Search Results

Search found 43274 results on 1731 pages for 'single line'.

Page 466/1731 | < Previous Page | 462 463 464 465 466 467 468 469 470 471 472 473  | Next Page >

  • Why does Notepad "randomly" make pasted text a smaller font size?

    - by Coldblackice
    Sometimes when I copy and paste text into Notepad, it will paste the text in the default Notepad font and size, however, the latter half of the pasted line will be multiple font sizes smaller. I'm stumped as to why this is happening. I wondered if it was perhaps some type of hidden formatting that was being copied into Notepad, but I believe that Notepad strips the formatting. I've subsequently taken the same text and tried copy and pasting it into URL bars and CMD prompts to strip any potential formatting (even though it was plaintext copied from web), and then re-pasted into Notepad, but it still leaves this phenomenon. Additionally, when resizing the Notepad window, it will change what portion of the line is default sized and downsized, as seen in the screenshot posted below. The three windows are actually the same Notepad window, each with a different resizing and the resulting text resizing.

    Read the article

  • How do I get `set show-all-if-ambiguous on` in my .inputrc to play nice with the Python interpreter?

    - by ysim
    I noticed that after I added the set show-all-if-ambiguous on line to my ~/.inputrc, whenever I pressed tab to indent a block, it would show me the bash Display all ... possibilities? (y or n) prompt, and leave me unable to indent the actual code. Is there any way to keep that line in my .inputrc but still have the tab key work as expected in the Python interpreter? This is in my VirtualBox Ubuntu 12.04 VM, if it matters. EDIT: Curiously, I now have a different issue with the Python shell that comes with Django -- when I press tab, I get Python tab completion, but only with one Tab press. I've opened a separate question here for it.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • What's the advantage of using a bash script for cron jobs?

    - by AlxVallejo
    From my understanding you can write your crons by editing crontab -e I've found several sources that instead refer to a bash script in the cron job, rather than writing a job line for line. Is the only benefit that you can consolidate many tasks into one cron job using a bash script? Additional question for a newbie: Editing crontab -e refers to one file correct? I've noticed that if I open crontab -e and close without editing, when I open the file again there is a different numerical extension such as: "/tmp/crontab.XXXXk1DEaM" 0L, 0C I though the crontab is stored in /var/spool/cron or /etc/crontab ?? Why would it store the cron in the tmp folder?

    Read the article

  • Custom prompt doesn't work on Mac Terminal

    - by mareks
    I like to use a custom prompt (current path in blue) on my unix machine: export PS1='\[\e[0;34m\]\w \$\[\e[m\] ' But when I try to use it on Mac's terminal it doesn't work: it fails to detect the end of the prompt and overwrites the prompt when I type commands. This also happens when I'm inputting a long command where it wraps over the same line instead of starting a new line. I don't understand why this is the case since I use bash on both machines. Any suggestions on how to remedy this?

    Read the article

  • Transfer disk image to larger/smaller disk

    - by forthrin
    I need to switch the hard drive on a 2006 iMac to a new SSD. I don't have the original installation CDs. I know I can order CDs from Apple, but this costs money. Someone told me it's possible to rip the image of the old drive and transfer to the new drive. If so, does the size of the new drive have to be exactly the same as the old? If not, my questions are: Is it possible to "stretch" the image from 120 MB disk to a 256 MB disk (numbers are examples)? If so, what is the command line for this? Likewise, is it possible to "shrink" an image from a larger disk (eg. 256 MB) to a smaller disk (eg. 120 MB), provided that the actual space used on the disk does not exceed 120 MB? How do you do this on the command line?

    Read the article

  • How to install php cli with pnctl alongside Zend Server

    - by fazy
    I have Zend Server CE 5.6 with PHP 5.2 running on Ubuntu 11.10. Now the need has arisen to run a command line PHP script that uses PHP's pnctl functionality. First of all, I had no PHP command line in my path, so I made a symlink from the Zend one: sudo ln -s /usr/local/zend/bin/php /usr/bin However, when I run my script, I now get this error: PHP Fatal error: Call to undefined function pcntl_fork() The Zend web control panel doesn't offer pnctl in the list of modules, so how do I get this functionality? Is it safe to use apt-get to install PHP directly, to run alongside the Zend instance? If so, how do I make sure I get version 5.2? I guess the following would pull in PHP 5.3: apt-get php5-cli I could probably muddle through but any pointers to help me avoid making a mess would be much appreciated!

