know how to solve it. The query is getting crop always in the same char, an special char: ù EDIT 2: This is the cropped query: INSERT INTO extra_879 (id,id_user,title,content) VALUES (NULL,'1','Informazione Extra',' Riconoscimenti Laurea di ingegneria presa a le 22 anni e in il terso posto della promozione Diploma analista di sistemi ottenuto il rating massimo 20/20, primo posto della promozione. Borsa di Studio (offerta dal Ministero Esteri Italiano) vinta nel 2010 (Valutazione del territorio attraverso le nueve tecnologie) Pubblicazione di paper; Stima del RCS della nave CCGS radar sulla base dei risultati di H. Leong e H. Wilson. http://www.ing.uc.edu.vek-azozayalarchivospdf/PAPER-Sarmiento.pdf Tesi di laurea: PROGETTAZIONE E REALIZZAZIONE DI UN SIS-TEMA DI TELEMETRIA GSM PER IL CONTROLLO DELLO STATO DI TRANSITO VEICOLARE E CLIMA (ottenuto il punteggio pi') It gets crop just when the (ottenuto il punteggio più alto) phrase, just when ù appear... EDIT 3: I using jquery + ajax to send the query $.ajax({type: "POST", url: "handler.php", data: "e_text="+ $('#e_text').val() + "&e_title="+ $('#extra_title').val(),

    Read the article

  • Multhreading in Java

    - by Vijay Selvaraj
    I'm working with core java and IBM Websphere MQ 6.0. We have a standalone module say DBcomponent that hits the database and fetches a resultset based on the runtime query. The query is passed to the application via MQ messaging medium. We have a trigger configured for the queue which invokes the DBComponent whenever a message is available in the queue. The DBComponent consumes the message, constructs the query and returns the resultset to another queue. In this overall process we use log4j to log statements on a log file for auditing. The connection is pooled to the database using Apache pool. I am trying to check whether the log messages are logged correctly using a sample program. The program places the input message to the queue and checks for the logs in the log file. Its expected for the trigger method invocation to complete before i try to check for the message in log file, but every time my program to check for log message gets executed first leading my check to failure. Even if i introduce a Thread.sleep(time) doesn't solves the case. How can i make it to keep my method execution waiting until the trigger operation completes? Any suggestion will be helpful.

    Read the article

  • sending email with codeigniter

    - by Maru
    I have this MODEL and I get the email which I want to send class Cliente_Model extends CI_Model{ public function getInfo($id){ $this->db->select('*'); $this->db->from('pendientes'); $query = $this->db->get(); if($query->num_rows() > 0) { foreach ($query->result_array() as $row) { return $row['email']; } } else { return FALSE; } } } CONTROLLER $this->load->model('cliente_model', 'client'); $clientInfo = $this->client->getInfo($id); $this->email->from('[email protected]', 'Demo'); $this->email->to($clientInfo); $this->email->subject('Email Test'); $this->email->message('your user is '.$clientInfo.' and your password is '.$clave); $this->email->send(); and I need some help here, I can get the email and it can send it perfectly but in the message I need to send the password also and I don't know how I can get it from the model. thanks in advance!

    Read the article

  • Dependency injection and factory

    - by legenden
    Trying to figure out how to best handle the following scenario: Assume a RequestContext class which has a dependency to an external service, such as: public class RequestContext : IRequestContext { private readonly ServiceFactory<IWeatherService> _weatherService; public RequestContext(ServiceFactory<IWeatherService> weatherService, UserLocation location, string query) { _weatherService = weatherService; ... What sort of dependency should I require in the class that will ultimately instantiate RequestContext? It could be ServiceFactory<IWeatherService>, but that doesn't seem right, or I could create an IRequestContextFactory for it along the lines of: public class RequestContextFactory : IRequestContextFactory { private readonly ServiceFactory<IWeatherService> _weatherService; public RequestContextFactory(ServiceFactory<IWeatherService> weatherService) { _weatherService = weatherService; } public RequestContext Create(UserLocation location, string query) { return new RequestContext(_weatherService, location, query); } } And then pass the IRequestContextFactory through constructor injection. This seems like a good way to do it, but the problem with this approach is that I think it hinders discoverability (devs must know about the factory and implement it, which is not really apparent). Is there a better/more discoverable way that I'm missing?

