Search Results

Search found 34094 results on 1364 pages for 'open authentication'.

Page 473/1364 | < Previous Page | 469 470 471 472 473 474 475 476 477 478 479 480  | Next Page >

  • How to limit results in a SharePoint XSL query

    - by David
    Hello all, I am creating a SharePoint site that we will use to report issues with trucks used in our business. Linked to the list I have created will be a page that will display an overview of the trucks and a little truck icon will show the trucks current status. Green and the truck is okay (no open issues), Red and the truck have an open issue with status "Undrivable", Orange and there is two issues open that requires the user to look further into the truck before using it and finally a Gray truck for when there is a new issue created that has not been looked into (not sure if it is drivable or not). I have managed to create the "Dashboard" and with my limit XSL/XPATH knowledge been able to add a truck and replicate the description above but... in my test I have created 4 issues, for example if three of them are changed to status Closed and one left to Undrivable I will get four icons on the page, three with Green trucks and the last one Red. So in theory it works but I obviously only want to see the last truck, one truck. I am not interested in seeing the others. <xsl:template name="dvt_1.rowview"> <xsl:variable name="CountReport" select="count(/dsQueryResponse/Rows/Row[@Highloader='GGEU12' and @Status!='Closed'])" /> <xsl:variable name="MoreThan" select="$CountReport &gt; 1" /> <xsl:variable name="NoReports" select="$CountReport = 0" /> <xsl:variable name="Closed" select=" @Highloader='GGEU12' and @Status='Closed'" /> <xsl:choose> <xsl:when test="$MoreThan"> <div class="ms-vb"><img title='More than one report exist!' border='0' alt='In Progress' src='highloader/Library/hl-orange.png' /></div> </xsl:when> <xsl:otherwise> <div class="ms-vb"><xsl:value-of disable-output-escaping="yes" select="@Icon" /></div> </xsl:otherwise> </xsl:choose> </xsl:template> My hope is that someone with slightly more knowledge can find the last piece of the puzzle for me! Thanks for reading and asking questions to fill any gap I left above. David

    Read the article

  • An unhandled exception of type 'System.StackOverflowException' occurred in mscorlib.dll

    - by Sahar
    Hello everybody i wrote a code in asp.net that read data from files and draw a graph. It worked but after awhile when i run the program, this exception arise "An unhandled exception of type 'System.StackOverflowException' occurred in mscorlib.dll" in this statement in the code: if (File.Exists(fName)) <----(here is the exception) { stream = File.Open(fName, FileMode.Open); g_day = Deserialize(stream); stream.Close(); int cn = 0; if (g_day.Values.Count != 0) cn = g_day.Values[g_day.Values.Count - 1].Value; Label1.Text = cn.ToString(); } can u help me

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • MySQL UNION query from one table + ORDER BY

    - by ilnur777
    I have one table with two queries and I need to sort it with descending type using ORDER BY. Here is my MySQL query that does not work properly: (SELECT `text` FROM `comments` WHERE user_fr='".$user."' && archive='1' ORDER BY `is_new_fr` DESC) UNION (SELECT `text` FROM `message` WHERE user_to='".$user."' && archive='1' ORDER BY `is_new_to` DESC) Description! is_new_fr and is_new_to counts total new messages. Here is my table contant: user_fr | user_to | archive | is_new_fr | is_new_to| text name1 | name2 | 1 | 2 | 0 | testing... name2 | name1 | 1 | 0 | 5 | testing ... I want to make an order that 1st will display note that has more messages to few, or by another words using DESCending type. This is the display on the page I want to do: Open dialog with name2. Messages (5) Open dialog with name1. Messages (2) Thank you!

