Search Results

Search found 22358 results on 895 pages for 'django raw query'.

Page 459/895 | < Previous Page | 455 456 457 458 459 460 461 462 463 464 465 466  | Next Page >

  • Are Parameters really enough to prevent Sql injections?

    - by Rune Grimstad
    I've been preaching both to my colleagues and here on SO about the goodness of using parameters in SQL queries, especially in .NET applications. I've even gone so far as to promise them as giving immunity against SQL injection attacks. But I'm starting to wonder if this really is true. Are there any known SQL injection attacks that will be successfull against a parameterized query? Can you for example send a string that causes a buffer overflow on the server? There are of course other considerations to make to ensure that a web application is safe (like sanitizing user input and all that stuff) but now I am thinking of SQL injections. I'm especially interested in attacks against MsSQL 2005 and 2008 since they are my primary databases, but all databases are interesting. Edit: To clarify what I mean by parameters and parameterized queries. By using parameters I mean using "variables" instead of building the sql query in a string. So instead of doing this: SELECT * FROM Table WHERE Name = 'a name' We do this: SELECT * FROM Table WHERE Name = @Name and then set the value of the @Name parameter on the query / command object.

    Read the article

  • Multhreading in Java

    - by Vijay Selvaraj
    I'm working with core java and IBM Websphere MQ 6.0. We have a standalone module say DBcomponent that hits the database and fetches a resultset based on the runtime query. The query is passed to the application via MQ messaging medium. We have a trigger configured for the queue which invokes the DBComponent whenever a message is available in the queue. The DBComponent consumes the message, constructs the query and returns the resultset to another queue. In this overall process we use log4j to log statements on a log file for auditing. The connection is pooled to the database using Apache pool. I am trying to check whether the log messages are logged correctly using a sample program. The program places the input message to the queue and checks for the logs in the log file. Its expected for the trigger method invocation to complete before i try to check for the message in log file, but every time my program to check for log message gets executed first leading my check to failure. Even if i introduce a Thread.sleep(time) doesn't solves the case. How can i make it to keep my method execution waiting until the trigger operation completes? Any suggestion will be helpful.

    Read the article

  • Dependency injection and factory

    - by legenden
    Trying to figure out how to best handle the following scenario: Assume a RequestContext class which has a dependency to an external service, such as: public class RequestContext : IRequestContext { private readonly ServiceFactory<IWeatherService> _weatherService; public RequestContext(ServiceFactory<IWeatherService> weatherService, UserLocation location, string query) { _weatherService = weatherService; ... What sort of dependency should I require in the class that will ultimately instantiate RequestContext? It could be ServiceFactory<IWeatherService>, but that doesn't seem right, or I could create an IRequestContextFactory for it along the lines of: public class RequestContextFactory : IRequestContextFactory { private readonly ServiceFactory<IWeatherService> _weatherService; public RequestContextFactory(ServiceFactory<IWeatherService> weatherService) { _weatherService = weatherService; } public RequestContext Create(UserLocation location, string query) { return new RequestContext(_weatherService, location, query); } } And then pass the IRequestContextFactory through constructor injection. This seems like a good way to do it, but the problem with this approach is that I think it hinders discoverability (devs must know about the factory and implement it, which is not really apparent). Is there a better/more discoverable way that I'm missing?

    Read the article

  • My pivot chart has the wrong Y axis values but correct data point values

    - by Mark Harnett
    I created a pivot chart based on some raw data for the x axis (dates) and 4 calculated fields for the Y values. The values on resulting lines are correct (see the data label at the end of the line) but the Y axis is off by about 100, but not off by any consistent amount. I have played with auto axis on and off, turn log scale on and off. All to no avail. Does anybody have any thoughts? Image link