    Read the article

  • Service redirection on same network

    - by Unode
    I have a network on which I run multiple servers each dedicated to a given service. Because most services run on distinct ports I'm currently looking for a way of unifying "all" services into a single "proxy" machine. The idea is to abstract which machine is being accessed but still allow direct connection if needed/requested. This "proxy" machine has only one network interface which is part of the same network as all the other service providing machines. I've looked into Routing and NAT but I've so far failed to figure out how to make it work. I tried to achieve this using shorewall but couldn't find clear examples. However I'm not entirely sure this is the best/simplest strategy. With that said, what would be the best way of achieving this result? Example case: Proxy IP - Listening port - Send requests to 192.168.0.50 80 192.168.0.1:80 " 22 192.168.0.2:2222 " 3306 192.168.0.3:3000 " 5432 192.168.0.4:5432 " 5222 192.168.0.5:5222 PS: I'm not concerned with the single-point-of-failure nature of the proxy. Thanks

    Read the article

  • Help with user login on Centos 5.6

    - by Owen
    I added a user for the sole purpose of using SU for root. I did not allow the creation of a home directory when creating the user. So now when I login as this user I get the following: Could not chdir to home directory /home/MYUSERNAME: No such file or directory Couldn't resolve homedir for current user at - line 0 BEGIN failed--compilation aborted. Couldn't resolve homedir for current user at - line 0 BEGIN failed--compilation aborted. Is this an error, and if so how do I fix it so it is not looking to "resolve" the homedir?

    Read the article

  • Exchange 2003 inbound routing issue

    - by user565712
    Just recently we started experiencing inbound routing issues. Email adddressed to [email protected] is intermittantly translated to [email protected]. This is happening for several users and, as stated, is intermittant. I don't know where to start looking for the solution. Is this an Exchange issue? A DNS issue? We have a single Exchange server inside our network with an FQDN of server.domain.local with a single SMTP Virtual Server. The Advanced properties of the Delivery tab of the Virt Server has an empty Masquerade Domain textbox and the value for the FDQN text-box is set to the domain itself, domain.com. The DNS record for domain.com is a CNAME entry referencing www.domain.com. Is this somehow related to the problem? I checked the headers of the inbound messages that generated NDRs as a result of being sent to [email protected] and nowhere in the header is www.domain.com mentioned. To make my life even more difficult, we use Postini as a third-party SPAM filtering service. Our MX records point to the Postini servers and Postini delivers the messages to our server. Perhaps it is Postini that is mucking things up? sigh I'm having trouble with this one and the intermittent aspect is making it that much more difficult for me. Any ideas?

    Read the article

  • How to Transpose in Excel a column with more than 50,000 rows?

    - by ezlee69
    I am trying to Transpose all of column "B", but want to skip a line then grab the next 4 and paste them in the same column. How can I make this loop all of column "B" skipping every 5th line and change the range to the next open cell or "Range" automatically without manually typing each one individually? Range("B12:B16").Select Selection.Copy Sheets("Sheet2").Select Range("A2").Select Selection.PasteSpecial Paste:=xlPasteAll, Operation:=xlNone, SkipBlanks:= _ False, Transpose:=True Range("B18:B22").Select Selection.Copy Sheets("Sheet2").Select Range("A3").Select Selection.PasteSpecial Paste:=xlPasteAll, Operation:=xlNone, SkipBlanks:= _ False, Transpose:=True Range("B24:B28").Select Selection.Copy Sheets("Sheet2").Select Range("A4").Select Selection.PasteSpecial Paste:=xlPasteAll, Operation:=xlNone, SkipBlanks:= _ False, Transpose:=True