    Read the article

  • Need some help to determine the amount of recursive calls in PHP

    - by Ben Fransen
    Hi all, I've got a, I think fairly easy question, but this is bugging me for a while now. So I figured, maybe I can get some help here. Since recursive functions are always a bit tricky, and sometimes a bit unclear to me, I keep struggling to create a nice working solution to get my menudata. In one of my classes I have this function, which gives me all menu-items recursivly. The thing I want is to determine at which recursionlevel a certain object was retrieved so I can create a nicely looking HTML output with indents for the levels of nesting. public function GetObjectList($parentID = 0, $objectlist = null) { if(is_null($objectlist)) { $objectlist = new ObjectList("Model_Navigation"); } $query = MySQL::Query("SELECT * FROM `Navigation` WHERE `WebsiteID` = ".SITE_ID. " AND `LanguageID` = ".LANG_ID." AND `ParentID` = ".$parentID); while($result = MySQL::FetchAssoc($query)) { $object = new Model_Navigation(); $object->ID = $result["ID"]; $object->WebsiteID = $result["WebsiteID"]; $object->LanguageID = $result["LanguageID"]; $object->ParentID = $result["ParentID"]; $object->Name = $result["Name"]; $object->Page = Model_Page::GetObjectByID($result["PageID"]); $object->ExternalURL = $result["ExternalURL"]; $object->Index = $result["Index"]; $object->Level = [here lies my problem]; $objectlist->Add($object); self::GetObjectList($object->ID, $objectlist); } return $objectlist; } Hope to hear from you! Greetings from Holland, Ben Fransen

    Read the article

  • transactions and delete using fluent nhibernate

    - by Will I Am
    I am starting to play with (Fluent) nHibernate and I am wondering if someone can help with the following. I'm sure it's a total noob question. I want to do: delete from TABX where name = 'abc' where table TABX is defined as: ID int name varchar(32) ... I build the code based on internet samples: using (ITransaction transaction = session.BeginTransaction()) { IQuery query = session.CreateQuery("FROM TABX WHERE name = :uid") .SetString("uid", "abc"); session.Delete(query.List<Person>()[0]); transaction.Commit(); } but alas, it's generating two queries (one select and one delete). I want to do this in a single statement, as in my original SQL. What is the correct way of doing this? Also, I noticed that in most samples on the internet, people tend to always wrap all queries in transactions. Why is that? If I'm only running a single statement, that seems an overkill. Do people tend to just mindlessly cut and paste, or is there a reason beyond that? For example, in my query above, if I do manage it to get it from two queries down to one, i should be able to remove the begin/commit transaction, no? if it matters, I'm using PostgreSQL for experimenting.

    Read the article

  • My pivot chart has the wrong Y axis values but correct data point values

    - by Mark Harnett
    I created a pivot chart based on some raw data for the x axis (dates) and 4 calculated fields for the Y values. The values on resulting lines are correct (see the data label at the end of the line) but the Y axis is off by about 100, but not off by any consistent amount. I have played with auto axis on and off, turn log scale on and off. All to no avail. Does anybody have any thoughts? Image link

    Read the article

  • Problems connecting Clariion LUNS to Solaris 10

    - by vialde
    I've got a Clariion San and a Solaris 10 server with an emulex HBA. The Thin LUNS are visible in Solaris and I can happily format the raw devices. Unfortunately that's all I can do. All other operations result in I/O errors. I'm running current versions of PowerPath and Solaris is patched as high as it'll go. Anyone have any similar experiences?