    Read the article

  • MySqlDataReader giving error at build

    - by TuxMeister
    Hey there. I have a function in VB.net that authenticates a user towards a MySQL DB before launching the main application. Here's the code of the function: Public Function authConnect() As Boolean Dim dbserver As String Dim dbuser As String Dim dbpass As String dbserver = My.Settings.dbserver.ToString dbuser = My.Settings.dbuser.ToString dbpass = My.Settings.dbpass.ToString conn = New MySqlConnection myConnString = "server=" & dbserver & ";" & "user id=" & dbuser & ";" & "password=" & dbpass & ";" & "database=rtadmin" Dim myCommand As New MySqlCommand Dim myAdapter As New MySqlDataAdapter Dim myData As New DataTable Dim myDataReader As New MySqlDataReader Dim query As String myCommand.Parameters.Add(New MySqlParameter("?Username", login_usr_txt.Text)) myCommand.Parameters.Add(New MySqlParameter("?Password", login_pass_txt.Text)) query = "select * from users where user = ?Username and passwd = ?Password" conn.ConnectionString = myConnString Try conn.Open() Try myCommand.Connection = conn myCommand.CommandText = query myAdapter.SelectCommand = myCommand myDataReader = myCommand.ExecuteReader If myDataReader.HasRows() Then MessageBox.Show("You've been logged in.", "RT Live! Information", MessageBoxButtons.OK, MessageBoxIcon.Information) End If Catch ex As Exception End Try Catch ex As Exception End Try End Function The function is not yet complete, there are a few other things that need to be done before launching the application, since I'm using a MessageBox to display the result of the login attempt. The error that I'm getting is the following: Error 1 'MySql.Data.MySqlClient.MySqlDataReader.Friend Sub New(cmd As MySql.Data.MySqlClient.MySqlCommand, statement As MySql.Data.MySqlClient.PreparableStatement, behavior As System.Data.CommandBehavior)' is not accessible in this context because it is 'Friend'. C:\Users\Mario\documents\visual studio 2010\Projects\Remote Techs Live!\Remote Techs Live!\Login.vb 43 13 Remote Techs Live! Any ideas? Thanks.

    Read the article

  • C++ boost.asio server and client connection undersanding

    - by Edgar Buchvalov
    i started learning boost.asio and i have some problems with undersanding tcp connections. There is example from official boost site: #include <ctime> #include <iostream> #include <string> #include <boost/asio.hpp> using boost::asio::ip::tcp; std::string make_daytime_string() { using namespace std; // For time_t, time and ctime; time_t now = time(0); return ctime(&now); } int main() { try { boost::asio::io_service io_service; tcp::acceptor acceptor(io_service, tcp::endpoint(tcp::v4(), 13)); for (;;) { tcp::socket socket(io_service); acceptor.accept(socket); std::string message = make_daytime_string(); boost::system::error_code ignored_error; boost::asio::write(socket, boost::asio::buffer(message), boost::asio::transfer_all(), ignored_error); } } catch (std::exception& e) { std::cerr << e.what() << std::endl; } return 0; } there is question, why if i want to connet to this server via client i have t write: boost::asio::io_service io_service; tcp::resolver resolver(io_service); tcp::resolver::query query(host_ip, "daytime"); //why daytime? tcp::resolver::iterator endpoint_iterator = resolver.resolve(query); tcp::resolver::iterator end; why daytime?, what it meant and where it is inicialized in server, or i just doesn't missed somefing? there is full client code : www.boost.org/doc/libs/1_39_0/doc/html/boost_asio/tutorial/tutdaytime1.html thanks for explanation in advance

    Read the article

  • Stop duplicate icmp echo replies when bridging to a dummy interface?