    Read the article

  • AIR:- Desktop Application related to Window Component (Need some work around)

    - by Mahesh Parate
    Create custom component which contains Combobox and Datagrid. Application conations two button 1) Same Window and 2) New Window. (Label of two button) When you click on “Same Window” button your custom component should get added dynamically in your application. And when you click on “New Window” button your custom component should get open in different window (it should get shifted from application and should appear in Window component). Issue faced:- Clicking on Combobox, list is not getting open as change event doesn’t get fired in Native Window as it looses reference from main application. Issue with DataGrid in Native window (AIR). • DataGridEvent.COLUMN_STRETCH event get affected if try to open datagrid in Native Window. • DataGridEvent get fired but takes long time or even stuck while column stretch Note: Application is an Desktop Application. Only one instance is created in Application for your custom component to preserve current state on your custom component it can be Style, data, or other subcomponent state of your custom component (as above mentioned 2 component are just sample). Please find sample code below:- DataGridStretchIssue.mxml:- < ?xml version="1.0" encoding="utf-8"? < mx:WindowedApplication xmlns:mx="http://www.adobe.com/2006/mxml" layout="absolute" xmlns:local="*" width="800" height="500" < mx:Script < ![CDATA[ import mx.events.FlexEvent; import mx.core.Window; private var dgComp:DataGridComp = new DataGridComp(); private var win:Window; private function clickHandler(event:Event):void{ dgComp.percentWidth = 100; dgComp.percentHeight = 100; dgComp.x = 50; dgComp.y = 100; if(win){ win.close(); } this.addChild(dgComp); } private function openClickHandler(event:MouseEvent):void{ dgComp.x = 50; dgComp.y = 100; win = new Window();; win.width = 800; win.height = 500; win.addChild(dgComp); dgComp.percentWidth = 100; dgComp.percentHeight = 100; dgComp.x = 50; dgComp.y = 100; win.open(true) } ]]> < /mx:Script < mx:HBox <mx:Button id="btnID" click="clickHandler(event)" label="Same Window"/> <mx:Button id="btnIDOpen" click="openClickHandler(event)" label="New Window"/> < /mx:HBox < /mx:WindowedApplication DataGridComp.mxml < ?xml version="1.0" encoding="utf-8"? < mx:Canvas xmlns:mx="http://www.adobe.com/2006/mxml" width="100%" height="100%" <mx:Script> <![CDATA[ import mx.events.DataGridEvent; import mx.collections.ArrayCollection; [Bindable] public var cards:ArrayCollection = new ArrayCollection( [ {label:"Visa", data:1}, {label:"MasterCard", data:2}, {label:"American Express", data:3} ]); private function stretchFn(event:DataGridEvent):void{ trace("--- Stretched---") } ]]> </mx:Script> <mx:HBox> <mx:ComboBox dataProvider="{cards}" width="150"/> <mx:DataGrid columnStretch="stretchFn(event)" > <mx:ArrayCollection> <mx:Object> <mx:Artist>Pavement</mx:Artist> <mx:Price>11.99</mx:Price> <mx:Album>Slanted and Enchanted</mx:Album> </mx:Object> <mx:Object> <mx:Artist>Pavement</mx:Artist> <mx:Album>Brighten the Corners</mx:Album> <mx:Price>11.99</mx:Price> </mx:Object> </mx:ArrayCollection> </mx:DataGrid> </mx:HBox> < /mx:Canvas Can any one suggest me some work around to make my code workable... :)

    Read the article

  • Configuring Redhat / CentOS 5 SSH to authenticate to IPA server with public keys

    - by Kyle Flavin
    I'm trying to configure some Red Hat/CentOS servers to use an ipa-server on CentOS 6 for SSH authentication with public keys. I'm storing the public keys on the IPA server, which works great on Centos6 using "AuthorizedKeysCommand /usr/bin/sss_ssh_authorizedkeys" in /etc/ssh/sshd_config. However, on RH 5.10, neither the "AuthorizedKeysCommand" directive or the "/usr/bin/sss_ssh_authorizedkeys" command exist to pull the public key from the directory. Is there a different way to make this work? Googling this mostly returns instructions for setting it up on 6.