    Read the article

  • Mass modify all php files on my server

    - by anslume
    I would like to delete a php code on all my php files on my debian server. indeed I would like to get rid of a line: eval(base64_decode("DQplcnJvcl9yZXBvcnR")); It's present in many of my phpfiles. That's why I would like to find a script which is going to look it up in all my php files and replace itwith nothing? Do you have any idea how i could do that ? I know how to do it on windows with some software (notepad++ is very useful) but no idea how can I do that in a command line through ssh Thanks for your answer, Ans

    Read the article

  • Setting a mapped drive in Virtual hosts causes apache to not start

    - by darksoulsong
    I´m trying to set a virtual host on my windows 7 machine. The folder I want to point to is located on a centOS machine and the folder path is Z:\Websites\Online\MyClient\Site. But something strange happens when I set the document root like this: DocumentRoot "Z:\Websites\Online\MyClient\Site" Apache do not restarts after that. When I take a look at the log, there is an error pointing to that line, where I added the path to the folder: Syntax error on line 48 of C:/Program Files/Zend/Apache2/conf/extra/httpd-vhosts.conf: DocumentRoot must be a directory. There must be a way to make it work like this, by setting an Apache Installation on a machine and pointing it to a folder located on another computer, right? My hosts file is set like this: 172.17.10.1\Data\Websites\Online\MyClient\Site MyClient.local ANY HELP would be VERY appreciated.

    Read the article

  • PHP session files have permissions of 000 - They're ununsable

    - by vanced
    I kept having issues with a Document Management System I'm trying to install as, at the first step of the installation process, it would error with: Warning: Unknown: open(/tmp/sess_d39cac7f80834b2ee069d0c867ac169c, O_RDWR) failed: Permission denied (13) in Unknown on line 0 Warning: Unknown: Failed to write session data (files). Please verify that the current setting of session.save_path is correct (/tmp) in Unknown on line 0 I looked in /tmp and saw the sess_* files have the following permissions ---------- 1 vanced vanced 1240 Jan 20 08:48 sess_d39cac7f80834b2ee069d0c867ac169c All the session files look like this. So obviously, they're unusable by PHP and it's causing me lots of problems. How can I get PHP to set the correct permissions? I've tried changing the directory which php.ini uses to /tmp/phpsessions and the same thing occurs. The directories are a+rwx.

    Read the article

  • Copying List of Files Through Powershell

    - by Driftpeasant
    So I'm trying to copy 44k files from one server to another. My Powershell script is: Import-CSV f:\script\Listoffiles.csv | foreach $line {Move-item $_.Source $_.Destination} With the Format for the CSV: Source, Destination E:\folder1\folder2\file with space.txt, \\1.2.3.4\folder1\folder2\file with space.txt I keep getting: A positional parameter cannot be found that accepts argument '\\1.2.3.4\folder1\folder2\file'. At line:1 char:10 + move-item <<<< E:\folder1\folder2\file with space.txt \\1.2.3.4\folder1\folder2\file with space.txt + CategoryInfo : InvalidArgument: (:) [Move-Item], ParameterBindingException + FullyQualifiedErrorId : PositionalParameterNotFound,Microsoft.PowerShell.Commands.MoveItemCommand So I've tried putting "s around both paths, and also 's, and I still get either Move-Item: Could not find a part of the path errors. Can anyone help me?

    Read the article

  • Ubuntu - executable file - variable assignment throwing error on script run

    - by newcoder
    I am trying to run a small script - test - on ubuntu box. It is as follows: var1 = bash var2 = /home/test/directory ... ... <some more variable assignments and then program operations here> ... ... Now every time I run it, then it throws errors: root@localhost#/opt/test /opt/test: line 1: var1: command not found /opt/test: line 3: var2: command not found ... ... more similar errors ... Can someone help me understand what is wrong in this script? Many thanks.