    - by mbrownnyc
    I recently configured a bridge br0 with members as eth0 (real if) and dummy0 (dummy.ko if). When I ping this machine, I receive duplicate replies as: # ping SERVERA PING SERVERA.domain.local (192.168.100.115) 56(84) bytes of data. 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=1 ttl=62 time=113 ms 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=1 ttl=62 time=114 ms (DUP!) 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=2 ttl=62 time=113 ms 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=2 ttl=62 time=113 ms (DUP!) Using tcpdump on SERVERA, I was able to see icmp echo replies being sent from eth0 and br0 itself as follows (oddly two echo request packets arrive "from" my Windows box myhost): 23:19:05.324192 IP myhost.domain.local > SERVERA.domain.local: ICMP echo request, id 512, seq 43781, length 40 23:19:05.324212 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 23:19:05.324217 IP myhost.domain.local > SERVERA.domain.local: ICMP echo request, id 512, seq 43781, length 40 23:19:05.324221 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 23:19:05.324264 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 23:19:05.324272 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 It's worth noting, testing reveals that hosts on the same physical switch do not see DUP icmp echo responses (a host on the same VLAN on another switch does see a dup icmp echo response). I've read that this could be due to the ARP table of a switch, but I can't find any info directly related to bridges, just bonds. I have a feeling my problem lay in the stack on linux, not the switch, but am opened to any suggestions. The system is running centos6/el6 kernel 2.6.32-71.29.1.el6.i686. How do I stop ICMP echo replies from being sent in duplicate when dealing with a bridge interface/bridged interfaces? Thanks, Matt [edit] Quick note: It was recommended in #linux to: [08:53] == mbrownnyc [gateway/web/freenode/] has joined ##linux [08:57] <lkeijser> mbrownnyc: what happens if you set arp_ignore to 1 for the dummy interface? [08:59] <lkeijser> also set arp_announce to 2 for that interface [09:24] <mbrownnyc> lkeijser: I set arp_annouce to 2, arp_ignore to 2 in /etc/sysctl.conf and rebooted the machine... verifying that the bits are set after boot... the problem is still present I did this and came up empty. Same dup problem. I will be moving away from including the dummy interface in the bridge as: [09:31] == mbrownnyc [gateway/web/freenode/] has joined #Netfilter [09:31] <mbrownnyc> Hello all... I'm wondering, is it correct that even with an interface in PROMISC that the kernel will drop /some/ packets before they reach applications? [09:31] <whaffle> What would you make think so? [09:32] <mbrownnyc> I ask because I am receiving ICMP echo replies after configuring a bridge with a dummy interface in order for ipt_netflow to see all packets, only as reported in it's documentation: http://ipt-netflow.git.sourceforge.net/git/gitweb.cgi?p=ipt-netflow/ipt-netflow;a=blob;f=README.promisc [09:32] <mbrownnyc> but I do not know if PROMISC will do the same job [09:33] <mbrownnyc> I was referred here from #linux. any assistance is appreciated [09:33] <whaffle> The following conditions need to be met: PROMISC is enabled (bridges and applications like tcpdump will do this automatically, otherwise they won't function). [09:34] <whaffle> If an interface is part of a bridge, then all packets that enter the bridge should already be visible in the raw table. [09:35] <mbrownnyc> thanks whaffle PROMISC must be set manually for ipt_netflow to function, but [09:36] <whaffle> promisc does not need to be set manually, because the bridge will do it for you. [09:36] <whaffle> When you do not have a bridge, you can easily create one, thereby rendering any kernel patches moot. [09:36] <mbrownnyc> whaffle: I speak without the bridge [09:36] <whaffle> It is perfectly valid to have a "half-bridge" with only a single interface in it. [09:36] <mbrownnyc> whaffle: I am unfamiliar with the raw table, does this mean that PROMISC allows the raw table to be populated with packets the same as if the interface was part of a bridge? [09:37] <whaffle> Promisc mode will cause packets with {a dst MAC address that does not equal the interface's MAC address} to be delivered from the NIC into the kernel nevertheless. [09:37] <mbrownnyc> whaffle: I suppose I mean to clearly ask: what benefit would creating a bridge have over setting an interface PROMISC? [09:38] <mbrownnyc> whaffle: from your last answer I feel that the answer to my question is "none," is this correct? [09:39] <whaffle> Furthermore, the linux kernel itself has a check for {packets with a non-local MAC address}, so that packets that will not enter a bridge will be discarded as well, even in the face of PROMISC. [09:46] <mbrownnyc> whaffle: so, this last bit of information is quite clearly why I would need and want a bridge in my situation [09:46] <mbrownnyc> okay, the ICMP echo reply duplicate issue is likely out of the realm of this channel, but I sincerely appreciate the info on the kernels inner-workings [09:52] <whaffle> mbrownnyc: either the kernel patch, or a bridge with an interface. Since the latter is quicker, yes [09:54] <mbrownnyc> thanks whaffle [edit2] After removing the bridge, and removing the dummy kernel module, I only had a single interface chilling out, lonely. I still received duplicate icmp echo replies... in fact I received a random amount: http://pastebin.com/2LNs0GM8 The same thing doesn't happen on a few other hosts on the same switch, so it has to do with the linux box itself. I'll likely end up rebuilding it next week. Then... you know... this same thing will occur again. [edit3] Guess what? I rebuilt the box, and I'm still receiving duplicate ICMP echo replies. Must be the network infrastructure, although the ARP tables do not contain multiple entries. [edit4] How ridiculous. The machine was a network probe, so I was (ingress and egress) mirroring an uplink port to a node that was the NIC. So, the flow (must have) gone like this: ICMP echo request comes in through the mirrored uplink port. (the real) ICMP echo request is received by the NIC (the mirrored) ICMP echo request is received by the NIC ICMP echo reply is sent for both. I'm ashamed of myself, but now I know. It was suggested on #networking to either isolate the mirrored traffic to an interface that does not have IP enabled, or tag the mirrored packets with dot1q.

