Search Results

Search found 11972 results on 479 pages for 'writing'.

Page 470/479 | < Previous Page | 466 467 468 469 470 471 472 473 474 475 476 477  | Next Page >

  • java: how to get a string representation of a compressed byte array ?

    - by Guillaume
    I want to put some compressed data into a remote repository. To put data on this repository I can only use a method that take the name of the resource and its content as a String. (like data.txt + "hello world"). The repository is moking a filesystem but is not, so I can not use File directly. I want to be able to do the following: client send to server a file 'data.txt' server compress 'data.txt' into a compressed file 'data.zip' server send a string representation of data.zip to the repository repository store data.zip client download from repository data.zip and his able to open it with its favorite zip tool The problem arise at step 3 when I try to get a string representation of my compressed file. Here is a sample class, using the zip*stream and that emulate the repository showcasing my problem. The created zip file is working, but after its 'serialization' it's get corrupted. (the sample class use jakarta commons.io ) Many thanks for your help. package zip; import java.io.File; import java.io.FileInputStream; import java.io.FileOutputStream; import java.io.IOException; import java.io.InputStream; import java.util.zip.ZipEntry; import java.util.zip.ZipInputStream; import java.util.zip.ZipOutputStream; import org.apache.commons.io.FileUtils; /** * Date: May 19, 2010 - 6:13:07 PM * * @author Guillaume AME. */ public class ZipMe { public static void addOrUpdate(File zipFile, File ... files) throws IOException { File tempFile = File.createTempFile(zipFile.getName(), null); // delete it, otherwise you cannot rename your existing zip to it. tempFile.delete(); boolean renameOk = zipFile.renameTo(tempFile); if (!renameOk) { throw new RuntimeException("could not rename the file " + zipFile.getAbsolutePath() + " to " + tempFile.getAbsolutePath()); } byte[] buf = new byte[1024]; ZipInputStream zin = new ZipInputStream(new FileInputStream(tempFile)); ZipOutputStream out = new ZipOutputStream(new FileOutputStream(zipFile)); ZipEntry entry = zin.getNextEntry(); while (entry != null) { String name = entry.getName(); boolean notInFiles = true; for (File f : files) { if (f.getName().equals(name)) { notInFiles = false; break; } } if (notInFiles) { // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(name)); // Transfer bytes from the ZIP file to the output file int len; while ((len = zin.read(buf)) > 0) { out.write(buf, 0, len); } } entry = zin.getNextEntry(); } // Close the streams zin.close(); // Compress the files if (files != null) { for (File file : files) { InputStream in = new FileInputStream(file); // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(file.getName())); // Transfer bytes from the file to the ZIP file int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } // Complete the entry out.closeEntry(); in.close(); } // Complete the ZIP file } tempFile.delete(); out.close(); } public static void main(String[] args) throws IOException { final String zipArchivePath = "c:/temp/archive.zip"; final String tempFilePath = "c:/temp/data.txt"; final String resultZipFile = "c:/temp/resultingArchive.zip"; File zipArchive = new File(zipArchivePath); FileUtils.touch(zipArchive); File tempFile = new File(tempFilePath); FileUtils.writeStringToFile(tempFile, "hello world"); addOrUpdate(zipArchive, tempFile); //archive.zip exists and contains a compressed data.txt that can be read using winrar //now simulate writing of the zip into a in memory cache String archiveText = FileUtils.readFileToString(zipArchive); FileUtils.writeStringToFile(new File(resultZipFile), archiveText); //resultingArchive.zip exists, contains a compressed data.txt, but it can not //be read using winrar: CRC failed in data.txt. The file is corrupt } }

    Read the article

  • NSOutlineView not refreshing when objects added to managed object context from NSOperations

    - by John Gallagher
    Background Cocoa app using core data Two processes - daemon and a main UI Daemon constantly writing to a data store UI process reads from same data store NSOutlineView in UI is bound to an NSTreeController which is bound to Application with key path of delegate.interpretedMOC What I want When the UI is activated, the outline view should update with the latest data inserted by the daemon. The Problem Main Thread Approach I fetch all the entities I'm interested in, then iterate over them, doing refreshObject:mergeChanges:YES. This works OK - the items get refreshed correctly. However, this is all running on the main thread, so the UI locks up for 10-20 seconds whilst it refreshes. Fine, so let's move these refreshes to NSOperations that run in the background instead. NSOperation Multithreaded Approach As soon as I move the refreshObject:mergeChanges: call into an NSOperation, the refresh no longer works. When I add logging messages, it's clear that the new objects are loaded in by the NSOperation subclass and refreshed. Not only that, but they are What I've tried I've messed around with this for 2 days solid and tried everything I can think of. Passing objectIDs to the NSOperation to refresh instead of an entity name. Resetting the interpretedMOC at various points - after the data refresh and before the outline view reload. I'd subclassed NSOutlineView. I discarded my subclass and set the view back to being an instance of NSOutlineView, just in case there was any funny goings on here. Added a rearrangeObjects call to the NSTreeController before reloading the NSOutlineView data. Made sure I had set the staleness interval to 0 on all managed object contexts I was using. I've got a feeling this problem is somehow related to caching core data objects in memory. But I've totally exhausted all my ideas on how I get this to work. I'd be eternally grateful of any ideas anyone else has. Code Main Thread Approach // In App Delegate -(void)applicationDidBecomeActive:(NSNotification *)notification { // Delay to allow time for the daemon to save [self performSelector:@selector(refreshTrainingEntriesAndGroups) withObject:nil afterDelay:3]; } -(void)refreshTrainingEntriesAndGroups { NSSet *allTrainingGroups = [[[NSApp delegate] interpretedMOC] fetchAllObjectsForEntityName:kTrainingGroup]; for(JGTrainingGroup *thisTrainingGroup in allTrainingGroups) [interpretedMOC refreshObject:thisTrainingGroup mergeChanges:YES]; NSError *saveError = nil; [interpretedMOC save:&saveError]; [windowController performSelectorOnMainThread:@selector(refreshTrainingView) withObject:nil waitUntilDone:YES]; } // In window controller class -(void)refreshTrainingView { [trainingViewTreeController rearrangeObjects]; // Didn't really expect this to have any effect. And it didn't. [trainingView reloadData]; } NSOperation Multithreaded Approach // In App Delegate -(void)refreshTrainingEntriesAndGroups { JGRefreshEntityOperation *trainingGroupRefresh = [[JGRefreshEntityOperation alloc] initWithEntityName:kTrainingGroup]; NSOperationQueue *refreshQueue = [[NSOperationQueue alloc] init]; [refreshQueue setMaxConcurrentOperationCount:1]; [refreshQueue addOperation:trainingGroupRefresh]; while ([[refreshQueue operations] count] > 0) { [[NSRunLoop currentRunLoop] runUntilDate:[NSDate dateWithTimeIntervalSinceNow:0.05]]; [windowController performSelectorOnMainThread:@selector(refreshTrainingView) withObject:nil waitUntilDone:YES]; } // JGRefreshEntityOperation.m @implementation JGRefreshEntityOperation @synthesize started; @synthesize executing; @synthesize paused; @synthesize finished; -(void)main { [self startOperation]; NSSet *allEntities = [imoc fetchAllObjectsForEntityName:entityName]; for(id thisEntity in allEntities) [imoc refreshObject:thisEntity mergeChanges:YES]; [self finishOperation]; } -(void)startOperation { [self willChangeValueForKey:@"isExecuting"]; [self willChangeValueForKey:@"isStarted"]; [self setStarted:YES]; [self setExecuting:YES]; [self didChangeValueForKey:@"isExecuting"]; [self didChangeValueForKey:@"isStarted"]; imoc = [[NSManagedObjectContext alloc] init]; [imoc setStalenessInterval:0]; [imoc setUndoManager:nil]; [imoc setPersistentStoreCoordinator:[[NSApp delegate] interpretedPSC]]; [[NSNotificationCenter defaultCenter] addObserver:self selector:@selector(mergeChanges:) name:NSManagedObjectContextDidSaveNotification object:imoc]; } -(void)finishOperation { saveError = nil; [imoc save:&saveError]; if (saveError) { NSLog(@"Error saving. %@", saveError); } imoc = nil; [self willChangeValueForKey:@"isExecuting"]; [self willChangeValueForKey:@"isFinished"]; [self setExecuting:NO]; [self setFinished:YES]; [self didChangeValueForKey:@"isExecuting"]; [self didChangeValueForKey:@"isFinished"]; } -(void)mergeChanges:(NSNotification *)notification { NSManagedObjectContext *mainContext = [[NSApp delegate] interpretedMOC]; [mainContext performSelectorOnMainThread:@selector(mergeChangesFromContextDidSaveNotification:) withObject:notification waitUntilDone:YES]; } -(id)initWithEntityName:(NSString *)entityName_ { [super init]; [self setStarted:false]; [self setExecuting:false]; [self setPaused:false]; [self setFinished:false]; [NSThread setThreadPriority:0.0]; entityName = entityName_; return self; } @end // JGRefreshEntityOperation.h @interface JGRefreshEntityOperation : NSOperation { NSString *entityName; NSManagedObjectContext *imoc; NSError *saveError; BOOL started; BOOL executing; BOOL paused; BOOL finished; } @property(readwrite, getter=isStarted) BOOL started; @property(readwrite, getter=isPaused) BOOL paused; @property(readwrite, getter=isExecuting) BOOL executing; @property(readwrite, getter=isFinished) BOOL finished; -(void)startOperation; -(void)finishOperation; -(id)initWithEntityName:(NSString *)entityName_; -(void)mergeChanges:(NSNotification *)notification; @end

    Read the article

  • OSX launchd plist for node forever process

    - by lostintranslation
    I am trying to write a launchd.plist file for my node server. I am using forever to run my node server. I would like the server to start on boot. I would also like to wait for the mongodb launchd plist to run first. I installed mongobb using homebrew and it came with a launchd.plist already. I have executed the following: $ launchctl load ~/Library/LaunchAgents/homebrew.mxcl.mongodb.plist plist for mongodb is: <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd"> <plist version="1.0"> <dict> <key>Label</key> <string>homebrew.mxcl.mongodb</string> <key>ProgramArguments</key> <array> <string>/usr/local/opt/mongodb/mongod</string> <string>run</string> <string>--config</string> <string>/usr/local/etc/mongod.conf</string> </array> <key>RunAtLoad</key> <true/> <key>KeepAlive</key> <false/> <key>WorkingDirectory</key> <string>/usr/local</string> <key>StandardErrorPath</key> <string>/usr/local/var/log/mongodb/output.log</string> <key>StandardOutPath</key> <string>/usr/local/var/log/mongodb/output.log</string> <key>HardResourceLimits</key> <dict> <key>NumberOfFiles</key> <integer>1024</integer> </dict> <key>SoftResourceLimits</key> <dict> <key>NumberOfFiles</key> <integer>1024</integer> </dict> </dict> </plist> If I shutdown the computer and restart mongodb fires up as it should. However my node server is not starting. Any ideas? <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd"> <plist version="1.0"> <dict> <key>KeepAlive</key> <dict> <key>SuccessfulExit</key> <false/> </dict> <key>Label</key> <string>com.test.app</string> <key>ProgramArguments</key> <array> <string>/usr/local/bin/forever</string> <string>-a</string> <string>-l</string> <string>/var/log/app/app.log</string> <string>-e</string> <string>/var/log/app/app_error.log</string> <string>/data/server/app.js</string> </array> <key>RunAtLoad</key> <true/> <key>StartInterval</key> <integer>3600</integer> </dict> </plist> EDIT: writing to log file and I see this: env: node: No such file or directory I think this means that the node binary cannot be found. I can echo $PATH and /usr/local/bin is in my path. I can start node from the terminal. Ideas?

    Read the article

  • What does Ruby have that Python doesn't, and vice versa?