    Read the article

  • How to perform Linq select new with datetime in SQL 2008

    - by kd7iwp
    In our C# code I recently changed a line from inside a linq-to-sql select new query as follows: OrderDate = (p.OrderDate.HasValue ? p.OrderDate.Value.Year.ToString() + "-" + p.OrderDate.Value.Month.ToString() + "-" + p.OrderDate.Value.Day.ToString() : "") To: OrderDate = (p.OrderDate.HasValue ? p.OrderDate.Value.ToString("yyyy-mm-dd") : "") The change makes the line smaller and cleaner. It also works fine with our SQL 2008 database in our development environment. However, when the code deployed to our production environment which uses SQL 2005 I received an exception stating: Nullable Type must have a value. For further analysis I copied (p.OrderDate.HasValue ? p.OrderDate.Value.ToString("yyyy-mm-dd") : "") into a string (outside of a Linq statement) and had no problems at all, so it only causes an in issue inside my Linq. Is this problem just something to do with SQL 2005 using different date formats than from SQL 2008? Here's more of the Linq: dt = FilteredOrders.Where(x => x != null).Select(p => new { Order = p.OrderId, link = "/order/" + p.OrderId.ToString(), StudentId = (p.PersonId.HasValue ? p.PersonId.Value : 0), FirstName = p.IdentifierAccount.Person.FirstName, LastName = p.IdentifierAccount.Person.LastName, DeliverBy = p.DeliverBy, OrderDate = p.OrderDate.HasValue ? p.OrderDate.Value.Date.ToString("yyyy-mm-dd") : ""}).ToDataTable(); This is selecting from a List of Order objects. The FilteredOrders list is from another linq-to-sql query and I call .AsEnumerable on it before giving it to this particular select new query. Doing this in regular code works fine: if (o.OrderDate.HasValue) tempString += " " + o.OrderDate.Value.Date.ToString("yyyy-mm-dd");

    Read the article

  • exim4, avoid emails end up in spam folder

    - by MultiformeIngegno
    I have a VPS: I set up exim, problem is emails always go in the spam folder.. this is a sample header: http://pastebin.com/raw.php?i=4NJ2ZaUs As you can see it PASSes SPF test but still emails don't pass spam filters (I tried with Gmail).. Here's my exim config: dc_eximconfig_configtype='internet' dc_other_hostnames='MY_DOMAIN' dc_local_interfaces='' dc_readhost='MY_DOMAIN' dc_relay_domains='MY_DOMAIN' dc_minimaldns='false' dc_relay_nets='' dc_smarthost='MY_DOMAIN' CFILEMODE='644' dc_use_split_config='false' dc_hide_mailname='' dc_mailname_in_oh='true' dc_localdelivery='mail_spool' Why does this happen?

    Read the article

  • C++ boost.asio server and client connection undersanding

    - by Edgar Buchvalov
    i started learning boost.asio and i have some problems with undersanding tcp connections. There is example from official boost site: #include <ctime> #include <iostream> #include <string> #include <boost/asio.hpp> using boost::asio::ip::tcp; std::string make_daytime_string() { using namespace std; // For time_t, time and ctime; time_t now = time(0); return ctime(&now); } int main() { try { boost::asio::io_service io_service; tcp::acceptor acceptor(io_service, tcp::endpoint(tcp::v4(), 13)); for (;;) { tcp::socket socket(io_service); acceptor.accept(socket); std::string message = make_daytime_string(); boost::system::error_code ignored_error; boost::asio::write(socket, boost::asio::buffer(message), boost::asio::transfer_all(), ignored_error); } } catch (std::exception& e) { std::cerr << e.what() << std::endl; } return 0; } there is question, why if i want to connet to this server via client i have t write: boost::asio::io_service io_service; tcp::resolver resolver(io_service); tcp::resolver::query query(host_ip, "daytime"); //why daytime? tcp::resolver::iterator endpoint_iterator = resolver.resolve(query); tcp::resolver::iterator end; why daytime?, what it meant and where it is inicialized in server, or i just doesn't missed somefing? there is full client code : www.boost.org/doc/libs/1_39_0/doc/html/boost_asio/tutorial/tutdaytime1.html thanks for explanation in advance

    Read the article

  • how to disable these logs on the screen?

    - by user62367
    using Fedora 14: http://pastebin.com/raw.php?i=jUvcfugw i mount an anonym Samba share [checks it in every 5 sec] it's working, ok, great! But: when i shut down my Fedora box, i can see the lines containing this scripts lines! Many times, about ~50x on the screen. How could i disable these lines when shutting down? I [and other people] don't want to see those lines for about ~ 5 sec Thank you!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • NHibernate stored procedure problem