    Read the article

  • Need some help to determine the amount of recursive calls in PHP

    - by Ben Fransen
    Hi all, I've got a, I think fairly easy question, but this is bugging me for a while now. So I figured, maybe I can get some help here. Since recursive functions are always a bit tricky, and sometimes a bit unclear to me, I keep struggling to create a nice working solution to get my menudata. In one of my classes I have this function, which gives me all menu-items recursivly. The thing I want is to determine at which recursionlevel a certain object was retrieved so I can create a nicely looking HTML output with indents for the levels of nesting. public function GetObjectList($parentID = 0, $objectlist = null) { if(is_null($objectlist)) { $objectlist = new ObjectList("Model_Navigation"); } $query = MySQL::Query("SELECT * FROM `Navigation` WHERE `WebsiteID` = ".SITE_ID. " AND `LanguageID` = ".LANG_ID." AND `ParentID` = ".$parentID); while($result = MySQL::FetchAssoc($query)) { $object = new Model_Navigation(); $object->ID = $result["ID"]; $object->WebsiteID = $result["WebsiteID"]; $object->LanguageID = $result["LanguageID"]; $object->ParentID = $result["ParentID"]; $object->Name = $result["Name"]; $object->Page = Model_Page::GetObjectByID($result["PageID"]); $object->ExternalURL = $result["ExternalURL"]; $object->Index = $result["Index"]; $object->Level = [here lies my problem]; $objectlist->Add($object); self::GetObjectList($object->ID, $objectlist); } return $objectlist; } Hope to hear from you! Greetings from Holland, Ben Fransen

    Read the article

  • Problems connecting Clariion LUNS to Solaris 10

    - by vialde
    I've got a Clariion San and a Solaris 10 server with an emulex HBA. The Thin LUNS are visible in Solaris and I can happily format the raw devices. Unfortunately that's all I can do. All other operations result in I/O errors. I'm running current versions of PowerPath and Solaris is patched as high as it'll go. Anyone have any similar experiences?

    Read the article

  • SQL Server search filter and order by performance issues

    - by John Leidegren
    We have a table value function that returns a list of people you may access, and we have a relation between a search and a person called search result. What we want to do is that wan't to select all people from the search and present them. The query looks like this SELECT qm.PersonID, p.FullName FROM QueryMembership qm INNER JOIN dbo.GetPersonAccess(1) ON GetPersonAccess.PersonID = qm.PersonID INNER JOIN Person p ON p.PersonID = qm.PersonID WHERE qm.QueryID = 1234 There are only 25 rows with QueryID=1234 but there are almost 5 million rows total in the QueryMembership table. The person table has about 40K people in it. QueryID is not a PK, but it is an index. The query plan tells me 97% of the total cost is spent doing "Key Lookup" witht the seek predicate. QueryMembershipID = Scalar Operator (QueryMembership.QueryMembershipID as QM.QueryMembershipID) Why is the PK in there when it's not used in the query at all? and why is it taking so long time? The number of people total 25, with the index, this should be a table scan for all the QueryMembership rows that have QueryID=1234 and then a JOIN on the 25 people that exists in the table value function. Which btw only have to be evaluated once and completes in less than 1 second.

    Read the article

  • How to perform Linq select new with datetime in SQL 2008

    - by kd7iwp
    In our C# code I recently changed a line from inside a linq-to-sql select new query as follows: OrderDate = (p.OrderDate.HasValue ? p.OrderDate.Value.Year.ToString() + "-" + p.OrderDate.Value.Month.ToString() + "-" + p.OrderDate.Value.Day.ToString() : "") To: OrderDate = (p.OrderDate.HasValue ? p.OrderDate.Value.ToString("yyyy-mm-dd") : "") The change makes the line smaller and cleaner. It also works fine with our SQL 2008 database in our development environment. However, when the code deployed to our production environment which uses SQL 2005 I received an exception stating: Nullable Type must have a value. For further analysis I copied (p.OrderDate.HasValue ? p.OrderDate.Value.ToString("yyyy-mm-dd") : "") into a string (outside of a Linq statement) and had no problems at all, so it only causes an in issue inside my Linq. Is this problem just something to do with SQL 2005 using different date formats than from SQL 2008? Here's more of the Linq: dt = FilteredOrders.Where(x => x != null).Select(p => new { Order = p.OrderId, link = "/order/" + p.OrderId.ToString(), StudentId = (p.PersonId.HasValue ? p.PersonId.Value : 0), FirstName = p.IdentifierAccount.Person.FirstName, LastName = p.IdentifierAccount.Person.LastName, DeliverBy = p.DeliverBy, OrderDate = p.OrderDate.HasValue ? p.OrderDate.Value.Date.ToString("yyyy-mm-dd") : ""}).ToDataTable(); This is selecting from a List of Order objects. The FilteredOrders list is from another linq-to-sql query and I call .AsEnumerable on it before giving it to this particular select new query. Doing this in regular code works fine: if (o.OrderDate.HasValue) tempString += " " + o.OrderDate.Value.Date.ToString("yyyy-mm-dd");