    Read the article

  • Use puppet to make changes to ip route and sysctl

    - by Quintin Par
    I have two changes to ip route & sysctl that disable tcp slow start. Here’s how I do it ip route show Make a note of the line starting with default. Pick up the IP from the default line and run sudo ip route change default via $ip_address dev eth0 initcwnd 12 sudo sysctl -w net.ipv4.tcp_slow_start_after_idle=0 How can I create a puppet script out of this? One that can be deployed to many machines of the same type – CentOS 6 Edit: Added bounty to get a working example for sudo ip route change default via $ip_address dev eth0 initcwnd 12

    Read the article

  • I Cannot connect to remote MySQL database using SSH tunnel

    - by Scott
    Brand new server, brand new MySQL 5.5 install on Ubuntu 12.04. I can log in to the database as root from the command line. I can log on via Navicat MySQL or Sequel Pro as root on port 3306 from my Mac. I cannot log in using an SSH tunnel to the server and then to the database as root. I have tried both localhost and 127.0.0.1 as server for the local connection part. My password is fine. root is currently defined at %, 127.0.0.1, and localhost. I have set up this same type of connection at least 30 times before and never had a problem. The SSH connection gets made with no problem, and then it just hangs trying to connect to the DB and finally times out. The only thing I changed in my.cnf was to comment out the bind-address = 127.0.0.1 line. Any help? Any Ideas?

    Read the article

  • Whats wrong with my keyboard?

    - by Neifen
    I have a new kind of weird problem with my laptops keyboard. To be precise with the shift key. Lately the both Shift-Keys doesn't just make the letters big, they also took role of the 2 and the 7 on the numpad. So when i push the left shift key (with num lock) it also writes a 7. When I use the left shift key (without num lock), the cursor goes to the begin of the line. When i push the right shift key (with num lock) it writes a 2. When I use the right shift key (without num lock), the cursor goes to the end of the line. I really don't know what I changed on the computer... it's really weird and really annoying

    Read the article

  • How to run wireshark on the background without the GUI?

    - by user60968
    Hello everybody, I am trying to run Wireshark on Mac OS X, on the background. I did install the command line utilities, and so I am able to start wireshark and capture packet using the command line. The only thing I want now is to run it on the background, without even having the X11 icon on the task bar and see the window of wireshark. I believe it is possible but can't find anything on the doc of Wireshark. Maybe another way would be to find a trick to hide an icon on Mac OS X... If anybody already did that or have an idea... Thank you Please excuse my English which is not perfect at all

    Read the article

  • What's the best way to install software in Ubuntu?

    - by the0ther
    I'm new to Ubuntu and have been away from Linux for a while. I'm used to Windows and find this tedious on Linux but I want to give it a shot. My tendency is to prefer GUI tools over command-line, and Ubuntu is a distro that seems to cater to usability. I note it is based somewhat on apt-get which I've heard good things about. What's the best practise for installing apps on Ubuntu? Should I prefer to try my options in this order? Synaptic Package Manger apt-get on the command line .tar.gz files (old school)

    Read the article

  • Error configuring virtual hosts with Apache on Windows 8 [on hold]

    - by rushd
    I can't get virtual host to work on my Windows 8. I restart, stop, start Apache, but I get a popup dialog that says: The requested operation has failed! I know it's the line that produces the error, but how can I enable vhost if I don't uncomment the line in httpd.conf? # Virtual hosts Include conf/extra/httpd-vhosts.conf The only thing I did was edited C:\Apache24\conf\httpd.conf by removing the comment on Include conf/extra/httpd-vhosts.conf and edited the file located in C:\Apache24\conf\extra\httpd-vhost.conf. Apache is installed in C:\Apache24 Directory I want to use for Virtual Host is located at C:\Users\TomCODE\brainprojects My vhost.conf looks like this: <VirtualHost *:80> ServerAdmin [email protected] ServerName brain.local DocumentRoot "C:/Users/TomCODE/brainprojects" ErrorLog "logs/brain.local-error.log" CustomLog "logs/local.local-access.log" common </VirtualHost> My hosts file: 127.0.0.1 brain.local I downloaded the file httpd-2.4.9-win64-VC11 from Apache Lounge.

    Read the article

< Previous Page | 462 463 464 465 466 467 468 469 470 471 472 473  | Next Page >