    - by Calvin
    I'm having a hard time trying to get my stored procedure works with NHibernate. The data returned from the SP does not correspond to any database table. This is my mapping file: <?xml version="1.0" encoding="utf-8" ?> <hibernate-mapping xmlns="urn:nhibernate-mapping-2.2" assembly="DomainModel" namespace="DomainModel.Entities"> <sql-query name="DoSomething"> <return class="SomeClass"> <return-property name="ID" column="ID"/> </return> exec [dbo].[sp_doSomething] </sql-query> </hibernate-mapping> Here is my domain class: namespace DomainModel.Entities { public class SomeClass { public SomeClass() { } public virtual Guid ID { get; set; } } } When I run the code, it fails with Exception Details: NHibernate.HibernateException: Errors in named queries: {DoSomething} at line 80 Line 78: config.Configure(Path.Combine(AppDomain.CurrentDomain.BaseDirectory, "NHibernate.config")); Line 79: Line 80: g_sessionFactory = config.BuildSessionFactory(); When I debug into NHibernate code, it seems that SomeClass is not added to the persister dictionary because there isn't a class mapping (only sql-query) defined in hbm.xml. And later on in CheckNamedQueries function, it is not able to find the persistor for SomeClass. I've checked all the obvious things (e.g. make hbm as an embedded resource) and my code isn't too much different from other samples I found on the web, but somehow I just can't get it working. Any idea how I can resolve this issue?

    Read the article

  • ZIP Numerous Blob Files

    - by Michael
    I have a database table that contains numerous PDF blob files. I am attempting to combine all of the files into a single ZIP file that I can download and then print. Please help! <?php include 'config.php'; include 'connect.php'; $session= $_GET[session]; $query = " SELECT $tbl_uploads.username, $tbl_uploads.description, $tbl_uploads.type, $tbl_uploads.size, $tbl_uploads.content, $tbl_members.session FROM $tbl_uploads LEFT JOIN $tbl_members ON $tbl_uploads.username = $tbl_members.username WHERE $tbl_members.session= '$session'"; $result = mysql_query($query) or die('Error, query failed'); while(list($username, $description, $type, $size, $content) = mysql_fetch_array($result)) { header("Content-length: $size"); header("Content-type: $type"); header("Content-Disposition: inline; filename=$username-$description.pdf"); echo $content; } $files = array('File 1 from database', 'File 2 from database'); $zip = new ZipArchive; $zip->open('file.zip', ZipArchive::CREATE); foreach ($files as $file) { $zip->addFile($file); } $zip->close(); header('Content-Type: application/zip'); header('Content-disposition: attachment; filename=filename.zip'); header('Content-Length: ' . filesize($zipfilename)); readfile($zipname); mysql_close($link); exit; ?>

    Read the article

  • How do I view the full content of a text or varchar(MAX) column in SQL Server 2008 Management Studio

    - by adamjford
    In this live SQL Server 2008 (build 10.0.1600) database, there's an Events table, which contains a text column named Details. (Yes, I realize this should actually be a varchar(MAX) column, but whoever set this database up did not do it that way.) This column contains very large logs of exceptions and associated JSON data that I'm trying to access through SQL Server Management Studio, but whenever I copy the results from the grid to a text editor, it truncates it at 43679 characters. I've read on various locations on the Internet that you can set your Maximum Characters Retrieved for XML Data in Tools > Options > Query Results > SQL Server > Results To Grid to Unlimited, and then perform a query such as this: select Convert(xml, Details) from Events where EventID = 13920 (Note that the data is column is not XML at all. CONVERTing the column to XML is merely a workaround I found from Googling that someone else has used to get around the limit SSMS has from retrieving data from a text or varchar(MAX) column.) However, after setting the option above, running the query, and clicking on the link in the result, I still get the following error: Unable to show XML. The following error happened: Unexpected end of file has occurred. Line 5, position 220160. One solution is to increase the number of characters retrieved from the server for XML data. To change this setting, on the Tools menu, click Options. So, any idea on how to access this data? Would converting the column to varchar(MAX) fix my woes?

    Read the article

  • SQL Server search filter and order by performance issues

    - by John Leidegren
    We have a table value function that returns a list of people you may access, and we have a relation between a search and a person called search result. What we want to do is that wan't to select all people from the search and present them. The query looks like this SELECT qm.PersonID, p.FullName FROM QueryMembership qm INNER JOIN dbo.GetPersonAccess(1) ON GetPersonAccess.PersonID = qm.PersonID INNER JOIN Person p ON p.PersonID = qm.PersonID WHERE qm.QueryID = 1234 There are only 25 rows with QueryID=1234 but there are almost 5 million rows total in the QueryMembership table. The person table has about 40K people in it. QueryID is not a PK, but it is an index. The query plan tells me 97% of the total cost is spent doing "Key Lookup" witht the seek predicate. QueryMembershipID = Scalar Operator (QueryMembership.QueryMembershipID as QM.QueryMembershipID) Why is the PK in there when it's not used in the query at all? and why is it taking so long time? The number of people total 25, with the index, this should be a table scan for all the QueryMembership rows that have QueryID=1234 and then a JOIN on the 25 people that exists in the table value function. Which btw only have to be evaluated once and completes in less than 1 second.