    Read the article

  • transactions and delete using fluent nhibernate

    - by Will I Am
    I am starting to play with (Fluent) nHibernate and I am wondering if someone can help with the following. I'm sure it's a total noob question. I want to do: delete from TABX where name = 'abc' where table TABX is defined as: ID int name varchar(32) ... I build the code based on internet samples: using (ITransaction transaction = session.BeginTransaction()) { IQuery query = session.CreateQuery("FROM TABX WHERE name = :uid") .SetString("uid", "abc"); session.Delete(query.List<Person>()[0]); transaction.Commit(); } but alas, it's generating two queries (one select and one delete). I want to do this in a single statement, as in my original SQL. What is the correct way of doing this? Also, I noticed that in most samples on the internet, people tend to always wrap all queries in transactions. Why is that? If I'm only running a single statement, that seems an overkill. Do people tend to just mindlessly cut and paste, or is there a reason beyond that? For example, in my query above, if I do manage it to get it from two queries down to one, i should be able to remove the begin/commit transaction, no? if it matters, I'm using PostgreSQL for experimenting.

    Read the article

  • sending email with codeigniter

    - by Maru
    I have this MODEL and I get the email which I want to send class Cliente_Model extends CI_Model{ public function getInfo($id){ $this->db->select('*'); $this->db->from('pendientes'); $query = $this->db->get(); if($query->num_rows() > 0) { foreach ($query->result_array() as $row) { return $row['email']; } } else { return FALSE; } } } CONTROLLER $this->load->model('cliente_model', 'client'); $clientInfo = $this->client->getInfo($id); $this->email->from('[email protected]', 'Demo'); $this->email->to($clientInfo); $this->email->subject('Email Test'); $this->email->message('your user is '.$clientInfo.' and your password is '.$clave); $this->email->send(); and I need some help here, I can get the email and it can send it perfectly but in the message I need to send the password also and I don't know how I can get it from the model. thanks in advance!

    Read the article

  • NHibernate stored procedure problem

    - by Calvin
    I'm having a hard time trying to get my stored procedure works with NHibernate. The data returned from the SP does not correspond to any database table. This is my mapping file: <?xml version="1.0" encoding="utf-8" ?> <hibernate-mapping xmlns="urn:nhibernate-mapping-2.2" assembly="DomainModel" namespace="DomainModel.Entities"> <sql-query name="DoSomething"> <return class="SomeClass"> <return-property name="ID" column="ID"/> </return> exec [dbo].[sp_doSomething] </sql-query> </hibernate-mapping> Here is my domain class: namespace DomainModel.Entities { public class SomeClass { public SomeClass() { } public virtual Guid ID { get; set; } } } When I run the code, it fails with Exception Details: NHibernate.HibernateException: Errors in named queries: {DoSomething} at line 80 Line 78: config.Configure(Path.Combine(AppDomain.CurrentDomain.BaseDirectory, "NHibernate.config")); Line 79: Line 80: g_sessionFactory = config.BuildSessionFactory(); When I debug into NHibernate code, it seems that SomeClass is not added to the persister dictionary because there isn't a class mapping (only sql-query) defined in hbm.xml. And later on in CheckNamedQueries function, it is not able to find the persistor for SomeClass. I've checked all the obvious things (e.g. make hbm as an embedded resource) and my code isn't too much different from other samples I found on the web, but somehow I just can't get it working. Any idea how I can resolve this issue?