    - by Lennart Regebro
    There is a lot of discussions of Python vs Ruby, and I all find them completely unhelpful, because they all turn around why feature X sucks in language Y, or that claim language Y doesn't have X, although in fact it does. I also know exactly why I prefer Python, but that's also subjective, and wouldn't help anybody choosing, as they might not have the same tastes in development as I do. It would therefore be interesting to list the differences, objectively. So no "Python's lambdas sucks". Instead explain what Ruby's lambdas can do that Python's can't. No subjectivity. Example code is good! Don't have several differences in one answer, please. And vote up the ones you know are correct, and down those you know are incorrect (or are subjective). Also, differences in syntax is not interesting. We know Python does with indentation what Ruby does with brackets and ends, and that @ is called self in Python. UPDATE: This is now a community wiki, so we can add the big differences here. Ruby has a class reference in the class body In Ruby you have a reference to the class (self) already in the class body. In Python you don't have a reference to the class until after the class construction is finished. An example: class Kaka puts self end self in this case is the class, and this code would print out "Kaka". There is no way to print out the class name or in other ways access the class from the class definition body in Python. All classes are mutable in Ruby This lets you develop extensions to core classes. Here's an example of a rails extension: class String def starts_with?(other) head = self[0, other.length] head == other end end Ruby has Perl-like scripting features Ruby has first class regexps, $-variables, the awk/perl line by line input loop and other features that make it more suited to writing small shell scripts that munge text files or act as glue code for other programs. Ruby has first class continuations Thanks to the callcc statement. In Python you can create continuations by various techniques, but there is no support built in to the language. Ruby has blocks With the "do" statement you can create a multi-line anonymous function in Ruby, which will be passed in as an argument into the method in front of do, and called from there. In Python you would instead do this either by passing a method or with generators. Ruby: amethod { |here| many=lines+of+code goes(here) } Python: def function(here): many=lines+of+code goes(here) amethod(function) Interestingly, the convenience statement in Ruby for calling a block is called "yield", which in Python will create a generator. Ruby: def themethod yield 5 end themethod do |foo| puts foo end Python: def themethod(): yield 5 for foo in themethod: print foo Although the principles are different, the result is strikingly similar. Python has built-in generators (which are used like Ruby blocks, as noted above) Python has support for generators in the language. In Ruby you could use the generator module that uses continuations to create a generator from a block. Or, you could just use a block/proc/lambda! Moreover, in Ruby 1.9 Fibers are, and can be used as, generators. docs.python.org has this generator example: def reverse(data): for index in range(len(data)-1, -1, -1): yield data[index] Contrast this with the above block examples. Python has flexible name space handling In Ruby, when you import a file with require, all the things defined in that file will end up in your global namespace. This causes namespace pollution. The solution to that is Rubys modules. But if you create a namespace with a module, then you have to use that namespace to access the contained classes. In Python, the file is a module, and you can import its contained names with from themodule import *, thereby polluting the namespace if you want. But you can also import just selected names with from themodule import aname, another or you can simply import themodule and then access the names with themodule.aname. If you want more levels in your namespace you can have packages, which are directories with modules and an __init__.py file. Python has docstrings Docstrings are strings that are attached to modules, functions and methods and can be introspected at runtime. This helps for creating such things as the help command and automatic documentation. def frobnicate(bar): """frobnicate takes a bar and frobnicates it >>> bar = Bar() >>> bar.is_frobnicated() False >>> frobnicate(bar) >>> bar.is_frobnicated() True """ Python has more libraries Python has a vast amount of available modules and bindings for libraries. Python has multiple inheritance Ruby does not ("on purpose" -- see Ruby's website, see here how it's done in Ruby). It does reuse the module concept as a sort of abstract classes. Python has list/dict comprehensions Python: res = [x*x for x in range(1, 10)] Ruby: res = (0..9).map { |x| x * x } Python: >>> (x*x for x in range(10)) <generator object <genexpr> at 0xb7c1ccd4> >>> list(_) [0, 1, 4, 9, 16, 25, 36, 49, 64, 81] Ruby: p = proc { |x| x * x } (0..9).map(&p) Python: >>> {x:str(y*y) for x,y in {1:2, 3:4}.items()} {1: '4', 3: '16'} Ruby: >> Hash[{1=>2, 3=>4}.map{|x,y| [x,(y*y).to_s]}] => {1=>"4", 3=>"16"} Python has decorators Things similar to decorators can be created in Ruby, and it can also be argued that they aren't as necessary as in Python.

    Read the article

  • How do you control what your C compiler Optimizes?

    - by Jordan S
    I am writing the firmware for an embedded device in C using the Silicon Labs IDE and the SDCC compiler. The device architecture is based on the 8051 family. The function in question is shown below. The function is used to set the ports on my MCU to drive a stepper motor. It gets called in by an interrupt handler. The big switch statement just sets the ports to the proper value for the next motor step. The bottom part of the function looks at an input from a hall effect sensor and a number of steps moved in order to detect if the motor has stalled. The problem is, for some reason the second IF statement that looks like this if (StallDetector > (GapSize + 20)) { HandleStallEvent(); } always seems to get optimized out. If I try to put a breakpoint at the HandleStallEvent() call the IDE gives me a message saying "No Address Correlation to this line number". I am not really good enough at reading assembly to tell what it is doing but I have pasted a snippet from the asm output below. Any help would be much appreciated. void OperateStepper(void) { //static bit LastHomeMagState = HomeSensor; static bit LastPosMagState = PosSensor; if(PulseMotor) { if(MoveDirection == 1) // Go clockwise { switch(STEPPER_POSITION) { case 'A': STEPPER_POSITION = 'B'; P1 = 0xFD; break; case 'B': STEPPER_POSITION = 'C'; P1 = 0xFF; break; case 'C': STEPPER_POSITION = 'D'; P1 = 0xFE; break; case 'D': STEPPER_POSITION = 'A'; P1 = 0xFC; break; default: STEPPER_POSITION = 'A'; P1 = 0xFC; } //end switch } else // Go CounterClockwise { switch(STEPPER_POSITION) { case 'A': STEPPER_POSITION = 'D'; P1 = 0xFE; break; case 'B': STEPPER_POSITION = 'A'; P1 = 0xFC; break; case 'C': STEPPER_POSITION = 'B'; P1 = 0xFD; break; case 'D': STEPPER_POSITION = 'C'; P1 = 0xFF; break; default: STEPPER_POSITION = 'A'; P1 = 0xFE; } //end switch } //end else MotorSteps++; StallDetector++; if(PosSensor != LastPosMagState) { StallDetector = 0; LastPosMagState = PosSensor; } else { if (PosSensor == ON) { if (StallDetector > (MagnetSize + 20)) { HandleStallEvent(); } } else if (PosSensor == OFF) { if (StallDetector > (GapSize + 20)) { HandleStallEvent(); } } } } //end if PulseMotor } ... and the asm output for the the bottom part of this function... ; C:\SiLabs\Optec Programs\HSFW_HID_SDCC_2\MotionControl.c:653: if(PosSensor != LastPosMagState) mov c,_P1_4 jb _OperateStepper_LastPosMagState_1_1,00158$ cpl c 00158$: jc 00126$ C$MotionControl.c$655$3$7 ==. ; C:\SiLabs\Optec Programs\HSFW_HID_SDCC_2\MotionControl.c:655: StallDetector = 0; clr a mov _StallDetector,a mov (_StallDetector + 1),a C$MotionControl.c$657$3$7 ==. ; C:\SiLabs\Optec Programs\HSFW_HID_SDCC_2\MotionControl.c:657: LastPosMagState = PosSensor; mov c,_P1_4 mov _OperateStepper_LastPosMagState_1_1,c ret 00126$: C$MotionControl.c$661$2$8 ==. ; C:\SiLabs\Optec Programs\HSFW_HID_SDCC_2\MotionControl.c:661: if (PosSensor == ON) jb _P1_4,00123$ C$MotionControl.c$663$4$9 ==. ; C:\SiLabs\Optec Programs\HSFW_HID_SDCC_2\MotionControl.c:663: if (StallDetector > (MagnetSize + 20)) mov a,_MagnetSize mov r2,a rlc a subb a,acc mov r3,a mov a,#0x14 add a,r2 mov r2,a clr a addc a,r3 mov r3,a clr c mov a,r2 subb a,_StallDetector mov a,r3 subb a,(_StallDetector + 1) jnc 00130$ C$MotionControl.c$665$5$10 ==. ; C:\SiLabs\Optec Programs\HSFW_HID_SDCC_2\MotionControl.c:665: HandleStallEvent(); ljmp _HandleStallEvent 00123$: C$MotionControl.c$668$2$8 ==. ; C:\SiLabs\Optec Programs\HSFW_HID_SDCC_2\MotionControl.c:668: else if (PosSensor == OFF) jnb _P1_4,00130$ C$MotionControl.c$670$4$11 ==. ; C:\SiLabs\Optec Programs\HSFW_HID_SDCC_2\MotionControl.c:670: if (StallDetector > (GapSize + 20)) mov a,#0x14 add a,_GapSize mov r2,a clr a addc a,(_GapSize + 1) mov r3,a clr c mov a,r2 subb a,_StallDetector mov a,r3 subb a,(_StallDetector + 1) jnc 00130$ C$MotionControl.c$672$5$12 ==. ; C:\SiLabs\Optec Programs\HSFW_HID_SDCC_2\MotionControl.c:672: HandleStallEvent(); C$MotionControl.c$678$2$1 ==. XG$OperateStepper$0$0 ==. ljmp _HandleStallEvent 00130$: ret It looks to me like the compiler is NOT optimizing out this second if statement from the looks of the asm but if that is the case why does the IDE not allow me so set a breakpoint there? Maybe it's just a dumb IDE!

    Read the article

  • "The usage of semaphores is subtly wrong"

    - by Hoonose
    This past semester I was taking an OS practicum in C, in which the first project involved making a threads package, then writing a multiple producer-consumer program to demonstrate the functionality. However, after getting grading feedback, I lost points for "The usage of semaphores is subtly wrong" and "The program assumes preemption (e.g. uses yield to change control)" (We started with a non-preemptive threads package then added preemption later. Note that the comment and example contradict each other. I believe it doesn't assume either, and would work in both environments). This has been bugging me for a long time - the course staff was kind of overwhelmed, so I couldn't ask them what's wrong with this over the semester. I've spent a long time thinking about this and I can't see the issues. If anyone could take a look and point out the error, or reassure me that there actually isn't a problem, I'd really appreciate it. I believe the syntax should be pretty standard in terms of the thread package functions (minithreads and semaphores), but let me know if anything is confusing. #include <stdio.h> #include <stdlib.h> #include "minithread.h" #include "synch.h" #define BUFFER_SIZE 16 #define MAXCOUNT 100 int buffer[BUFFER_SIZE]; int size, head, tail; int count = 1; int out = 0; int toadd = 0; int toremove = 0; semaphore_t empty; semaphore_t full; semaphore_t count_lock; // Semaphore to keep a lock on the // global variables for maintaining the counts /* Method to handle the working of a student * The ID of a student is the corresponding minithread_id */ int student(int total_burgers) { int n, i; semaphore_P(count_lock); while ((out+toremove) < arg) { n = genintrand(BUFFER_SIZE); n = (n <= total_burgers - (out + toremove)) ? n : total_burgers - (out + toremove); printf("Student %d wants to get %d burgers ...\n", minithread_id(), n); toremove += n; semaphore_V(count_lock); for (i=0; i<n; i++) { semaphore_P(empty); out = buffer[tail]; printf("Student %d is taking burger %d.\n", minithread_id(), out); tail = (tail + 1) % BUFFER_SIZE; size--; toremove--; semaphore_V(full); } semaphore_P(count_lock); } semaphore_V(count_lock); printf("Student %d is done.\n", minithread_id()); return 0; } /* Method to handle the working of a cook * The ID of a cook is the corresponding minithread_id */ int cook(int total_burgers) { int n, i; printf("Creating Cook %d\n",minithread_id()); semaphore_P(count_lock); while ((count+toadd) <= arg) { n = genintrand(BUFFER_SIZE); n = (n <= total_burgers - (count + toadd) + 1) ? n : total_burgers - (count + toadd) + 1; printf("Cook %d wants to put %d burgers into the burger stack ...\n", minithread_id(),n); toadd += n; semaphore_V(count_lock); for (i=0; i<n; i++) { semaphore_P(full); printf("Cook %d is putting burger %d into the burger stack.\n", minithread_id(), count); buffer[head] = count++; head = (head + 1) % BUFFER_SIZE; size++; toadd--; semaphore_V(empty); } semaphore_P(count_lock); } semaphore_V(count_lock); printf("Cook %d is done.\n", minithread_id()); return 0; } /* Method to create our multiple producers and consumers * and start their respective threads by fork */ void starter(int* c){ int i; for (i=0;i<c[2];i++){ minithread_fork(cook, c[0]); } for (i=0;i<c[1];i++){ minithread_fork(student, c[0]); } } /* The arguments are passed as command line parameters * argv[1] is the no of students * argv[2] is the no of cooks */ void main(int argc, char *argv[]) { int pass_args[3]; pass_args[0] = MAXCOUNT; pass_args[1] = atoi(argv[1]); pass_args[2] = atoi(argv[2]); size = head = tail = 0; empty = semaphore_create(); semaphore_initialize(empty, 0); full = semaphore_create(); semaphore_initialize(full, BUFFER_SIZE); count_lock = semaphore_create(); semaphore_initialize(count_lock, 1); minithread_system_initialize(starter, pass_args); }