    Read the article

  • VB6 ADODB Fails with SQL Compact: Multipe-Step operation generated errors

    - by Belliez
    Hi, I am converting an old application to use SQL Compact database (it works ok with SQ Server 2005 and 2008) and using the following code gives an error when attempting to execute a simple select command: Private Const mSqlProvider As String = "Provider=Microsoft.SQLSERVER.CE.OLEDB.3.5;" Private Const mSqlHost As String = "Data Source=C:\database.sdf;" Private mCmd As ADODB.Command ' For executing SQL' Private mDbConnection As ADODB.Connection Private Sub Command1_Click() Dim DbConnectionString As String DbConnectionString = mSqlProvider & _ mSqlHost Set mDbConnection = New ADODB.Connection mDbConnection.CursorLocation = adUseClient Call mDbConnection.Open(DbConnectionString) If mDbConnection.State = adStateOpen Then Debug.Print (" Database is open") ' Initialise the command object' Set mCmd = New ADODB.Command mCmd.ActiveConnection = mDbConnection End If mCmd.CommandText = "select * from myTable" mCmd.CommandType = adCmdText mCmd.Execute ' FAILS HERE! ' End Sub I have referenced Microsoft ActiveX Data Access Object 6.0 Library in the project. The error I get is: Run-Time error -2147217887 (80040e21) Multipe-Step operation generated errors. Check each status value Just wondering if anyone has any suggestions? Thanks

    Read the article

  • Subversion (20014)Internal error: database is locked on NFS

    - by Niraj Gurjar
    i have subversion setup using apache and DAV. OS is RHEL 4. Repository is created on NFS server mounted on this machine. when i try to access this repository i get following error in apache logs (20014)Internal error: database is locked Could not fetch resource information. [500, #0] Could not open the requested SVN filesystem [500, #200030] Could not open the requested SVN filesystem [500, #200030] The URI does not contain the name of a repository. [403, #190001] i did 'chmod' on that mounted partition but problem still persists. any help?

    Read the article

  • Proxy calls across a DMZ

    - by John
    We need to determine a quick way for our web application deployed in a DMZ to communicate to our SQL server that lives in the protected network. Only port 80 is open and available, and no direct SQL traffic is allowed across the firewall. So take the following simple system. A web page (default.aspx) makes a call (string GetData()) that resides in an assembly (Simple.DLL). GetData() uses ADO.NET to open a connection, execute a SQL call, retrieve the data, and return the data to the caller. However, since only port 80 is available and no SQL traffic is allowed, what could we do to accomplish our goal? I believe a .NET remoting solution would work, and I have heard of an architecture where a remoting layer proxies the call from Simple.DLL in the DMZ to another Simple.DLL that runs on the protected side. The remoting layer handles the communication between the two DLL’s. Can someone shed some light on how WCF/remoting can help us and how to get started with a solution?

    Read the article

  • How can I load a file into a DataBag from within a Yahoo PigLatin UDF?

    - by Cervo
    I have a Pig program where I am trying to compute the minimum center between two bags. In order for it to work, I found I need to COGROUP the bags into a single dataset. The entire operation takes a long time. I want to either open one of the bags from disk within the UDF, or to be able to pass another relation into the UDF without needing to COGROUP...... Code: # **** Load files for iteration **** register myudfs.jar; wordcounts = LOAD 'input/wordcounts.txt' USING PigStorage('\t') AS (PatentNumber:chararray, word:chararray, frequency:double); centerassignments = load 'input/centerassignments/part-*' USING PigStorage('\t') AS (PatentNumber: chararray, oldCenter: chararray, newCenter: chararray); kcenters = LOAD 'input/kcenters/part-*' USING PigStorage('\t') AS (CenterID:chararray, word:chararray, frequency:double); kcentersa1 = CROSS centerassignments, kcenters; kcentersa = FOREACH kcentersa1 GENERATE centerassignments::PatentNumber as PatentNumber, kcenters::CenterID as CenterID, kcenters::word as word, kcenters::frequency as frequency; #***** Assign to nearest k-mean ******* assignpre1 = COGROUP wordcounts by PatentNumber, kcentersa by PatentNumber; assignwork2 = FOREACH assignpre1 GENERATE group as PatentNumber, myudfs.kmeans(wordcounts, kcentersa) as CenterID; basically my issue is that for each patent I need to pass the sub relations (wordcounts, kcenters). In order to do this, I do a cross and then a COGROUP by PatentNumber in order to get the set PatentNumber, {wordcounts}, {kcenters}. If I could figure a way to pass a relation or open up the centers from within the UDF, then I could just GROUP wordcounts by PatentNumber and run myudfs.kmeans(wordcount) which is hopefully much faster without the CROSS/COGROUP. This is an expensive operation. Currently this takes about 20 minutes and appears to tack the CPU/RAM. I was thinking it might be more efficient without the CROSS. I'm not sure it will be faster, so I'd like to experiment. Anyway it looks like calling the Loading functions from within Pig needs a PigContext object which I don't get from an evalfunc. And to use the hadoop file system, I need some initial objects as well, which I don't see how to get. So my question is how can I open a file from the hadoop file system from within a PIG UDF? I also run the UDF via main for debugging. So I need to load from the normal filesystem when in debug mode. Another better idea would be if there was a way to pass a relation into a UDF without needing to CROSS/COGROUP. This would be ideal, particularly if the relation resides in memory.. ie being able to do myudfs.kmeans(wordcounts, kcenters) without needing the CROSS/COGROUP with kcenters... But the basic idea is to trade IO for RAM/CPU cycles. Anyway any help will be much appreciated, the PIG UDFs aren't super well documented beyond the most simple ones, even in the UDF manual.