    Read the article

  • HATEOAS - Discovery and URI Templating

    - by Paul Kirby
    I'm designing a HATEOAS API for internal data at my company, but have been having troubles with the discovery of links. Consider the following set of steps for someone to retrieve information about a specific employee in this system: User sends GET to http://coredata/ to get all available resources, returns a number of links including one tagged as rel = "http://coredata/rels/employees" User follows HREF on the rel from the first request, performing a GET at (for example) http://coredata/employees The data returned from this last call is my conundrum and a situation where I've heard mixed suggestions. Here are some of them: That GET will return all employees (with perhaps truncated data), and the client would be responsible for picking the one it wants from that list. That GET would return a number of URI templated links describing how to query / get one employee / get all employees. Something like: "_links": { "http://coredata/rels/employees#RetrieveOne": { "href": "http://coredata/employees/{id}" }, "http://coredata/rels/employees#Query": { "href": "http://coredata/employees{?login,firstName,lastName}" }, "http://coredata/rels/employees#All": { "href": "http://coredata/employees/all" } } I'm a little stuck here with what remains closest to HATEOAS. For option 1, I really do not want to make my clients retrieve all employees every time for the sake of navigation, but I can see how using URI templating in example two introduces some out-of-band knowledge. My other thought was to use the RetrieveOne, Query, and All operations as my cool URLs, but that seems to violate the concept that you should be able to navigate to the resources you want from one base URI. Has anyone else managed to come up with a good way to handle this? Navigation is dead simple once you've retrieved one resource or a set of resources, but it seems very difficult to use for discovery.

    Read the article

  • dig works but dig +trace <domain_name> not working

    - by anoopmathew
    In my local system i can't get the proper result of dig +trace , but dig works fine. I'm using Ubuntu 10.04 LTS version. I'll attach the result of dig and dig +trace along with this updates. dig +trace gmail.com ; << DiG 9.7.0-P1 << +trace gmail.com ;; global options: +cmd ;; Received 12 bytes from 4.2.2.4#53(4.2.2.4) in 291 ms dig gmail.com ; << DiG 9.7.0-P1 << gmail.com ;; global options: +cmd ;; Got answer: ;; -HEADER<<- opcode: QUERY, status: NOERROR, id: 59528 ;; flags: qr rd ra; QUERY: 1, ANSWER: 2, AUTHORITY: 0, ADDITIONAL: 0 ;; QUESTION SECTION: ;gmail.com. IN A ;; ANSWER SECTION: gmail.com. 49 IN A 74.125.236.118 gmail.com. 49 IN A 74.125.236.117 ;; Query time: 302 msec ;; SERVER: 4.2.2.4#53(4.2.2.4) ;; WHEN: Sat Oct 13 14:57:56 2012 ;; MSG SIZE rcvd: 59 Please anyone update a solution for this issue. I'm just worried about my issue.

    Read the article

  • Checking inherited attributes in an 'ancestry' based SQL table

    - by Brendon Muir
    I'm using the ancestry gem to help organise my app's tree structure in the database. It basically writes a childs ancestor information to a special column called 'ancestry'. The ancestry column for a particular child might look like '1/34/87' where the parent of this child is 87, and then 87's parent is 34 and 34's is 1. It seems possible that we could select rows from this table each with a subquery that checks all the ancestors to see if a certain attribute it set. E.g. in my app you can hide an item and its children just by setting the parent element's visibility column to 0. I want to be able to find all the items where none of their ancestors are hidden. I tried converting the slashes to comma's with the REPLACE command but IN required a set of comma separated integers rather than one string with comma separated string numbers. It's funny, because I can do this query in two steps, e.g. retrieve the row, then take its ancestry column, split out the id's and make another query that checks that the id is IN that set of id's and that visibility isn't ever 0 and whala! But joining these into one query seems to be quite a task. Much searching has shown a few answers but none really do what I want. SELECT * FROM t1 WHERE id = 99; 99's ancestry column reads '1/34/87' SELECT * FROM t1 WHERE visibility = 0 AND id IN (1,34,87); kind of backwards, but if this returns no rows then the item is visible. Has anyone come across this before and come up with a solution. I don't really want to go the stored procedure route. It's for a rails app.