    Read the article

  • Arraylist is null; I cannot access books in the arraylist

    - by user3701380
    I am a beginner-intermediate java programmer and I am getting a null pointer exception from my arraylist. I am writing a bookstore program for APCS and when i add the book, it is supposed to add to the arraylist in the inventory class. But when i call a method to search for a book (e.g. by title), it shows that there isn't anything in the arraylist. //Here is my inventory class -- it has all methods for adding the book or searching for one The searching methods are in getBookByTitle, getBookByAuthor, and getBookByISBN and the method for adding a book is addBook package webbazonab; //Inventory Class //Bharath Senthil //Ansh Sikka import java.util.ArrayList; public class Inventory{ private ArrayList<Book> allBooks = new ArrayList<Book>(); private String bookTitles; private String bookAuthors; private String bookPrices; private String bookCopies; private String ISBNs; public Inventory() { } //@param double price, int copies, String bookTitle, String Author, String isbnNumber public void addBooks(Book addedBook){ allBooks.add(addedBook); } public boolean isAvailable(){ for(Book myBook : allBooks){ if(myBook.copiesLeft() == 0) return false; } return true; } public String populateTitle(){ for (Book titleBooks : allBooks){ bookTitles = titleBooks.getTitle() + "\n"; return bookTitles; } return bookTitles; } public String populateAuthor(){ for(Book authorBooks : allBooks){ bookAuthors = authorBooks.getAuthor() + "\n"; return bookAuthors; } return bookAuthors; } public String populatePrice(){ for (Book pricedBooks : allBooks){ bookPrices = String.valueOf(pricedBooks.getPrice()) + "\n"; } return "$" + bookPrices; } /** * * @return */ public String populateCopies(){ for (Book amtBooks : allBooks){ bookCopies = String.valueOf(amtBooks.copiesLeft()) + "\n"; return bookCopies; } return bookCopies; } public String populateISBN(){ for (Book isbnNums : allBooks){ ISBNs = isbnNums.getIsbn() + "\n"; return ISBNs; } return ISBNs; } @SuppressWarnings("empty-statement") public Book getBookByTitle(String titleSearch) { for(Book titleBook : allBooks) { if (titleBook.getTitle().equals(titleSearch)) { return titleBook; } } return null; } public Book getBookByISBN(String isbnSearch){ for(Book isbnBookSearches : allBooks){ if(isbnBookSearches.getIsbn().equals(isbnSearch)){ return isbnBookSearches; } } return null; } public Book getBookByAuthor(String authorSearch){ for(Book authorBookSearches : allBooks){ if(authorBookSearches.getAuthor().equals(authorSearch)){ return authorBookSearches; } } return null; } public void sort(){ for(int i = 0; i < allBooks.size(); i++) { for(int k = 0; k < allBooks.size(); k++) { if(((Book) allBooks.get(i)).getIsbn().compareTo(((Book) allBooks.get(k)).getIsbn()) < 1) { Book temp = (Book) allBooks.get(k); allBooks.set(k, allBooks.get(i)); allBooks.set(i, temp); } else if(((Book) allBooks.get(i)).getIsbn().compareTo(((Book) allBooks.get(k)).getIsbn()) > 1) { Book temp = (Book) allBooks.get(i); allBooks.set(i, allBooks.get(k)); allBooks.set(k, temp); } } } } public ArrayList<Book> getBooks(){ return allBooks; } } //The exception occurs when i call the method here (in another class): Inventory lib = new Inventory(); jTextField12.setText(lib.getBookByAuthor(authorSearch).getTitle()); Here is my book class if you need it package webbazonab; //Webbazon AB //Project By: Ansh Sikka and Bharath Senthil public class Book { private double myPrice; private String myTitle; private String bookAuthor; private String isbn; private int myCopies; public Book(double price, int copies, String bookTitle, String Author, String isbnNumber) { myPrice = price; myCopies = copies; myTitle = bookTitle; bookAuthor = Author; isbn = isbnNumber; } public double getPrice() { return myPrice; } public String getIsbn() { return isbn; } public String getTitle() { return myTitle; } public String getAuthor() { return bookAuthor; } public int copiesLeft(){ return myCopies; } public String notFound(){ return "The book you searched for could not be found!"; } public String toString() { return "Title: " + getTitle() + "\nAuthor: " + getAuthor() + "\nNumber of Available Books: " + copiesLeft() + "\nPrice: $" + getPrice(); } } Thanks!

    Read the article

  • Problem measuring N times the execution time of a code block

    - by Nazgulled
    EDIT: I just found my problem after writing this long post explaining every little detail... If someone can give me a good answer on what I'm doing wrong and how can I get the execution time in seconds (using a float with 5 decimal places or so), I'll mark that as accepted. Hint: The problem was on how I interpreted the clock_getttime() man page. Hi, Let's say I have a function named myOperation that I need to measure the execution time of. To measure it, I'm using clock_gettime() as it was recommend here in one of the comments. My teacher recommends us to measure it N times so we can get an average, standard deviation and median for the final report. He also recommends us to execute myOperation M times instead of just one. If myOperation is a very fast operation, measuring it M times allow us to get a sense of the "real time" it takes; cause the clock being used might not have the required precision to measure such operation. So, execution myOperation only one time or M times really depends if the operation itself takes long enough for the clock precision we are using. I'm having trouble dealing with that M times execution. Increasing M decreases (a lot) the final average value. Which doesn't make sense to me. It's like this, on average you take 3 to 5 seconds to travel from point A to B. But then you go from A to B and back to A 5 times (which makes it 10 times, cause A to B is the same as B to A) and you measure that. Than you divide by 10, the average you get is supposed to be the same average you take traveling from point A to B, which is 3 to 5 seconds. This is what I want my code to do, but it's not working. If I keep increasing the number of times I go from A to B and back A, the average will be lower and lower each time, it makes no sense to me. Enough theory, here's my code: #include <stdio.h> #include <time.h> #define MEASUREMENTS 1 #define OPERATIONS 1 typedef struct timespec TimeClock; TimeClock diffTimeClock(TimeClock start, TimeClock end) { TimeClock aux; if((end.tv_nsec - start.tv_nsec) < 0) { aux.tv_sec = end.tv_sec - start.tv_sec - 1; aux.tv_nsec = 1E9 + end.tv_nsec - start.tv_nsec; } else { aux.tv_sec = end.tv_sec - start.tv_sec; aux.tv_nsec = end.tv_nsec - start.tv_nsec; } return aux; } int main(void) { TimeClock sTime, eTime, dTime; int i, j; for(i = 0; i < MEASUREMENTS; i++) { printf(" » MEASURE %02d\n", i+1); clock_gettime(CLOCK_REALTIME, &sTime); for(j = 0; j < OPERATIONS; j++) { myOperation(); } clock_gettime(CLOCK_REALTIME, &eTime); dTime = diffTimeClock(sTime, eTime); printf(" - NSEC (TOTAL): %ld\n", dTime.tv_nsec); printf(" - NSEC (OP): %ld\n\n", dTime.tv_nsec / OPERATIONS); } return 0; } Notes: The above diffTimeClock function is from this blog post. I replaced my real operation with myOperation() because it doesn't make any sense to post my real functions as I would have to post long blocks of code, you can easily code a myOperation() with whatever you like to compile the code if you wish. As you can see, OPERATIONS = 1 and the results are: » MEASURE 01 - NSEC (TOTAL): 27456580 - NSEC (OP): 27456580 For OPERATIONS = 100 the results are: » MEASURE 01 - NSEC (TOTAL): 218929736 - NSEC (OP): 2189297 For OPERATIONS = 1000 the results are: » MEASURE 01 - NSEC (TOTAL): 862834890 - NSEC (OP): 862834 For OPERATIONS = 10000 the results are: » MEASURE 01 - NSEC (TOTAL): 574133641 - NSEC (OP): 57413 Now, I'm not a math wiz, far from it actually, but this doesn't make any sense to me whatsoever. I've already talked about this with a friend that's on this project with me and he also can't understand the differences. I don't understand why the value is getting lower and lower when I increase OPERATIONS. The operation itself should take the same time (on average of course, not the exact same time), no matter how many times I execute it. You could tell me that that actually depends on the operation itself, the data being read and that some data could already be in the cache and bla bla, but I don't think that's the problem. In my case, myOperation is reading 5000 lines of text from an CSV file, separating the values by ; and inserting those values into a data structure. For each iteration, I'm destroying the data structure and initializing it again. Now that I think of it, I also that think that there's a problem measuring time with clock_gettime(), maybe I'm not using it right. I mean, look at the last example, where OPERATIONS = 10000. The total time it took was 574133641ns, which would be roughly 0,5s; that's impossible, it took a couple of minutes as I couldn't stand looking at the screen waiting and went to eat something.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • adjust selected File to FileFilter in a JFileChooser

    - by amarillion
    I'm writing a diagram editor in java. This app has the option to export to various standard image formats such as .jpg, .png etc. When the user clicks File-Export, you get a JFileChooser which has a number of FileFilters in it, for .jpg, .png etc. Now here is my question: Is there a way to have the extension of the default adjust to the selected file filter? E.g. if the document is named "lolcat" then the default option should be "lolcat.png" when the png filter is selected, and when the user selects the jpg file filter, the default should change to "lolcat.jpg" automatically. Is this possible? How can I do it? edit: Based on the answer below, I wrote some code. But it doesn't quite work yet. I've added a propertyChangeListener to the FILE_FILTER_CHANGED_PROPERTY, but it seems that within this method getSelectedFile() returns null. Here is the code. package nl.helixsoft; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.beans.PropertyChangeEvent; import java.beans.PropertyChangeListener; import java.io.File; import java.util.ArrayList; import java.util.List; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.filechooser.FileFilter; public class JFileChooserTest { public class SimpleFileFilter extends FileFilter { private String desc; private List<String> extensions; private boolean showDirectories; /** * @param name example: "Data files" * @param glob example: "*.txt|*.csv" */ public SimpleFileFilter (String name, String globs) { extensions = new ArrayList<String>(); for (String glob : globs.split("\\|")) { if (!glob.startsWith("*.")) throw new IllegalArgumentException("expected list of globs like \"*.txt|*.csv\""); // cut off "*" // store only lower case (make comparison case insensitive) extensions.add (glob.substring(1).toLowerCase()); } desc = name + " (" + globs + ")"; } public SimpleFileFilter(String name, String globs, boolean showDirectories) { this(name, globs); this.showDirectories = showDirectories; } @Override public boolean accept(File file) { if(showDirectories && file.isDirectory()) { return true; } String fileName = file.toString().toLowerCase(); for (String extension : extensions) { if (fileName.endsWith (extension)) { return true; } } return false; } @Override public String getDescription() { return desc; } /** * @return includes '.' */ public String getFirstExtension() { return extensions.get(0); } } void export() { String documentTitle = "lolcat"; final JFileChooser jfc = new JFileChooser(); jfc.setDialogTitle("Export"); jfc.setDialogType(JFileChooser.SAVE_DIALOG); jfc.setSelectedFile(new File (documentTitle)); jfc.addChoosableFileFilter(new SimpleFileFilter("JPEG", "*.jpg")); jfc.addChoosableFileFilter(new SimpleFileFilter("PNG", "*.png")); jfc.addPropertyChangeListener(JFileChooser.FILE_FILTER_CHANGED_PROPERTY, new PropertyChangeListener() { public void propertyChange(PropertyChangeEvent arg0) { System.out.println ("Property changed"); String extold = null; String extnew = null; if (arg0.getOldValue() == null || !(arg0.getOldValue() instanceof SimpleFileFilter)) return; if (arg0.getNewValue() == null || !(arg0.getNewValue() instanceof SimpleFileFilter)) return; SimpleFileFilter oldValue = ((SimpleFileFilter)arg0.getOldValue()); SimpleFileFilter newValue = ((SimpleFileFilter)arg0.getNewValue()); extold = oldValue.getFirstExtension(); extnew = newValue.getFirstExtension(); String filename = "" + jfc.getSelectedFile(); System.out.println ("file: " + filename + " old: " + extold + ", new: " + extnew); if (filename.endsWith(extold)) { filename.replace(extold, extnew); } else { filename += extnew; } jfc.setSelectedFile(new File (filename)); } }); jfc.showDialog(frame, "export"); } JFrame frame; void run() { frame = new JFrame(); JButton btn = new JButton ("export"); frame.add (btn); btn.addActionListener (new ActionListener() { public void actionPerformed(ActionEvent ae) { export(); } }); frame.setSize (300, 300); frame.pack(); frame.setVisible(true); } public static void main(String[] args) { javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { JFileChooserTest x = new JFileChooserTest(); x.run(); } }); } }

    Read the article

  • Add child to scene from within a class.