    Read the article

  • IIS NLB Web Farm to front Single Tomcat Instance

    - by Brent Pabst
    I've got a single Tomcat 6 server that hosts a JSP app. We just spun up a new IIS 7.5 web farm to host our other internal apps. Currently the machine that hosts Tomcat is also running IIS 7 with the ISAPI filter loaded to provide front-end handling for the JSP app. I'd like to move the IIS portion to the web farm to consolidate our IIS presence and let the Tomcat server just serve and run Java and Tomcat. Has anyone done this, is it even possible while ensuring session state is properly maintained? I had it up and running using the IIS Tomcat Connector http://tomcatiis.riaforge.org/ but after a while the communication between the boxes slowed and pages would not load. In addition it seemed like some of our authentication tickets were timing out. Thanks for any ideas or reference material!

    Read the article

  • Accessing Windows 7 Printer from Ubuntu Linux via LPR/LPD or Samba

    - by nitbuntu
    Hi, I'm having difficulty printing from my Linux (Ubuntu 10.04) based PC to a printer connected to a Windows 7 machine. I was trying to connect using Samba (version 3.5.6) but this always brings up an authentication screen which never accepts any password I use. So I read somewhere that an alternative is to access the Windows printer via LPR/LPD. I added an LPR/LPD printer in Windows 7, but even within Windows 7, I am not able to print as the print que monitor shows as 'printer busy'. The printer in question is an Epson Stylus DX7400 and works fine when using the standard USB ports....but doesn't when I use with the LPR/LPD ports. I even opened up the TCP/IP port 515 in my McAfee firewall without any success. Any help with this would be highly appreciated. Additionally, does anyone have any idea how I can get Samba working for me?

    Read the article

  • Problem extracting text from RSS feeds

    - by Gautam
    Hi, I am new to the world of Ruby and Rails. I have seen rails cast 190 and I just started playing with it. I used selector gadget to find out the CSS and XPath I have the following code.. require 'rubygems' require 'nokogiri' require 'open-uri' url = "http://www.telegraph.co.uk/sport/football/rss" doc = Nokogiri::HTML(open(url)) doc.xpath('//a').each do |paragraph| puts paragraph.text end When I extracted text from a normal HTML page with css, I could get the extracted text on the console. But when I try to do the same either with CSS or XPath for the RSS Feed for the following URL mentioned in the code above, I dont get any output. How do you extract text from RSS feeds?? I also have another silly question. Is there a way to extract text from 2 different feeds and display it on the console something like url1 = "http://www.telegraph.co.uk/sport/football/rss" url2 = "http://www.telegraph.co.uk/sport/cricket/rss" Looking forward for your help and suggestions Thank You Gautam