    Read the article

  • Optimal two variable linear regression SQL statement (censoring outliers)

    - by Dave Jarvis
    Problem Am looking to apply the y = mx + b equation (where m is SLOPE, b is INTERCEPT) to a data set, which is retrieved as shown in the SQL code. The values from the (MySQL) query are: SLOPE = 0.0276653965651912 INTERCEPT = -57.2338357550468 SQL Code SELECT ((sum(t.YEAR) * sum(t.AMOUNT)) - (count(1) * sum(t.YEAR * t.AMOUNT))) / (power(sum(t.YEAR), 2) - count(1) * sum(power(t.YEAR, 2))) as SLOPE, ((sum( t.YEAR ) * sum( t.YEAR * t.AMOUNT )) - (sum( t.AMOUNT ) * sum(power(t.YEAR, 2)))) / (power(sum(t.YEAR), 2) - count(1) * sum(power(t.YEAR, 2))) as INTERCEPT FROM (SELECT D.AMOUNT, Y.YEAR FROM CITY C, STATION S, YEAR_REF Y, MONTH_REF M, DAILY D WHERE -- For a specific city ... -- C.ID = 8590 AND -- Find all the stations within a 15 unit radius ... -- SQRT( POW( C.LATITUDE - S.LATITUDE, 2 ) + POW( C.LONGITUDE - S.LONGITUDE, 2 ) ) <15 AND -- Gather all known years for that station ... -- S.STATION_DISTRICT_ID = Y.STATION_DISTRICT_ID AND -- The data before 1900 is shaky; insufficient after 2009. -- Y.YEAR BETWEEN 1900 AND 2009 AND -- Filtered by all known months ... -- M.YEAR_REF_ID = Y.ID AND -- Whittled down by category ... -- M.CATEGORY_ID = '001' AND -- Into the valid daily climate data. -- M.ID = D.MONTH_REF_ID AND D.DAILY_FLAG_ID <> 'M' GROUP BY Y.YEAR ORDER BY Y.YEAR ) t Data The data is visualized here (with five outliers highlighted): Questions How do I return the y value against all rows without repeating the same query to collect and collate the data? That is, how do I "reuse" the list of t values? How would you change the query to eliminate outliers (at an 85% confidence interval)? The following results (to calculate the start and end points of the line) appear incorrect. Why are the results off by ~10 degrees (e.g., outliers skewing the data)? (1900 * 0.0276653965651912) + (-57.2338357550468) = -4.66958228 (2009 * 0.0276653965651912) + (-57.2338357550468) = -1.65405406 I would have expected the 1900 result to be around 10 (not -4.67) and the 2009 result to be around 11.50 (not -1.65). Thank you!

    Read the article

  • exim4, avoid emails end up in spam folder

    - by MultiformeIngegno
    I have a VPS: I set up exim, problem is emails always go in the spam folder.. this is a sample header: http://pastebin.com/raw.php?i=4NJ2ZaUs As you can see it PASSes SPF test but still emails don't pass spam filters (I tried with Gmail).. Here's my exim config: dc_eximconfig_configtype='internet' dc_other_hostnames='MY_DOMAIN' dc_local_interfaces='' dc_readhost='MY_DOMAIN' dc_relay_domains='MY_DOMAIN' dc_minimaldns='false' dc_relay_nets='' dc_smarthost='MY_DOMAIN' CFILEMODE='644' dc_use_split_config='false' dc_hide_mailname='' dc_mailname_in_oh='true' dc_localdelivery='mail_spool' Why does this happen?

    Read the article

  • mysql subselect alternative

    - by Arnold
    Hi, Lets say I am analyzing how high school sports records affect school attendance. So I have a table in which each row corresponds to a high school basketball game. Each game has an away team id and a home team id (FK to another "team table") and a home score and an away score and a date. I am writing a query that matches attendance with this seasons basketball games. My sample output will be (#_students_missed_class, day_of_game, home_team, away_team, home_team_wins_this_season, away_team_wins_this_season) I now want to add how each team did the previous season to my analysis. Well, I have their previous season stored in the game table but i should be able to accomplish that with a subselect. So in my main select statement I add the subselect: SELECT COUNT(*) FROM game_table WHERE game_table.date BETWEEN 'start of previous season' AND 'end of previous season' AND ( (game_table.home_team = team_table.id AND game_table.home_score > game_table.away_score) OR (game_table.away_team = team_table.id AND game_table.away_score > game_table.home_score)) In this case team-table.id refers to the id of the home_team so I now have all their wins calculated from the previous year. This method of calculation is neither time nor resource intensive. The Explain SQL shows that I have ALL in the Type field and I am not using a Key and the query times out. I'm not sure how I can accomplish a more efficient query with a subselect. It seems proposterously inefficient to have to write 4 of these queries (for home wins, home losses, away wins, away losses). I am sure this could be more lucid. I'll absolutely add color tomorrow if anyone has questions