    - by Fecal Brunch
    Hi, I'm new to flash in general and have been writing a program with two classes that extend MovieClip (Stems and Star). I need to create a new Stems object as a child of the scene when the user stops dragging a Star object, but do not know how to reference the scene from within the Star class's code. I've tried passing the scene into the constructor of the Star and doing sometihng like: this.scene.addChild (new Stems ()); But apparently that's not how to do it... Below is the code for Stems and Stars, any advice would be appreciated greatly. package { import flash.display.MovieClip; import flash.events.*; import flash.utils.Timer; public class Stems extends MovieClip { public const centreX=1026/2; public const centreY=600/2; public var isFlowing:Boolean; public var flowerType:Number; public const outerLimit=210; public const innerLimit=100; public function Stems(fType:Number) { this.isFlowing=false; this.scaleX=this.scaleY= .0007* distanceFromCentre(this.x, this.y); this.setXY(); trace(distanceFromCentre(this.x, this.y)); if (fType==2) { gotoAndStop("Aplant"); } } public function distanceFromCentre(X:Number, Y:Number):int { return (Math.sqrt((X-centreX)*(X-centreX)+(Y-centreY)*(Y-centreY))); } public function rotateAwayFromCentre():void { var theX:int=centreX-this.x; var theY:int = (centreY - this.y) * -1; var angle = Math.atan(theY/theX)/(Math.PI/180); if (theX<0) { angle+=180; } if (theX>=0&&theY<0) { angle+=360; } this.rotation = ((angle*-1) + 90)+180; } public function setXY() { do { var tempX=Math.random()*centreX*2; var tempY=Math.random()*centreY*2; } while (distanceFromCentre (tempX, tempY)>this.outerLimit || distanceFromCentre (tempX, tempY)<this.innerLimit); this.x=tempX; this.y=tempY; rotateAwayFromCentre(); } public function getFlowerType():Number { return this.flowerType; } } } package { import flash.display.MovieClip; import flash.events.*; import flash.utils.Timer; public class Star extends MovieClip { public const sWide=1026; public const sTall=600; public var startingX:Number; public var startingY:Number; public var starColor:Number; public var flicker:Timer; public var canUpdatePos:Boolean=true; public const innerLimit=280; public function Star(color:Number, basefl:Number, factorial:Number) { this.setXY(); this.starColor=color; this.flicker = new Timer (basefl + factorial * (Math.ceil(100* Math.random ()))); this.flicker.addEventListener(TimerEvent.TIMER, this.tick); this.addEventListener(MouseEvent.MOUSE_OVER, this.hover); this.addEventListener(MouseEvent.MOUSE_UP, this.drop); this.addEventListener(MouseEvent.MOUSE_DOWN, this.drag); this.addChild (new Stems (2)); this.flicker.start(); this.updateAnimation(0, false); } public function distanceOK(X:Number, Y:Number):Boolean { if (Math.sqrt((X-(sWide/2))*(X-(sWide/2))+(Y-(sTall/2))*(Y-(sTall/2)))>innerLimit) { return true; } else { return false; } } public function setXY() { do { var tempX=this.x=Math.random()*sWide; var tempY=this.y=Math.random()*sTall; } while (distanceOK (tempX, tempY)==false); this.startingX=tempX; this.startingY=tempY; } public function tick(event:TimerEvent) { if (this.canUpdatePos) { this.setXY(); } this.updateAnimation(0, false); this.updateAnimation(this.starColor, false); } public function updateAnimation(color:Number, bright:Boolean) { var brightStr:String; if (bright) { brightStr="bright"; } else { brightStr="low"; } switch (color) { case 0 : this.gotoAndStop("none"); break; case 1 : this.gotoAndStop("N" + brightStr); break; case 2 : this.gotoAndStop("A" + brightStr); break; case 3 : this.gotoAndStop("F" + brightStr); break; case 4 : this.gotoAndStop("E" + brightStr); break; case 5 : this.gotoAndStop("S" + brightStr); break; } } public function hover(event:MouseEvent):void { this.updateAnimation(this.starColor, true); this.canUpdatePos=false; } public function drop(event:MouseEvent):void { this.stopDrag(); this.x=this.startingX; this.y=this.startingY; this.updateAnimation(0, false); this.canUpdatePos=true; } public function drag(event:MouseEvent):void { this.startDrag(false); this.canUpdatePos=false; } } }

    Read the article

  • Cobol: science and fiction

    - by user847
    There are a few threads about the relevance of the Cobol programming language on this forum, e.g. this thread links to a collection of them. What I am interested in here is a frequently repeated claim based on a study by Gartner from 1997: that there were around 200 billion lines of code in active use at that time! I would like to ask some questions to verify or falsify a couple of related points. My goal is to understand if this statement has any truth to it or if it is totally unrealistic. I apologize in advance for being a little verbose in presenting my line of thought and my own opinion on the things I am not sure about, but I think it might help to put things in context and thus highlight any wrong assumptions and conclusions I have made. Sometimes, the "200 billion lines" number is accompanied by the added claim that this corresponded to 80% of all programming code in any language in active use. Other times, the 80% merely refer to so-called "business code" (or some other vague phrase hinting that the reader is not to count mainstream software, embedded systems or anything else where Cobol is practically non-existent). In the following I assume that the code does not include double-counting of multiple installations of the same software (since that is cheating!). In particular in the time prior to the y2k problem, it has been noted that a lot of Cobol code is already 20 to 30 years old. That would mean it was written in the late 60ies and 70ies. At that time, the market leader was IBM with the IBM/370 mainframe. IBM has put up a historical announcement on his website quoting prices and availability. According to the sheet, prices are about one million dollars for machines with up to half a megabyte of memory. Question 1: How many mainframes have actually been sold? I have not found any numbers for those times; the latest numbers are for the year 2000, again by Gartner. :^( I would guess that the actual number is in the hundreds or the low thousands; if the market size was 50 billion in 2000 and the market has grown exponentially like any other technology, it might have been merely a few billions back in 1970. Since the IBM/370 was sold for twenty years, twenty times a few thousand will result in a couple of ten-thousands of machines (and that is pretty optimistic)! Question 2: How large were the programs in lines of code? I don't know how many bytes of machine code result from one line of source code on that architecture. But since the IBM/370 was a 32-bit machine, any address access must have used 4 bytes plus instruction (2, maybe 3 bytes for that?). If you count in operating system and data for the program, how many lines of code would have fit into the main memory of half a megabyte? Question 3: Was there no standard software? Did every single machine sold run a unique hand-coded system without any standard software? Seriously, even if every machine was programmed from scratch without any reuse of legacy code (wait ... didn't that violate one of the claims we started from to begin with???) we might have O(50,000 l.o.c./machine) * O(20,000 machines) = O(1,000,000,000 l.o.c.). That is still far, far, far away from 200 billion! Am I missing something obvious here? Question 4: How many programmers did we need to write 200 billion lines of code? I am really not sure about this one, but if we take an average of 10 l.o.c. per day, we would need 55 million man-years to achieve this! In the time-frame of 20 to 30 years this would mean that there must have existed two to three million programmers constantly writing, testing, debugging and documenting code. That would be about as many programmers as we have in China today, wouldn't it? Question 5: What about the competition? So far, I have come up with two things here: 1) IBM had their own programming language, PL/I. Above I have assumed that the majority of code has been written exclusively using Cobol. However, all other things being equal I wonder if IBM marketing had really pushed their own development off the market in favor of Cobol on their machines. Was there really no relevant code base of PL/I? 2) Sometimes (also on this board in the thread quoted above) I come across the claim that the "200 billion lines of code" are simply invisible to anybody outside of "governments, banks ..." (and whatnot). Actually, the DoD had funded their own language in order to increase cost effectiveness and reduce the proliferation of programming language. This lead to their use of Ada. Would they really worry about having so many different programming languages if they had predominantly used Cobol? If there was any language running on "government and military" systems outside the perception of mainstream computing, wouldn't that language be Ada? I hope someone can point out any flaws in my assumptions and/or conclusions and shed some light on whether the above claim has any truth to it or not.

    Read the article

  • Exception - Illegal Block size during decryption(Android)

    - by Vamsi
    I am writing an application which encrypts and decrypts the user notes based on the user set password. i used the following algorithms for encryption/decryption 1. PBEWithSHA256And256BitAES-CBC-BC 2. PBEWithMD5And128BitAES-CBC-OpenSSL e_Cipher = Cipher.getInstance(PBEWithSHA256And256BitAES-CBC-BC); d_Cipher = Cipher.getInstance(PBEWithSHA256And256BitAES-CBC-BC); e_Cipher.init() d_Cipher.init() encryption is working well, but when trying to decrypt it gives Exception - Illegal Block size after encryption i am converting the cipherText to HEX and storing it in a sqlite database. i am retrieving correct values from the sqlite database during decyption but when calling d_Cipher.dofinal() it throws the Exception. I thought i missed to specify the padding and tried to check what are the other available cipher algorithms but i was unable to found. so request you to please give the some knowledge on what are the cipher algorithms and padding that are supported by Android? if the algorithm which i used can be used for padding, how should i specify the padding mechanism? I am pretty new to Encryption so tried a couple of algorithms which are available in BouncyCastle.java but unsuccessful. As requested here is the code public class CryptoHelper { private static final String TAG = "CryptoHelper"; //private static final String PBEWithSHA256And256BitAES = "PBEWithSHA256And256BitAES-CBC-BC"; //private static final String PBEWithSHA256And256BitAES = "PBEWithMD5And128BitAES-CBC-OpenSSL"; private static final String PBEWithSHA256And256BitAES = "PBEWithMD5And128BitAES-CBC-OpenSSLPBEWITHSHA1AND3-KEYTRIPLEDES-CB"; private static final String randomAlgorithm = "SHA1PRNG"; public static final int SALT_LENGTH = 8; public static final int SALT_GEN_ITER_COUNT = 20; private final static String HEX = "0123456789ABCDEF"; private Cipher e_Cipher; private Cipher d_Cipher; private SecretKey secretKey; private byte salt[]; public CryptoHelper(String password) throws InvalidKeyException, NoSuchAlgorithmException, NoSuchPaddingException, InvalidAlgorithmParameterException, InvalidKeySpecException { char[] cPassword = password.toCharArray(); PBEKeySpec pbeKeySpec = new PBEKeySpec(cPassword); PBEParameterSpec pbeParamSpec = new PBEParameterSpec(salt, SALT_GEN_ITER_COUNT); SecretKeyFactory keyFac = SecretKeyFactory.getInstance(PBEWithSHA256And256BitAES); secretKey = keyFac.generateSecret(pbeKeySpec); SecureRandom saltGen = SecureRandom.getInstance(randomAlgorithm); this.salt = new byte[SALT_LENGTH]; saltGen.nextBytes(this.salt); e_Cipher = Cipher.getInstance(PBEWithSHA256And256BitAES); d_Cipher = Cipher.getInstance(PBEWithSHA256And256BitAES); e_Cipher.init(Cipher.ENCRYPT_MODE, secretKey, pbeParamSpec); d_Cipher.init(Cipher.DECRYPT_MODE, secretKey, pbeParamSpec); } public String encrypt(String cleartext) throws IllegalBlockSizeException, BadPaddingException { byte[] encrypted = e_Cipher.doFinal(cleartext.getBytes()); return convertByteArrayToHex(encrypted); } public String decrypt(String cipherString) throws IllegalBlockSizeException { byte[] plainText = decrypt(convertStringtobyte(cipherString)); return(new String(plainText)); } public byte[] decrypt(byte[] ciphertext) throws IllegalBlockSizeException { byte[] retVal = {(byte)0x00}; try { retVal = d_Cipher.doFinal(ciphertext); } catch (BadPaddingException e) { Log.e(TAG, e.toString()); } return retVal; } public String convertByteArrayToHex(byte[] buf) { if (buf == null) return ""; StringBuffer result = new StringBuffer(2*buf.length); for (int i = 0; i < buf.length; i++) { appendHex(result, buf[i]); } return result.toString(); } private static void appendHex(StringBuffer sb, byte b) { sb.append(HEX.charAt((b>>4)&0x0f)).append(HEX.charAt(b&0x0f)); } private static byte[] convertStringtobyte(String hexString) { int len = hexString.length()/2; byte[] result = new byte[len]; for (int i = 0; i < len; i++) { result[i] = Integer.valueOf(hexString.substring(2*i, 2*i+2), 16).byteValue(); } return result; } public byte[] getSalt() { return salt; } public SecretKey getSecretKey() { return secretKey; } public static SecretKey createSecretKey(char[] password) throws NoSuchAlgorithmException, InvalidKeySpecException { PBEKeySpec pbeKeySpec = new PBEKeySpec(password); SecretKeyFactory keyFac = SecretKeyFactory.getInstance(PBEWithSHA256And256BitAES); return keyFac.generateSecret(pbeKeySpec); } } I will call mCryptoHelper.decrypt(String str) then this results in Illegal block size exception My Env: Android 1.6 on Eclipse