    Read the article

  • Reading a file with a supplied name in C++

    - by Cosmina
    I must read a file with a given name (it's caled "hamlet.txt"). The class used to read the file is defined like this #ifndef READWORDS_H #define READWORDS_H /** * ReadWords class. Provides mechanisms to read a text file, and return * capitalized words from that file. */ using namespace std; #include <string> #include <fstream> class ReadWords { public: /** * Constructor. Opens the file with the default name "text.txt". * Program exits with an error message if the file does not exist. */ ReadWords(); /** * Constructor. Opens the file with the given filename. * Program exits with an error message if the file does not exist. * @param filename - a C string naming the file to read. */ ReadWords(char *filename); My definition of the members of the classis this: #include<string> #include<fstream> #include<iostream> #include "ReadWords.h" using namespace std; ReadWords::ReadWords() { wordfile.open("text.txt"); if( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } } ReadWords::ReadWords(char *filename) { wordfile.open(filename); if ( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } wordfile>>nextword; } And the main to test it. using namespace std; #include #include #include "ReadWords.h" int main() { char name[30]; cout<<"Please input a name for the file that you wish to open"; cin>>name; ReadWords x( name[] ); } When I complie it gives me the error: main.cpp:14: error: expected primary-expression before ']' token I know it's got something to do with the function ReadWords( char *filename), but I do not know what. Any help please?

    Read the article

  • Unix domain socket firewall

    - by lagab
    Hello, everyone. I've got a problem with my debian server. Probably there is some vulnerable script at my web-serser, which is running from www-data user. I also have samba with winbind installed, and samba is joined to windows domain. So, probably this vulnerable script allows hacker to bruteforce out domain controller through winbind unix domain socket. Actually I have lots of such lines at netstat -a output: unix 3 [ ] STREAM CONNECTED 509027 /var/run/samba/winbindd_privileged/pipe And our DC logs contain lots of recorded authentication attems from root or guest accounts. How can I restrict my apaches access to winbind? I had an idea to use some kind of firewall for IPC sockets. Is it possible?

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • SSL confirmation dialog popup auto closes in IE8 when re-accessing a JNLP file

    - by haylem
    I'm having this very annoying problem to troubleshoot and have been going at it for way too many days now, so have a go at it. The Environment We have 2 app-servers, which can be located on either the same machine or 2 different machines, and use the same signing certificate, and host 2 different web-apps. Though let's say, for the sake of our study case here, that they are on the same physical machine. So, we have: https://company.com/webapp1/ https://company.com/webapp2/ webapp1 is GWT-based rich-client which contains on one of its screens a menu with an item that is used to invoke a Java WebStart Client located on webapp2. It does so by performing a simple window.open call via this GWT call: Window.open("https://company.com/webapp2/app.jnlp", "_blank", null); Expected Behavior User merrilly goes to webapp1 User navigates to menu entry to start the WebStart app and clicks on it browser fires off a separate window/dialog which, depending on the browser and its security settings, will: request confirmation to navigate to this secure site, directly download the file, and possibly auto-execute a javaws process if there's a file association, otherwise the user can simply click on the file and start the app (or go about doing whatever it takes here). If you close the app, close the dialog, and re-click the menu entry, the same thing should happen again. Actual Behavior On Anything but God-forsaken IE 8 (Though I admit there's also all the god-forsaken pre-IE8 stuff, but the Requirements Lords being merciful we have already recently managed to make them drop these suckers. That was close. Let's hold hands and say a prayer of gratitude.) Stuff just works. JNLP gets downloaded, app executes just fine, you can close the app and re-do all the steps and it will restart happily. People rejoice. Puppies are safe and play on green hills in the sunshine. Developers can go grab a coffee and move on to more meaningful and rewarding tasks, like checking out on SO questions. Chrome doesn't want to execute the JNLP, but who cares? Customers won't get RSI from clicking a file every other week. On God-forsaken IE8 On the first visit, the dialog opens and requests confirmation for the user to continue to webapp2, though it could be unsafe (here be dragons, I tell you). The JNLP downloads and auto-opens, the app start. Your breathing is steady and slow. You close the app, close that SSL confirmation dialog, and re-click the menu entry. The dialog opens and auto-closes. Nothing starts, the file wasn't downloaded to any known location and Fiddler just reports the connection was closed. If you close IE and reach that menu item to click it again, it is now back to working correctly. Until you try again during the same session, of course. Your heart-rate goes up, you get some more coffee to make matters worse, and start looking for plain tickets online and a cheap but heavy golf-club on an online auction site to go clubbing baby polar seals to avenge your bloodthirst, as the gates to the IE team in Redmond are probably more secured than an ice block, as one would assume they get death threats often. Plus, the IE9 and IE10 teams are already hard at work fxing the crap left by their predecessors, so maybe you don't want to be too hard on them, and you don't have money to waste on a PI to track down the former devs responsible for this mess. Added Details I have come across many problems with IE8 not downloading files over SSL when it uses a no-cache header. This was indeed one of our problems, which seems to be worked out now. It downloads files fine, webapp2 uses the following headers to serve the JNLP file: response.setHeader("Cache-Control", "private, must-revalidate"); // IE8 happy response.setHeader("Pragma", "private"); // IE8 happy response.setHeader("Expires", "0"); // IE8 happy response.setHeader("Access-Control-Allow-Origin", "*"); // allow to request via cross-origin AJAX response.setContentType("application/x-java-jnlp-file"); // please exec me As you might have inferred, we get some confirmation dialog because there's something odd with the SSL certificate. Unfortunately I have no control over that. Assuming that's only temporary and for development purposes as we usually don't get our hands on the production certs. So the SSL cert is expired and doesn't specify the server. And the confirmation dialog. Wouldn't be that bad if it weren't for IE, as other browsers don't care, just ask for confirmation, and execute as expected and consistantly. Please, pretty please, help me, or I might consider sacrificial killings as an option. And I think I just found a decently prized stainless steel golf-club, so I'm right on the edge of gore. Side Notes Might actually be related to IE8 window.open SSL Certificate issue. Though it doesn't explain why the dialog would auto-close (that really is beyong me...), it could help to not have the confirmation dialog and not need the dialog at all. For instance, I was thinking that just having a simple URL in that menu instead of have it entirely managed by GWT code to invoke a Window.open would solve the problem. But I don't have control on that menu, and also I'm very curious how this could be fixed otherwise and why the hell it happens in the first place...