    Read the article

  • ZIP Numerous Blob Files

    - by Michael
    I have a database table that contains numerous PDF blob files. I am attempting to combine all of the files into a single ZIP file that I can download and then print. Please help! <?php include 'config.php'; include 'connect.php'; $session= $_GET[session]; $query = " SELECT $tbl_uploads.username, $tbl_uploads.description, $tbl_uploads.type, $tbl_uploads.size, $tbl_uploads.content, $tbl_members.session FROM $tbl_uploads LEFT JOIN $tbl_members ON $tbl_uploads.username = $tbl_members.username WHERE $tbl_members.session= '$session'"; $result = mysql_query($query) or die('Error, query failed'); while(list($username, $description, $type, $size, $content) = mysql_fetch_array($result)) { header("Content-length: $size"); header("Content-type: $type"); header("Content-Disposition: inline; filename=$username-$description.pdf"); echo $content; } $files = array('File 1 from database', 'File 2 from database'); $zip = new ZipArchive; $zip->open('file.zip', ZipArchive::CREATE); foreach ($files as $file) { $zip->addFile($file); } $zip->close(); header('Content-Type: application/zip'); header('Content-disposition: attachment; filename=filename.zip'); header('Content-Length: ' . filesize($zipfilename)); readfile($zipname); mysql_close($link); exit; ?>

    Read the article

  • how to disable these logs on the screen?

    - by user62367
    using Fedora 14: http://pastebin.com/raw.php?i=jUvcfugw i mount an anonym Samba share [checks it in every 5 sec] it's working, ok, great! But: when i shut down my Fedora box, i can see the lines containing this scripts lines! Many times, about ~50x on the screen. How could i disable these lines when shutting down? I [and other people] don't want to see those lines for about ~ 5 sec Thank you!

    Read the article

  • security deleting a mysql row with jQuery $.post

    - by FFish
    I want to delete a row in my database and found an example on how to do this with jQuery's $.post() Now I am wondering about security though.. Can someone send a POST request to my delete-row.php script from another website? JS function deleterow(id) { // alert(typeof(id)); // number if (confirm('Are you sure want to delete?')) { $.post('delete-row.php', {album_id:+id, ajax:'true'}, function() { $("#row_"+id).fadeOut("slow"); }); } } PHP: delete-row.php <?php require_once("../db.php"); mysql_connect(DB_SERVER, DB_USER, DB_PASSWORD) or die("could not connect to database " . mysql_error()); mysql_select_db(DB_NAME) or die("could not select database " . mysql_error()); if (isset($_POST['album_id'])) { $query = "DELETE FROM albums WHERE album_id = " . $_POST['album_id']; $result = mysql_query($query); if (!$result) die('Invalid query: ' . mysql_error()); echo "album deleted!"; } ?>

    Read the article

  • How to use SQLErrorCodeSQLExceptionTranslator and DAO class with @Repository in Spring?

    - by GuidoMB
    I'm using Spring 3.0.2 and I have a class called MovieDAO that uses JDBC to handle the db. I have set the @Repository annotations and I want to convert the SQLException to the Spring's DataAccessException I have the following example: @Repository public class JDBCCommentDAO implements CommentDAO { static JDBCCommentDAO instance; ConnectionManager connectionManager; private JDBCCommentDAO() { connectionManager = new ConnectionManager("org.postgresql.Driver", "postgres", "postgres"); } static public synchronized JDBCCommentDAO getInstance() { if (instance == null) instance = new JDBCCommentDAO(); return instance; } @Override public Collection<Comment> getComments(User user) throws DAOException { Collection<Comment> comments = new ArrayList<Comment>(); try { String query = "SELECT * FROM Comments WHERE Comments.userId = ?"; Connection conn = connectionManager.getConnection(); PreparedStatement stmt = conn.prepareStatement(query); stmt = conn.prepareStatement(query); stmt.setInt(1, user.getId()); ResultSet result = stmt.executeQuery(); while (result.next()) { Movie movie = JDBCMovieDAO.getInstance().getLightMovie(result.getInt("movie")); comments.add(new Comment(result.getString("text"), result.getInt("score"), user, result.getDate("date"), movie)); } connectionManager.closeConnection(conn); } catch (SQLException e) { e.printStackTrace(); //CONVERT TO DATAACCESSEXCEPTION } return comments; } } I Don't know how to get the Translator and I don't want to extends any Spring class, because that is why I'm using the @Repository annotation