    Read the article

  • Access Violation

    - by Justin
    I've been learning how to NOP functions in C++ or even C but there are very few tutorials online about it. I've been googling for the past few hours now and I'm just stuck. Here is my code. #include <iostream> #include <windows.h> #include <tlhelp32.h> using namespace std; //#define NOP 0x90 byte NOP[] = {0x90}; void enableDebugPrivileges() { HANDLE hcurrent=GetCurrentProcess(); HANDLE hToken; BOOL bret=OpenProcessToken(hcurrent,40,&hToken); LUID luid; bret=LookupPrivilegeValue(NULL,"SeDebugPrivilege",&luid); TOKEN_PRIVILEGES NewState,PreviousState; DWORD ReturnLength; NewState.PrivilegeCount =1; NewState.Privileges[0].Luid =luid; NewState.Privileges[0].Attributes=2; AdjustTokenPrivileges(hToken,FALSE,&NewState,28,&PreviousState,&ReturnLength); } DWORD GetProcId(char* ProcName) { PROCESSENTRY32 pe32; HANDLE hSnapshot = NULL; pe32.dwSize = sizeof( PROCESSENTRY32 ); hSnapshot = CreateToolhelp32Snapshot( TH32CS_SNAPPROCESS, 0 ); if( Process32First( hSnapshot, &pe32 ) ) { do{ if( strcmp( pe32.szExeFile, ProcName ) == 0 ) break; }while( Process32Next( hSnapshot, &pe32 ) ); } if( hSnapshot != INVALID_HANDLE_VALUE ) CloseHandle( hSnapshot ); return pe32.th32ProcessID; } void WriteMem(DWORD Address, void* Value, size_t Size) { DWORD Protect = NULL; VirtualProtect((LPVOID)Address, 3, PAGE_READWRITE, &Protect); memcpy((void*)Address, Value, 3); VirtualProtect((LPVOID)Address, 3, Protect, &Protect); } void nop_(PVOID address, int bytes){ DWORD d, ds; VirtualProtect(address, bytes, PAGE_EXECUTE_READWRITE, &d); memset(address, 144, bytes); VirtualProtect(address,bytes,d,&ds); } void MemCopy(HANDLE pHandle, void* Dest, const void* Src, int Len) { DWORD OldProtect; DWORD OldProtect2; VirtualProtect(Dest, Len, PAGE_EXECUTE_READWRITE, &OldProtect); memcpy(Dest, Src, Len); VirtualProtect(Dest, Len, OldProtect, &OldProtect2); FlushInstructionCache(pHandle, Dest, Len); } int main() { enableDebugPrivileges(); DWORD pid; HANDLE phandle; // Obtain the process ID pid = GetProcId("gr.exe"); if(GetLastError()) { cout << "Error_PID_: " << GetLastError() << endl; system("pause"); return -1; } // Obtain the process handle phandle = OpenProcess(PROCESS_ALL_ACCESS,0,pid); if(GetLastError()) { cout << "Error_HANDLE_: " << GetLastError() << endl; system("pause"); return -1; } // Debug info, 0 = bad cout <<"pid : " << pid << endl; cout <<"HANDLE: " << phandle << endl << endl; system("pause"); // Change value to short iValue = -1; int choice = 0; BYTE * bGodMode = (BYTE *) (0x409A7E); // Lives Address bool hack = true; while(hack) { system("cls"); cout << "What hack?\n0. Exit\n1. Lives\n\n!> "; cin >> choice; switch(choice) { case 0: { hack=false; break; } case 1: // Modify Time cout << "God Mode On\n!> "; // cin >> iValue; // nop_((PVOID)(0x409A7E), 3); // MemCopy(phandle, (PVOID)0x409A7E, &NOP, 1); WriteMem((DWORD)(0x00409A7E), (void*)NOP, sizeof NOP); if(GetLastError()) { cout << "Error: " << GetLastError() << endl; system("pause"); } break; default: cout << "ERROR!\n"; break; } Sleep(100); } system("pause"); return 0; } This is suppose to NOP the DEC function that is 3 bytes long preventing me from losing lives. However each time I try it, it crashes the hack and says I had a access violation. I tried to look up the reasons and most of them dealt with with the size of the location I'm writing to and what I'm copying from. Otherwise, I have absolutely no idea. Any help would be nice. The game is GunRoar and the base address "0x409A7E" is where the DEC function is.

    Read the article

  • Why are my Opteron cores running at only 75% capacity each? (25% CPU idle)

    - by Tim Cooper
    We've just taken delivery of a powerful 32-core AMD Opteron server with 128Gb. We have 2 x 6272 CPU's with 16 cores each. We are running a big long-running java task on 30 threads. We have the NUMA optimisations for Linux and java turned on. Our Java threads are mainly using objects that are private to that thread, sometimes reading memory that other threads will be reading, and very very occasionally writing or locking shared objects. We can't explain why the CPU cores are 25% idle. Below is a dump of "top": top - 23:06:38 up 1 day, 23 min, 3 users, load average: 10.84, 10.27, 9.62 Tasks: 676 total, 1 running, 675 sleeping, 0 stopped, 0 zombie Cpu(s): 64.5%us, 1.3%sy, 0.0%ni, 32.9%id, 1.3%wa, 0.0%hi, 0.0%si, 0.0%st Mem: 132138168k total, 131652664k used, 485504k free, 92340k buffers Swap: 5701624k total, 230252k used, 5471372k free, 13444344k cached ... top - 22:37:39 up 23:54, 3 users, load average: 7.83, 8.70, 9.27 Tasks: 678 total, 1 running, 677 sleeping, 0 stopped, 0 zombie Cpu0 : 75.8%us, 2.0%sy, 0.0%ni, 22.2%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu1 : 77.2%us, 1.3%sy, 0.0%ni, 21.5%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu2 : 77.3%us, 1.0%sy, 0.0%ni, 21.7%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu3 : 77.8%us, 1.0%sy, 0.0%ni, 21.2%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu4 : 76.9%us, 2.0%sy, 0.0%ni, 21.1%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu5 : 76.3%us, 2.0%sy, 0.0%ni, 21.7%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu6 : 12.6%us, 3.0%sy, 0.0%ni, 84.4%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu7 : 8.6%us, 2.0%sy, 0.0%ni, 89.4%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu8 : 77.0%us, 2.0%sy, 0.0%ni, 21.1%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu9 : 77.0%us, 2.0%sy, 0.0%ni, 21.1%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu10 : 77.6%us, 1.7%sy, 0.0%ni, 20.8%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu11 : 75.7%us, 2.0%sy, 0.0%ni, 21.4%id, 1.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu12 : 76.6%us, 2.3%sy, 0.0%ni, 21.1%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu13 : 76.6%us, 2.3%sy, 0.0%ni, 21.1%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu14 : 76.2%us, 2.6%sy, 0.0%ni, 15.9%id, 5.3%wa, 0.0%hi, 0.0%si, 0.0%st Cpu15 : 76.6%us, 2.0%sy, 0.0%ni, 21.5%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu16 : 73.6%us, 2.6%sy, 0.0%ni, 23.8%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu17 : 74.5%us, 2.3%sy, 0.0%ni, 23.2%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu18 : 73.9%us, 2.3%sy, 0.0%ni, 23.8%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu19 : 72.9%us, 2.6%sy, 0.0%ni, 24.4%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu20 : 72.8%us, 2.6%sy, 0.0%ni, 24.5%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu21 : 72.7%us, 2.3%sy, 0.0%ni, 25.0%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu22 : 72.5%us, 2.6%sy, 0.0%ni, 24.8%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu23 : 73.0%us, 2.3%sy, 0.0%ni, 24.7%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu24 : 74.7%us, 2.7%sy, 0.0%ni, 22.7%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu25 : 74.5%us, 2.6%sy, 0.0%ni, 22.8%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu26 : 73.7%us, 2.0%sy, 0.0%ni, 24.3%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu27 : 74.1%us, 2.3%sy, 0.0%ni, 23.6%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu28 : 74.1%us, 2.3%sy, 0.0%ni, 23.6%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu29 : 74.0%us, 2.0%sy, 0.0%ni, 24.0%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu30 : 73.2%us, 2.3%sy, 0.0%ni, 24.5%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu31 : 73.1%us, 2.0%sy, 0.0%ni, 24.9%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Mem: 132138168k total, 131711704k used, 426464k free, 88336k buffers Swap: 5701624k total, 229572k used, 5472052k free, 13745596k cached PID USER PR NI VIRT RES SHR S %CPU %MEM TIME+ COMMAND 13865 root 20 0 122g 112g 3.1g S 2334.3 89.6 20726:49 java 27139 jayen 20 0 15428 1728 952 S 2.6 0.0 0:04.21 top 27161 sysadmin 20 0 15428 1712 940 R 1.0 0.0 0:00.28 top 33 root 20 0 0 0 0 S 0.3 0.0 0:06.24 ksoftirqd/7 131 root 20 0 0 0 0 S 0.3 0.0 0:09.52 events/0 1858 root 20 0 0 0 0 S 0.3 0.0 1:35.14 kondemand/0 A dump of the java stack confirms that none of the threads are anywhere near the few places where locks are used, nor are they anywhere near any disk or network i/o. I had trouble finding a clear explanation of what 'top' means by "idle" versus "wait", but I get the impression that "idle" means "no more threads that need to be run" but this doesn't make sense in our case. We're using a "Executors.newFixedThreadPool(30)". There are a large number of tasks pending and each task lasts for 10 seconds or so. I suspect that the explanation requires a good understanding of NUMA. Is the "idle" state what you see when a CPU is waiting for a non-local access? If not, then what is the explanation?