    Read the article

  • NetBeans ("6.8" and "later") - UML support?

    - by Petike
    Hello, I wanted to download the "UML plugin" to NetBeans through the "Tools/Plugins" but I didn't find the plugin there. Then I read in many articles that the "NetBeans UML plugin is not supported anymore" :-( . Then I discovered that there exists some "NetBeans SDE" tool that supports the UML in NetBeans and there exists the "Comunity Edition" of that tool which is free, but only for "non-commercial" uses - so it's not open-source - and so I don't want to use it. So I would like to ask, if Sun (or whoever else who officially maintains (or maintained in the past) the NetBeans UML plugin) is not going to support the UML plugin to NetBeans anymore and if so, is there any "open-source" UML plugin which is supported in version "6.8" and "later" and if so - which? Thank you.

    Read the article

  • Credentials work for SSMS but not (ODBC) LogParser script

    - by justSteve
    Via SSMS I'm able to connect and navigate the server/db in question. but trying to connect via a logparser script the same credentials fail. I'm trying to execute this from the same box on which the server's running. the username is owner/dbo of the db. The db has mixed mode authentication. [linebreaks for clarity] C:\TTS\tools\LogParserc:\tts\tools\logparser\logparser file:c:\tts\tools\logparser\errors2SQL.sql?source="C:\inetpub\logs\LogFiles\W3SVC8\u_ex100521.log" -i:IISW3C -o:SQL -createTable:ON -oConnString:"Driver={SQL Server Native Client 10.0};Server=servername\SQLEXPRESS;db=Tter;uid=logger2;pwd=foo" -stats:OFF Task aborted. Error connecting to ODBC Server SQL State: 28000 Native Error: 18456 Error Message: [Microsoft][SQL Server Native Client 10.0][SQL Server]Login failed for user 'logger2'. C:\TTS\tools\LogParser

    Read the article

  • subversion problem on mac os x

    - by Mohsin Jimmy
    This exists in my httpd.conf file: <Location /svn> DAV svn SVNParentPath /Users/iirp/Sites/svn Allow from all #AuthType Basic #AuthName "Subversion repository" #AuthUserFile /Users/iirp/Sites/svn-auth-file #Require valid-user </Location> This is working file When I change this to: <Location /svn> DAV svn SVNParentPath /Users/iirp/Sites/svn #Allow from all AuthType Basic AuthName "Subversion repository" AuthUserFile /Users/iirp/Sites/svn-auth-file Require valid-user </Location> and when I access my repository through URL, it gives me the authentication screen but after that screen my svn repository is not showing up correctly. to see message that it gives to me is: Internal Server Error The server encountered an internal error or misconfiguration and was unable to complete your request. Please contact the server administrator, [email protected] and inform them of the time the error occurred, and anything you might have done that may have caused the error. More information about this error may be available in the server error log.