    Read the article

  • How to use SQLErrorCodeSQLExceptionTranslator and DAO class with @Repository in Spring?

    - by GuidoMB
    I'm using Spring 3.0.2 and I have a class called MovieDAO that uses JDBC to handle the db. I have set the @Repository annotations and I want to convert the SQLException to the Spring's DataAccessException I have the following example: @Repository public class JDBCCommentDAO implements CommentDAO { static JDBCCommentDAO instance; ConnectionManager connectionManager; private JDBCCommentDAO() { connectionManager = new ConnectionManager("org.postgresql.Driver", "postgres", "postgres"); } static public synchronized JDBCCommentDAO getInstance() { if (instance == null) instance = new JDBCCommentDAO(); return instance; } @Override public Collection<Comment> getComments(User user) throws DAOException { Collection<Comment> comments = new ArrayList<Comment>(); try { String query = "SELECT * FROM Comments WHERE Comments.userId = ?"; Connection conn = connectionManager.getConnection(); PreparedStatement stmt = conn.prepareStatement(query); stmt = conn.prepareStatement(query); stmt.setInt(1, user.getId()); ResultSet result = stmt.executeQuery(); while (result.next()) { Movie movie = JDBCMovieDAO.getInstance().getLightMovie(result.getInt("movie")); comments.add(new Comment(result.getString("text"), result.getInt("score"), user, result.getDate("date"), movie)); } connectionManager.closeConnection(conn); } catch (SQLException e) { e.printStackTrace(); //CONVERT TO DATAACCESSEXCEPTION } return comments; } } I Don't know how to get the Translator and I don't want to extends any Spring class, because that is why I'm using the @Repository annotation

    Read the article

  • copy rows before updating them to preserve archive in Postgres

    - by punkish
    I am experimenting with creating a table that keeps a version of every row. The idea is to be able to query for how the rows were at any point in time even if the query has JOINs. Consider a system where the primary resource is books, that is, books are queried for, and author info comes along for the ride CREATE TABLE authors ( author_id INTEGER NOT NULL, version INTEGER NOT NULL CHECK (version > 0), author_name TEXT, is_active BOOLEAN DEFAULT '1', modified_on TIMESTAMP DEFAULT CURRENT_TIMESTAMP, PRIMARY KEY (author_id, version) ) INSERT INTO authors (author_id, version, author_name) VALUES (1, 1, 'John'), (2, 1, 'Jack'), (3, 1, 'Ernest'); I would like to be able to update the above like so UPDATE authors SET author_name = 'Jack K' WHERE author_id = 1; and end up with 2, 1, Jack, t, 2012-03-29 21:35:00 2, 2, Jack K, t, 2012-03-29 21:37:40 which I can then query with SELECT author_name, modified_on FROM authors WHERE author_id = 2 AND modified_on < '2012-03-29 21:37:00' ORDER BY version DESC LIMIT 1; to get 2, 1, Jack, t, 2012-03-29 21:35:00 Something like the following doesn't really work CREATE OR REPLACE FUNCTION archive_authors() RETURNS TRIGGER AS $archive_author$ BEGIN IF (TG_OP = 'UPDATE') THEN -- The following fails because author_id,version PK already exists INSERT INTO authors (author_id, version, author_name) VALUES (OLD.author_id, OLD.version, OLD.author_name); UPDATE authors SET version = OLD.version + 1 WHERE author_id = OLD.author_id AND version = OLD.version; RETURN NEW; END IF; RETURN NULL; -- result is ignored since this is an AFTER trigger END; $archive_author$ LANGUAGE plpgsql; CREATE TRIGGER archive_author AFTER UPDATE OR DELETE ON authors FOR EACH ROW EXECUTE PROCEDURE archive_authors(); How can I achieve the above? Or, is there a better way to accomplish this? Ideally, I would prefer to not create a shadow table to store the archived rows.

    Read the article

< Previous Page | 455 456 457 458 459 460 461 462 463 464 465 466  | Next Page >