    Read the article

  • Is there any better way for creating a dynamic HTML table without using any javascript library like

    - by piemesons
    Dont worry we dont need to find out any bug in this code.. Its working perfectly.:-P My boss came to me and said "Hey just tell me whats the best of way of writing code for a dynamic HTML table (add row, delete row, update row).No need to add any CSS. Just javascript. No Jquery library etc. I was confused that in the middle of the project why he asking for some stupid exercise like this. What ever i wrote the following code and mailed him and after 15 mins i got a mail from him. " I was expecting much better code from a guy like you. Anyways good job monkey.(And with a picture of monkey as attachment.) thats was the mail. Line by line. I want to reply him but before that i want to know about the quality of my code. Is this really shitty...!!! Or he was just making fun of mine. I dont think that code is really shitty. Still correct me if you can.Code is working perfectly fine. Just copy paste it in a HTML file. <html> <head> <title> Exercise CSS </title> <script type="text/javascript"> function add_row() { var table = document.getElementById('table'); var rowCount = table.rows.length; var row = table.insertRow(rowCount); var cell1 = row.insertCell(0); var element1 = document.createElement("input"); element1.type = "text"; cell1.appendChild(element1); var cell2 = row.insertCell(1); var element2 = document.createElement("input"); element2.type = "text"; cell2.appendChild(element2); var cell3 = row.insertCell(2); cell3.innerHTML = ' <span onClick="edit(this)">Edit</span>/<span onClick="delete_row(this)">Delete</span>'; cell3.setAttribute("style", "display:none;"); var cell4 = row.insertCell(3); cell4.innerHTML = '<span onClick="save(this)">Save</span>'; } function save(e) { var elTableCells = e.parentNode.parentNode.getElementsByTagName("td"); elTableCells[0].innerHTML=elTableCells[0].firstChild.value; elTableCells[1].innerHTML=elTableCells[1].firstChild.value; elTableCells[2].setAttribute("style", "display:block;"); elTableCells[3].setAttribute("style", "display:none;"); } function edit(e) { var elTableCells = e.parentNode.parentNode.getElementsByTagName("td"); elTableCells[0].innerHTML='<input type="text" value="'+elTableCells[0].innerHTML+'">'; elTableCells[1].innerHTML='<input type="text" value="'+elTableCells[1].innerHTML+'">'; elTableCells[2].setAttribute("style", "display:none;"); elTableCells[3].setAttribute("style", "display:block;"); } function delete_row(e) { e.parentNode.parentNode.parentNode.removeChild(e.parentNode.parentNode); } </script> </head> <body > <div id="display"> <table id='table'> <tr id='id'> <td> Piemesons </td> <td> 23 </td> <td > <span onClick="edit(this)">Edit</span>/<span onClick="delete_row(this)">Delete</span> </td> <td style="display:none;"> <span onClick="save(this)">Save</span> </td> </tr> </table> <input type="button" value="Add new row" onClick="add_row();" /> </div> </body>

    Read the article

  • XML over HTTP with JMS and Spring

    - by Will Sumekar
    I have a legacy HTTP server where I need to send an XML file over HTTP request (POST) using Java (not browser) and the server will respond with another XML in its HTTP response. It is similar to Web Service but there's no WSDL and I have to follow the existing XML structure to construct my XML to be sent. I have done a research and found an example that matches my requirement here. The example uses HttpClient from Apache Commons. (There are also other examples I found but they use java.net networking package (like URLConnection) which is tedious so I don't want to use them). But it's also my requirement to use Spring and JMS. I know from Spring's reference that it's possible to combine HttpClient, JMS and Spring. My question is, how? Note that it's NOT in my requirement to use HttpClient. If you have a better suggestion, I'm welcome. Appreciate it. For your reference, here's the XML-over-HTTP example I've been talking about: /* * $Header: * $Revision$ * $Date$ * ==================================================================== * * Copyright 2002-2004 The Apache Software Foundation * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. * ==================================================================== * * This software consists of voluntary contributions made by many * individuals on behalf of the Apache Software Foundation. For more * information on the Apache Software Foundation, please see * <http://www.apache.org/>. * * [Additional notices, if required by prior licensing conditions] * */ import java.io.File; import java.io.FileInputStream; import org.apache.commons.httpclient.HttpClient; import org.apache.commons.httpclient.methods.InputStreamRequestEntity; import org.apache.commons.httpclient.methods.PostMethod; /** * * This is a sample application that demonstrates * how to use the Jakarta HttpClient API. * * This application sends an XML document * to a remote web server using HTTP POST * * @author Sean C. Sullivan * @author Ortwin Glück * @author Oleg Kalnichevski */ public class PostXML { /** * * Usage: * java PostXML http://mywebserver:80/ c:\foo.xml * * @param args command line arguments * Argument 0 is a URL to a web server * Argument 1 is a local filename * */ public static void main(String[] args) throws Exception { if (args.length != 2) { System.out.println( "Usage: java -classpath <classpath> [-Dorg.apache.commons."+ "logging.simplelog.defaultlog=<loglevel>]" + " PostXML <url> <filename>]"); System.out.println("<classpath> - must contain the "+ "commons-httpclient.jar and commons-logging.jar"); System.out.println("<loglevel> - one of error, "+ "warn, info, debug, trace"); System.out.println("<url> - the URL to post the file to"); System.out.println("<filename> - file to post to the URL"); System.out.println(); System.exit(1); } // Get target URL String strURL = args[0]; // Get file to be posted String strXMLFilename = args[1]; File input = new File(strXMLFilename); // Prepare HTTP post PostMethod post = new PostMethod(strURL); // Request content will be retrieved directly // from the input stream // Per default, the request content needs to be buffered // in order to determine its length. // Request body buffering can be avoided when // content length is explicitly specified post.setRequestEntity(new InputStreamRequestEntity( new FileInputStream(input), input.length())); // Specify content type and encoding // If content encoding is not explicitly specified // ISO-8859-1 is assumed post.setRequestHeader( "Content-type", "text/xml; charset=ISO-8859-1"); // Get HTTP client HttpClient httpclient = new HttpClient(); // Execute request try { int result = httpclient.executeMethod(post); // Display status code System.out.println("Response status code: " + result); // Display response System.out.println("Response body: "); System.out.println(post.getResponseBodyAsString()); } finally { // Release current connection to the connection pool // once you are done post.releaseConnection(); } } }

    Read the article

  • Embedding mercurial revision information in Visual Studio c# projects automatically

    - by Mark Booth
    Original Problem In building our projects, I want the mercurial id of each repository to be embedded within the product(s) of that repository (the library, application or test application). I find it makes it so much easier to debug an application ebing run by custiomers 8 timezones away if you know precisely what went into building the particular version of the application they are using. As such, every project (application or library) in our systems implement a way of getting at the associated revision information. I also find it very useful to be able to see if an application has been compiled with clean (un-modified) changesets from the repository. 'Hg id' usefully appends a + to the changeset id when there are uncommitted changes in a repository, so this allows is to easily see if people are running a clean or a modified version of the code. My current solution is detailed below, and fulfills the basic requirements, but there are a number of problems with it. Current Solution At the moment, to each and every Visual Studio solution, I add the following "Pre-build event command line" commands: cd $(ProjectDir) HgID I also add an HgID.bat file to the Project directory: @echo off type HgId.pre > HgId.cs For /F "delims=" %%a in ('hg id') Do <nul >>HgID.cs set /p = @"%%a" echo ; >> HgId.cs echo } >> HgId.cs echo } >> HgId.cs along with an HgId.pre file, which is defined as: namespace My.Namespace { /// <summary> Auto generated Mercurial ID class. </summary> internal class HgID { /// <summary> Mercurial version ID [+ is modified] [Named branch]</summary> public const string Version = When I build my application, the pre-build event is triggered on all libraries, creating a new HgId.cs file (which is not kept under revision control) and causing the library to be re-compiled with with the new 'hg id' string in 'Version'. Problems with the current solution The main problem is that since the HgId.cs is re-created at each pre-build, every time we need to compile anything, all projects in the current solution are re-compiled. Since we want to be able to easily debug into our libraries, we usually keep many libraries referenced in our main application solution. This can result in build times which are significantly longer than I would like. Ideally I would like the libraries to compile only if the contents of the HgId.cs file has actually changed, as opposed to having been re-created with exactly the same contents. The second problem with this method is it's dependence on specific behaviour of the windows shell. I've already had to modify the batch file several times, since the original worked under XP but not Vista, the next version worked under Vista but not XP and finally I managed to make it work with both. Whether it will work with Windows 7 however is anyones guess and as time goes on, I see it more likely that contractors will expect to be able to build our apps on their Windows 7 boxen. Finally, I have an aesthetic problem with this solution, batch files and bodged together template files feel like the wrong way to do this. My actual questions How would you solve/how are you solving the problem I'm trying to solve? What better options are out there than what I'm currently doing? Rejected Solutions to these problems Before I implemented the current solution, I looked at Mercurials Keyword extension, since it seemed like the obvious solution. However the more I looked at it and read peoples opinions, the more that I came to the conclusion that it wasn't the right thing to do. I also remember the problems that keyword substitution has caused me in projects at previous companies (just the thought of ever having to use Source Safe again fills me with a feeling of dread *8'). Also, I don't particularly want to have to enable Mercurial extensions to get the build to complete. I want the solution to be self contained, so that it isn't easy for the application to be accidentally compiled without the embedded version information just because an extension isn't enabled or the right helper software hasn't been installed. I also thought of writing this in a better scripting language, one where I would only write HgId.cs file if the content had actually changed, but all of the options I could think of would require my co-workers, contractors and possibly customers to have to install software they might not otherwise want (for example cygwin). Any other options people can think of would be appreciated. Update Partial solution Having played around with it for a while, I've managed to get the HgId.bat file to only overwrite the HgId.cs file if it changes: @echo off type HgId.pre > HgId.cst For /F "delims=" %%a in ('hg id') Do <nul >>HgId.cst set /p = @"%%a" echo ; >> HgId.cst echo } >> HgId.cst echo } >> HgId.cst fc HgId.cs HgId.cst >NUL if %errorlevel%==0 goto :ok copy HgId.cst HgId.cs :ok del HgId.cst Problems with this solution Even though HgId.cs is no longer being re-created every time, Visual Studio still insists on compiling everything every time. I've tried looking for solutions and tried checking "Only build startup projects and dependencies on Run" in Tools|Options|Projects and Solutions|Build and Run but it makes no difference. The second problem also remains, and now I have no way to test if it will work with Vista, since that contractor is no longer with us. If anyone can test this batch file on a Windows 7 and/or Vista box, I would appreciate hearing how it went. Finally, my aesthetic problem with this solution, is even strnger than it was before, since the batch file is more complex and this there is now more to go wrong. If you can think of any better solution, I would love to hear about them.

    Read the article

  • Unknown error in Producer/Consumer program, believe it to be an infinite loop.

    - by ray2k
    Hello, I am writing a program that is solving the producer/consumer problem, specifically the bounded-buffer version(i believe they mean the same thing). The producer will be generating x number of random numbers, where x is a command line parameter to my program. At the current moment, I believe my program is entering an infinite loop, but I'm not sure why it is occurring. I believe I am executing the semaphores correctly. You compile it like this: gcc -o prodcon prodcon.cpp -lpthread -lrt Then to run, ./prodcon 100(the number of randum nums to produce) This is my code. typedef int buffer_item; #include <stdlib.h> #include <stdio.h> #include <pthread.h> #include <semaphore.h> #include <unistd.h> #define BUFF_SIZE 10 #define RAND_DIVISOR 100000000 #define TRUE 1 //two threads void *Producer(void *param); void *Consumer(void *param); int insert_item(buffer_item item); int remove_item(buffer_item *item); int returnRandom(); //the global semaphores sem_t empty, full, mutex; //the buffer buffer_item buf[BUFF_SIZE]; //buffer counter int counter; //number of random numbers to produce int numRand; int main(int argc, char** argv) { /* thread ids and attributes */ pthread_t pid, cid; pthread_attr_t attr; pthread_attr_init(&attr); pthread_attr_setscope(&attr, PTHREAD_SCOPE_SYSTEM); numRand = atoi(argv[1]); sem_init(&empty,0,BUFF_SIZE); sem_init(&full,0,0); sem_init(&mutex,0,0); printf("main started\n"); pthread_create(&pid, &attr, Producer, NULL); pthread_create(&cid, &attr, Consumer, NULL); printf("main gets here"); pthread_join(pid, NULL); pthread_join(cid, NULL); printf("main done\n"); return 0; } //generates a randum number between 1 and 100 int returnRandom() { int num; srand(time(NULL)); num = rand() % 100 + 1; return num; } //begin producing items void *Producer(void *param) { buffer_item item; int i; for(i = 0; i < numRand; i++) { //sleep for a random period of time int rNum = rand() / RAND_DIVISOR; sleep(rNum); //generate a random number item = returnRandom(); //acquire the empty lock sem_wait(&empty); //acquire the mutex lock sem_wait(&mutex); if(insert_item(item)) { fprintf(stderr, " Producer report error condition\n"); } else { printf("producer produced %d\n", item); } /* release the mutex lock */ sem_post(&mutex); /* signal full */ sem_post(&full); } return NULL; } /* Consumer Thread */ void *Consumer(void *param) { buffer_item item; int i; for(i = 0; i < numRand; i++) { /* sleep for a random period of time */ int rNum = rand() / RAND_DIVISOR; sleep(rNum); /* aquire the full lock */ sem_wait(&full); /* aquire the mutex lock */ sem_wait(&mutex); if(remove_item(&item)) { fprintf(stderr, "Consumer report error condition\n"); } else { printf("consumer consumed %d\n", item); } /* release the mutex lock */ sem_post(&mutex); /* signal empty */ sem_post(&empty); } return NULL; } /* Add an item to the buffer */ int insert_item(buffer_item item) { /* When the buffer is not full add the item and increment the counter*/ if(counter < BUFF_SIZE) { buf[counter] = item; counter++; return 0; } else { /* Error the buffer is full */ return -1; } } /* Remove an item from the buffer */ int remove_item(buffer_item *item) { /* When the buffer is not empty remove the item and decrement the counter */ if(counter > 0) { *item = buf[(counter-1)]; counter--; return 0; } else { /* Error buffer empty */ return -1; } }

    Read the article

  • What's wrong with Bundler working with RubyGems to push a Git repo to Heroku?