    Read the article

  • dig works but dig +trace <domain_name> not working

    - by anoopmathew
    In my local system i can't get the proper result of dig +trace , but dig works fine. I'm using Ubuntu 10.04 LTS version. I'll attach the result of dig and dig +trace along with this updates. dig +trace gmail.com ; << DiG 9.7.0-P1 << +trace gmail.com ;; global options: +cmd ;; Received 12 bytes from 4.2.2.4#53(4.2.2.4) in 291 ms dig gmail.com ; << DiG 9.7.0-P1 << gmail.com ;; global options: +cmd ;; Got answer: ;; -HEADER<<- opcode: QUERY, status: NOERROR, id: 59528 ;; flags: qr rd ra; QUERY: 1, ANSWER: 2, AUTHORITY: 0, ADDITIONAL: 0 ;; QUESTION SECTION: ;gmail.com. IN A ;; ANSWER SECTION: gmail.com. 49 IN A 74.125.236.118 gmail.com. 49 IN A 74.125.236.117 ;; Query time: 302 msec ;; SERVER: 4.2.2.4#53(4.2.2.4) ;; WHEN: Sat Oct 13 14:57:56 2012 ;; MSG SIZE rcvd: 59 Please anyone update a solution for this issue. I'm just worried about my issue.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • linq - how to sort a list

    - by Billy Logan
    Hello everyone, I have a linq query that populates a list of designers. since i am using the filters below my sorting is not functioning properly. My question is with the given code below how can i best sort this List after the fact or sort while querying? I have tried to sort the list after the fact using the following script but i receive a compiler error: List<TBLDESIGNER> designers = new List<TBLDESIGNER>(); designers = 'calls my procedure below and comes back with an unsorted list of designers' designers.Sort((x, y) => string.Compare(x.FIRST_NAME, y.LAST_NAME)); Query goes as follows: List<TBLDESIGNER> designer = null; using (SOAE strikeOffContext = new SOAE()) { //Invoke the query designer = AdminDelegates.selectDesignerDesigns.Invoke(strikeOffContext).ByActive(active).ByAdmin(admin).ToList(); } Delegate: public static Func<SOAE, IQueryable<TBLDESIGNER>> selectDesignerDesigns = CompiledQuery.Compile<SOAE, IQueryable<TBLDESIGNER>>( (designer) => from c in designer.TBLDESIGNER.Include("TBLDESIGN") orderby c.FIRST_NAME ascending select c); Filter ByActive: public static IQueryable<TBLDESIGNER> ByActive(this IQueryable<TBLDESIGNER> qry, bool active) { //Return the filtered IQueryable object return from c in qry where c.ACTIVE == active select c; } Filter ByAdmin: public static IQueryable<TBLDESIGNER> ByAdmin(this IQueryable<TBLDESIGNER> qry, bool admin) { //Return the filtered IQueryable object return from c in qry where c.SITE_ADMIN == admin select c; } Thanks in advance, Billy

    Read the article

  • Checking inherited attributes in an 'ancestry' based SQL table

    - by Brendon Muir
    I'm using the ancestry gem to help organise my app's tree structure in the database. It basically writes a childs ancestor information to a special column called 'ancestry'. The ancestry column for a particular child might look like '1/34/87' where the parent of this child is 87, and then 87's parent is 34 and 34's is 1. It seems possible that we could select rows from this table each with a subquery that checks all the ancestors to see if a certain attribute it set. E.g. in my app you can hide an item and its children just by setting the parent element's visibility column to 0. I want to be able to find all the items where none of their ancestors are hidden. I tried converting the slashes to comma's with the REPLACE command but IN required a set of comma separated integers rather than one string with comma separated string numbers. It's funny, because I can do this query in two steps, e.g. retrieve the row, then take its ancestry column, split out the id's and make another query that checks that the id is IN that set of id's and that visibility isn't ever 0 and whala! But joining these into one query seems to be quite a task. Much searching has shown a few answers but none really do what I want. SELECT * FROM t1 WHERE id = 99; 99's ancestry column reads '1/34/87' SELECT * FROM t1 WHERE visibility = 0 AND id IN (1,34,87); kind of backwards, but if this returns no rows then the item is visible. Has anyone come across this before and come up with a solution. I don't really want to go the stored procedure route. It's for a rails app.

    Read the article

< Previous Page | 455 456 457 458 459 460 461 462 463 464 465 466  | Next Page >