    - by stanigator
    I've made sure that all the files are in the root of the repository as recommended in this discussion. However, as I follow the instructions in this section of the book, I can't get through the section without the problems. What do you think is happening with my system that's causing the error? I have no clue at the moment of what the problem means despite reading the following in the log. Thanks in advance for your help! stanley@ubuntu:~/rails_sample/first_app$ git push heroku master Warning: Permanently added the RSA host key for IP address '50.19.85.156' to the list of known hosts. Counting objects: 96, done. Compressing objects: 100% (79/79), done. Writing objects: 100% (96/96), 28.81 KiB, done. Total 96 (delta 22), reused 0 (delta 0) -----> Heroku receiving push -----> Ruby/Rails app detected -----> Installing dependencies using Bundler version 1.2.0.pre Running: bundle install --without development:test --path vendor/bundle --binstubs bin/ --deployment Fetching gem metadata from https://rubygems.org/....... Installing rake (0.9.2.2) Installing i18n (0.6.0) Installing multi_json (1.3.5) Installing activesupport (3.2.3) Installing builder (3.0.0) Installing activemodel (3.2.3) Installing erubis (2.7.0) Installing journey (1.0.3) Installing rack (1.4.1) Installing rack-cache (1.2) Installing rack-test (0.6.1) Installing hike (1.2.1) Installing tilt (1.3.3) Installing sprockets (2.1.3) Installing actionpack (3.2.3) Installing mime-types (1.18) Installing polyglot (0.3.3) Installing treetop (1.4.10) Installing mail (2.4.4) Installing actionmailer (3.2.3) Installing arel (3.0.2) Installing tzinfo (0.3.33) Installing activerecord (3.2.3) Installing activeresource (3.2.3) Installing coffee-script-source (1.3.3) Installing execjs (1.3.2) Installing coffee-script (2.2.0) Installing rack-ssl (1.3.2) Installing json (1.7.3) with native extensions Installing rdoc (3.12) Installing thor (0.14.6) Installing railties (3.2.3) Installing coffee-rails (3.2.2) Installing jquery-rails (2.0.2) Using bundler (1.2.0.pre) Installing rails (3.2.3) Installing sass (3.1.18) Installing sass-rails (3.2.5) Installing sqlite3 (1.3.6) with native extensions Gem::Installer::ExtensionBuildError: ERROR: Failed to build gem native extension. /usr/local/bin/ruby extconf.rb checking for sqlite3.h... no sqlite3.h is missing. Try 'port install sqlite3 +universal' or 'yum install sqlite-devel' and check your shared library search path (the location where your sqlite3 shared library is located). *** extconf.rb failed *** Could not create Makefile due to some reason, probably lack of necessary libraries and/or headers. Check the mkmf.log file for more details. You may need configuration options. Provided configuration options: --with-opt-dir --without-opt-dir --with-opt-include --without-opt-include=${opt-dir}/include --with-opt-lib --without-opt-lib=${opt-dir}/lib --with-make-prog --without-make-prog --srcdir=. --curdir --ruby=/usr/local/bin/ruby --with-sqlite3-dir --without-sqlite3-dir --with-sqlite3-include --without-sqlite3-include=${sqlite3-dir}/include --with-sqlite3-lib --without-sqlite3-lib=${sqlite3-dir}/lib --enable-local --disable-local Gem files will remain installed in /tmp/build_3tplrxvj7qa81/vendor/bundle/ruby/1.9.1/gems/sqlite3-1.3.6 for inspection. Results logged to /tmp/build_3tplrxvj7qa81/vendor/bundle/ruby/1.9.1/gems/sqlite3-1.3.6/ext/sqlite3/gem_make.out An error occurred while installing sqlite3 (1.3.6), and Bundler cannot continue. Make sure that `gem install sqlite3 -v '1.3.6'` succeeds before bundling. ! ! Failed to install gems via Bundler. ! ! Heroku push rejected, failed to compile Ruby/rails app To [email protected]:growing-mountain-2788.git ! [remote rejected] master -> master (pre-receive hook declined) error: failed to push some refs to '[email protected]:growing-mountain-2788.git' ------Gemfile------------------------ As requested, here's the auto-generated gemfile: source 'https://rubygems.org' gem 'rails', '3.2.3' # Bundle edge Rails instead: # gem 'rails', :git => 'git://github.com/rails/rails.git' gem 'sqlite3' gem 'json' # Gems used only for assets and not required # in production environments by default. group :assets do gem 'sass-rails', '~> 3.2.3' gem 'coffee-rails', '~> 3.2.1' # See https://github.com/sstephenson/execjs#readme for more supported runtimes # gem 'therubyracer', :platform => :ruby gem 'uglifier', '>= 1.0.3' end gem 'jquery-rails' # To use ActiveModel has_secure_password # gem 'bcrypt-ruby', '~> 3.0.0' # To use Jbuilder templates for JSON # gem 'jbuilder' # Use unicorn as the app server # gem 'unicorn' # Deploy with Capistrano # gem 'capistrano' # To use debugger # gem 'ruby-debug'

    Read the article

  • libcurl - unable to download a file

    - by marmistrz
    I'm working on a program which will download lyrics from sites like AZLyrics. I'm using libcurl. It's my code lyricsDownloader.cpp #include "lyricsDownloader.h" #include <curl/curl.h> #include <cstring> #include <iostream> #define DEBUG 1 ///////////////////////////////////////////////////////////////////////////// size_t lyricsDownloader::write_data_to_var(char *ptr, size_t size, size_t nmemb, void *userdata) // this function is a static member function { ostringstream * stream = (ostringstream*) userdata; size_t count = size * nmemb; stream->write(ptr, count); return count; } string AZLyricsDownloader::toProviderCode() const { /*this creates an url*/ } CURLcode AZLyricsDownloader::download() { CURL * handle; CURLcode err; ostringstream buff; handle = curl_easy_init(); if (! handle) return static_cast<CURLcode>(-1); // set verbose if debug on curl_easy_setopt( handle, CURLOPT_VERBOSE, DEBUG ); curl_easy_setopt( handle, CURLOPT_URL, toProviderCode().c_str() ); // set the download url to the generated one curl_easy_setopt(handle, CURLOPT_WRITEDATA, &buff); curl_easy_setopt(handle, CURLOPT_WRITEFUNCTION, &AZLyricsDownloader::write_data_to_var); err = curl_easy_perform(handle); // The segfault should be somewhere here - after calling the function but before it ends cerr << "cleanup\n"; curl_easy_cleanup(handle); // copy the contents to text variable lyrics = buff.str(); return err; } main.cpp #include <QString> #include <QTextEdit> #include <iostream> #include "lyricsDownloader.h" int main(int argc, char *argv[]) { AZLyricsDownloader dl(argv[1], argv[2]); dl.perform(); QTextEdit qtexted(QString::fromStdString(dl.lyrics)); cout << qPrintable(qtexted.toPlainText()); return 0; } When running ./maelyrica Anthrax Madhouse I'm getting this logged from curl * About to connect() to azlyrics.com port 80 (#0) * Trying 174.142.163.250... * connected * Connected to azlyrics.com (174.142.163.250) port 80 (#0) > GET /lyrics/anthrax/madhouse.html HTTP/1.1 Host: azlyrics.com Accept: */* < HTTP/1.1 301 Moved Permanently < Server: nginx/1.0.12 < Date: Thu, 05 Jul 2012 16:59:21 GMT < Content-Type: text/html < Content-Length: 185 < Connection: keep-alive < Location: http://www.azlyrics.com/lyrics/anthrax/madhouse.html < Segmentation fault Strangely, the file is there. The same error is displayed when there's no such page (redirect to azlyrics.com mainpage) What am I doing wrong? Thanks in advance EDIT: I made the function for writing data static, but this changes nothing. Even wget seems to have problems $ wget http://www.azlyrics.com/lyrics/anthrax/madhouse.html --2012-07-06 10:36:05-- http://www.azlyrics.com/lyrics/anthrax/madhouse.html Resolving www.azlyrics.com... 174.142.163.250 Connecting to www.azlyrics.com|174.142.163.250|:80... connected. HTTP request sent, awaiting response... No data received. Retrying. Why does opening the page in a browser work and wget/curl not? EDIT2: After adding this: curl_easy_setopt(handle, CURLOPT_FOLLOWLOCATION, 1); The log is: * About to connect() to azlyrics.com port 80 (#0) * Trying 174.142.163.250... * connected * Connected to azlyrics.com (174.142.163.250) port 80 (#0) > GET /lyrics/anthrax/madhouse.html HTTP/1.1 Host: azlyrics.com Accept: */* < HTTP/1.1 301 Moved Permanently < Server: nginx/1.0.12 < Date: Fri, 06 Jul 2012 09:09:47 GMT < Content-Type: text/html < Content-Length: 185 < Connection: keep-alive < Location: http://www.azlyrics.com/lyrics/anthrax/madhouse.html < * Ignoring the response-body * Connection #0 to host azlyrics.com left intact * Issue another request to this URL: 'http://www.azlyrics.com/lyrics/anthrax/madhouse.html' * About to connect() to www.azlyrics.com port 80 (#1) * Trying 174.142.163.250... * connected * Connected to www.azlyrics.com (174.142.163.250) port 80 (#1) > GET /lyrics/anthrax/madhouse.html HTTP/1.1 Host: www.azlyrics.com Accept: */* < HTTP/1.1 200 OK < Server: nginx/1.0.12 < Date: Fri, 06 Jul 2012 09:09:47 GMT < Content-Type: text/html < Transfer-Encoding: chunked < Connection: keep-alive < Segmentation fault

    Read the article

  • How to compare a memory bits in C++?

    - by Trunet
    Hi, I need help with a memory bit comparison function. I bought a LED Matrix here with 4 x HT1632C chips and I'm using it on my arduino mega2560. There're no code available for this chipset(it's not the same as HT1632) and I'm writing on my own. I have a plot function that get x,y coordinates and a color and that pixel turn on. Only this is working perfectly. But I need more performance on my display so I tried to make a shadowRam variable that is a "copy" of my device memory. Before I plot anything on display it checks on shadowRam to see if it's really necessary to change that pixel. When I enabled this(getShadowRam) on plot function my display has some, just SOME(like 3 or 4 on entire display) ghost pixels(pixels that is not supposed to be turned on). If I just comment the prev_color if's on my plot function it works perfectly. Also, I'm cleaning my shadowRam array setting all matrix to zero. variables: #define BLACK 0 #define GREEN 1 #define RED 2 #define ORANGE 3 #define CHIP_MAX 8 byte shadowRam[63][CHIP_MAX-1] = {0}; getShadowRam function: byte HT1632C::getShadowRam(byte x, byte y) { byte addr, bitval, nChip; if (x>=32) { nChip = 3 + x/16 + (y>7?2:0); } else { nChip = 1 + x/16 + (y>7?2:0); } bitval = 8>>(y&3); x = x % 16; y = y % 8; addr = (x<<1) + (y>>2); if ((shadowRam[addr][nChip-1] & bitval) && (shadowRam[addr+32][nChip-1] & bitval)) { return ORANGE; } else if (shadowRam[addr][nChip-1] & bitval) { return GREEN; } else if (shadowRam[addr+32][nChip-1] & bitval) { return RED; } else { return BLACK; } } plot function: void HT1632C::plot (int x, int y, int color) { if (x<0 || x>X_MAX || y<0 || y>Y_MAX) return; if (color != BLACK && color != GREEN && color != RED && color != ORANGE) return; char addr, bitval; byte nChip; byte prev_color = HT1632C::getShadowRam(x,y); bitval = 8>>(y&3); if (x>=32) { nChip = 3 + x/16 + (y>7?2:0); } else { nChip = 1 + x/16 + (y>7?2:0); } x = x % 16; y = y % 8; addr = (x<<1) + (y>>2); switch(color) { case BLACK: if (prev_color != BLACK) { // compare with memory to only set if pixel is other color // clear the bit in both planes; shadowRam[addr][nChip-1] &= ~bitval; HT1632C::sendData(nChip, addr, shadowRam[addr][nChip-1]); shadowRam[addr+32][nChip-1] &= ~bitval; HT1632C::sendData(nChip, addr+32, shadowRam[addr+32][nChip-1]); } break; case GREEN: if (prev_color != GREEN) { // compare with memory to only set if pixel is other color // set the bit in the green plane and clear the bit in the red plane; shadowRam[addr][nChip-1] |= bitval; HT1632C::sendData(nChip, addr, shadowRam[addr][nChip-1]); shadowRam[addr+32][nChip-1] &= ~bitval; HT1632C::sendData(nChip, addr+32, shadowRam[addr+32][nChip-1]); } break; case RED: if (prev_color != RED) { // compare with memory to only set if pixel is other color // clear the bit in green plane and set the bit in the red plane; shadowRam[addr][nChip-1] &= ~bitval; HT1632C::sendData(nChip, addr, shadowRam[addr][nChip-1]); shadowRam[addr+32][nChip-1] |= bitval; HT1632C::sendData(nChip, addr+32, shadowRam[addr+32][nChip-1]); } break; case ORANGE: if (prev_color != ORANGE) { // compare with memory to only set if pixel is other color // set the bit in both the green and red planes; shadowRam[addr][nChip-1] |= bitval; HT1632C::sendData(nChip, addr, shadowRam[addr][nChip-1]); shadowRam[addr+32][nChip-1] |= bitval; HT1632C::sendData(nChip, addr+32, shadowRam[addr+32][nChip-1]); } break; } } If helps: The datasheet of board I'm using. On page 7 has the memory mapping I'm using. Also, I have a video of display working.

    Read the article

  • Something like a manual refresh is needed angularjs, and a $digest() iterations error

    - by Tony Ennis
    (post edited again, new comments follow this line) I'm changing the title of this posting since it was misleading - I was trying to fix a symptom. I was unable to figure out why the code was breaking with a $digest() iterations error. A plunk of my code worked fine. I was totally stuck, so I decided to make my code a little more Angular-like. One anti-pattern I had implemented was to hide my model behind my controller by adding getters/setters to the controller. I tore all that out and instead put the model into the $scope since I had read that was proper Angular. To my surprise, the $digest() iterations error went away. I do not exactly know why and I do not have the intestinal fortitude to put the old code back and figure it out. I surmise that by involving the controller in the get/put of the data I added a dependency under the hood. I do not understand it. edit #2 ends here. (post edited, see EDIT below) I was working through my first Error: 10 $digest() iterations reached. Aborting! error today. I solved it this way: <div ng-init="lineItems = ctrl.getLineItems()"> <tr ng-repeat="r in lineItems"> <td>{{r.text}}</td> <td>...</td> <td>{{r.price | currency}}</td> </tr </div> Now a new issue has arisen - the line items I'm producing can be modified by another control on the page. It's a text box for a promo code. The promo code adds a discount to the lineItem array. It would show up if I could ng-repeat over ctrl.getLineItems(). Since the ng-repeat is looking at a static variable, not the actual model, it doesn't see that the real line items have changed and thus the promotional discount doesn't get displayed until I refresh the browser. Here's the HTML for the promo code: <input type="text" name="promo" ng-model="ctrl.promoCode"/> <button ng-click="ctrl.applyPromoCode()">apply promo code</button> The input tag is writing the value to the model. The bg-click in the button is invoking a function that will apply the code. This could change the data behind the lineItems. I have been advised to use $scope.apply(...). However, since this is applied as a matter of course by ng-click is isn't going to do anything. Indeed, if I add it to ctrl.applyPromoCode(), I get an error since an .apply() is already in progress. I'm at a loss. EDIT The issue above is probably the result of me fixing of symptom, not a problem. Here is the original HTML that was dying with the 10 $digest() iterations error. <table> <tr ng-repeat="r in ctrl.getLineItems()"> <td>{{r.text}}</td> <td>...</td> <td>{{r.price | currency}}</td> </tr> </table> The ctrl.getLineItems() function doesn't do much but invoke a model. I decided to keep the model out of the HTML as much as I could. this.getLineItems = function() { var total = 0; this.lineItems = []; this.lineItems.push({text:"Your quilt will be "+sizes[this.size].block_size+" squares", price:sizes[this.size].price}); total = sizes[this.size].price; this.lineItems.push({text: threads[this.thread].narrative, price:threads[this.thread].price}); total = total + threads[this.thread].price; if (this.sashing) { this.lineItems.push({text:"Add sashing", price: this.getSashingPrice()}); total = total + sizes[this.size].sashing; } else { this.lineItems.push({text:"No sashing", price:0}); } if(isNaN(this.promo)) { this.lineItems.push({text:"No promo code", price:0}); } else { this.lineItems.push({text:"Promo code", price: promos[this.promo].price}); total = total + promos[this.promo].price; } this.lineItems.push({text:"Shipping", price:this.shipping}); total = total + this.shipping; this.lineItems.push({text:"Order Total", price:total}); return this.lineItems; }; And the model code assembled an array of objects based upon the items selected. I'll abbreviate the class as it croaks as long as the array has a row. function OrderModel() { this.lineItems = []; // Result of the lineItems call ... this.getLineItems = function() { var total = 0; this.lineItems = []; ... this.lineItems.push({text:"Order Total", price:total}); return this.lineItems; }; }

    Read the article

  • compile time if && return string reference optimization

    - by Truncheon
    Hi. I'm writing a series classes that inherit from a base class using virtual. They are INT, FLOAT and STRING objects that I want to use in a scripting language. I'm trying to implement weak typing, but I don't want STRING objects to return copies of themselves when used in the following way (instead I would prefer to have a reference returned which can be used in copying): a = "hello "; b = "world"; c = a + b; I have written the following code as a mock example: #include <iostream> #include <string> #include <cstdio> #include <cstdlib> std::string dummy("<int object cannot return string reference>"); struct BaseImpl { virtual bool is_string() = 0; virtual int get_int() = 0; virtual std::string get_string_copy() = 0; virtual std::string const& get_string_ref() = 0; }; struct INT : BaseImpl { int value; INT(int i = 0) : value(i) { std::cout << "constructor called\n"; } INT(BaseImpl& that) : value(that.get_int()) { std::cout << "copy constructor called\n"; } bool is_string() { return false; } int get_int() { return value; } std::string get_string_copy() { char buf[33]; sprintf(buf, "%i", value); return buf; } std::string const& get_string_ref() { return dummy; } }; struct STRING : BaseImpl { std::string value; STRING(std::string s = "") : value(s) { std::cout << "constructor called\n"; } STRING(BaseImpl& that) { if (that.is_string()) value = that.get_string_ref(); else value = that.get_string_copy(); std::cout << "copy constructor called\n"; } bool is_string() { return true; } int get_int() { return atoi(value.c_str()); } std::string get_string_copy() { return value; } std::string const& get_string_ref() { return value; } }; struct Base { BaseImpl* impl; Base(BaseImpl* p = 0) : impl(p) {} ~Base() { delete impl; } }; int main() { Base b1(new INT(1)); Base b2(new STRING("Hello world")); Base b3(new INT(*b1.impl)); Base b4(new STRING(*b2.impl)); std::cout << "\n"; std::cout << b1.impl->get_int() << "\n"; std::cout << b2.impl->get_int() << "\n"; std::cout << b3.impl->get_int() << "\n"; std::cout << b4.impl->get_int() << "\n"; std::cout << "\n"; std::cout << b1.impl->get_string_ref() << "\n"; std::cout << b2.impl->get_string_ref() << "\n"; std::cout << b3.impl->get_string_ref() << "\n"; std::cout << b4.impl->get_string_ref() << "\n"; std::cout << "\n"; std::cout << b1.impl->get_string_copy() << "\n"; std::cout << b2.impl->get_string_copy() << "\n"; std::cout << b3.impl->get_string_copy() << "\n"; std::cout << b4.impl->get_string_copy() << "\n"; return 0; } It was necessary to add an if check in the STRING class to determine whether its safe to request a reference instead of a copy: Script code: a = "test"; b = a; c = 1; d = "" + c; /* not safe to request reference by standard */ C++ code: STRING(BaseImpl& that) { if (that.is_string()) value = that.get_string_ref(); else value = that.get_string_copy(); std::cout << "copy constructor called\n"; } If was hoping there's a way of moving that if check into compile time, rather than run time.

    Read the article

  • .NET SerialPort.Read skipps bytes

    - by Lukas Rieger
    Solution Reading the data byte wise via "port.ReadByte" is too slow, the problem is inside the SerialPort class. i changed it to reading bigger chunks via "port.Read" and there are now no buffer overruns. although i found the solution myself, writing it down helped me and maybe someone else has the same problem and finds this via google... (how can i mark it as answered?) EDIT 2 by setting port.ReadBufferSize = 2000000; i can delay the problem for ~30 seconds. so it seems, .Net really is too slow... since my application is not that critical, i just set the buffer to 20MB, but i am still interested in the cause. EDIT i just tested something i had not thought of before (shame on me): port.ErrorReceived += (object self, SerialErrorReceivedEventArgs se_arg) => { Console.Write("| Error: {0} | ", System.Enum.GetName(se_arg.EventType.GetType(), se_arg.EventType)); }; and it seems that i have an overrun. Is the .Net implementation too slow for 500k or is there an error on my side? Original Question i built a very primitive oszilloscope (avr, which sends adc data over uart to an ftdi chip). On the pc side i have a WPF Programm that displays this data. The Protokoll is: two sync bytes (0xaffe) - 14 data bytes - two sync bytes - 14 data bytes - ... i use 16bit values, so inside the 14 data bytes are 7 channels (lsb first). I verified the uC Firmware with hTerm, and it does send and receive everything correct. But, if i try to read the data with C#, sometimes some bytes are lost. The oszilloscop programm is a mess, but i created a small sample application, which has the same symptoms. I added two extension methods to a) read one byte from the COM Port and ignore -1 (EOF) and b) wait for the sync pattern. The sample programm first syncs onto the data stream by waiting for (0xaffe) and then compares the received bytes with the expected values. the loop runs a few times until an assert failed message pops up. I could not find anything about lost bytes via google, any help would be appreciated. Code using System; using System.Collections.Generic; using System.Diagnostics; using System.IO.Ports; using System.Linq; using System.Text; using System.Threading.Tasks; namespace SerialTest { public static class SerialPortExtensions { public static byte ReadByteSerial(this SerialPort port) { int i = 0; do { i = port.ReadByte(); } while (i < 0 || i > 0xff); return (byte)i; } public static void WaitForPattern_Ushort(this SerialPort port, ushort pattern) { byte hi = 0; byte lo = 0; do { lo = hi; hi = port.ReadByteSerial(); } while (!(hi == (pattern >> 8) && lo == (pattern & 0x00ff))); } } class Program { static void Main(string[] args) { //500000 8n1 SerialPort port = new SerialPort("COM3", 500000, Parity.None, 8, StopBits.One); port.Open(); port.DiscardInBuffer(); port.DiscardOutBuffer(); //Sync port.WaitForPattern_Ushort(0xaffe); byte hi = 0; byte lo = 0; int val; int n = 0; // Start Loop, the stream is already synced while (true) { //Read 7 16-bit values (=14 Bytes) for (int i = 0; i < 7; i++) { lo = port.ReadByteSerial(); hi = port.ReadByteSerial(); val = ((hi << 8) | lo); Debug.Assert(val != 0xaffe); } //Read two sync bytes lo = port.ReadByteSerial(); hi = port.ReadByteSerial(); val = ((hi << 8) | lo); Debug.Assert(val == 0xaffe); n++; } } } }

    Read the article

< Previous Page | 466 467 468 469 470 471 472 473 474 475 476 477  | Next Page >