    Read the article

  • JSF HIBERNATE POSTGRESQL

    - by user312619
    When I press "Save" button I get an exception like that ; javax.servlet.ServletException: org.hibernate.exception.JDBCConnectionException: Cannot open connection javax.faces.webapp.FacesServlet.service(FacesServlet.java:325) root cause javax.faces.el.EvaluationException: org.hibernate.exception.JDBCConnectionException: Cannot open connection javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:102) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312) root cause org.hibernate.exception.JDBCConnectionException: Cannot open connection org.hibernate.exception.SQLStateConverter.convert(SQLStateConverter.java:98) org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:66) org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:52) org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:449) org.hibernate.jdbc.ConnectionManager.getConnection(ConnectionManager.java:167) org.hibernate.jdbc.JDBCContext.connection(JDBCContext.java:142) org.hibernate.transaction.JDBCTransaction.begin(JDBCTransaction.java:85) org.hibernate.impl.SessionImpl.beginTransaction(SessionImpl.java:1463) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.hibernate.context.ThreadLocalSessionContext$TransactionProtectionWrapper.invoke(ThreadLocalSessionContext.java:344) $Proxy108.beginTransaction(Unknown Source) com.yemex.beans.CompanyBean.saveOrUpdate(CompanyBean.java:52) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.apache.el.parser.AstValue.invoke(AstValue.java:196) org.apache.el.MethodExpressionImpl.invoke(MethodExpressionImpl.java:276) com.sun.faces.facelets.el.TagMethodExpression.invoke(TagMethodExpression.java:98) javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:88) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312) root cause java.sql.SQLException: No suitable driver found for jdbc:postgresql://localhost/postgres java.sql.DriverManager.getConnection(Unknown Source) java.sql.DriverManager.getConnection(Unknown Source) org.hibernate.connection.DriverManagerConnectionProvider.getConnection(DriverManagerConnectionProvider.java:133) org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:446) org.hibernate.jdbc.ConnectionManager.getConnection(ConnectionManager.java:167) org.hibernate.jdbc.JDBCContext.connection(JDBCContext.java:142) org.hibernate.transaction.JDBCTransaction.begin(JDBCTransaction.java:85) org.hibernate.impl.SessionImpl.beginTransaction(SessionImpl.java:1463) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.hibernate.context.ThreadLocalSessionContext$TransactionProtectionWrapper.invoke(ThreadLocalSessionContext.java:344) $Proxy108.beginTransaction(Unknown Source) com.yemex.beans.CompanyBean.saveOrUpdate(CompanyBean.java:52) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.apache.el.parser.AstValue.invoke(AstValue.java:196) org.apache.el.MethodExpressionImpl.invoke(MethodExpressionImpl.java:276) com.sun.faces.facelets.el.TagMethodExpression.invoke(TagMethodExpression.java:98) javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:88) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312)

    Read the article

  • C# CF: file encryption/decryption on the fly

    - by nuttynibbles
    Hi, i've seen many article on encrypt/decrypt of file and typically a button is used to choose the file for encrypt and another button to decrypt the file. i've seen some application like truecrypt and probably others which does file encryption on-the-fly with transparent. this means that when a encrypted file is clicked to access, it will automatically decrypt and play/open the file. then when the file is closed, it will automatically encrypt again. some have said that the only way to detect file open is through file system filter. but is there other ways to do this in c# compact framework?

    Read the article

  • Sharepoint database connection issue after upgrade to SQL Server 2008 R2

    - by Neil Hoff
    I took a backup of all our Sharepoint WSS 3.0 databases and restored them to a new Windows 2008 R2 server. The new SQL server has the same name and IP address as the old one. The only difference between the two is the new one has SQL 2008 R2 and the old one has SQL 2005. When I navigate to the sharepoint url I get this error: Cannot connect to the configuration database. I checked the logs at this location: "%commonprogramfiles%/Microsoft Shared/web server extensions/12/Logs" and found this error: System.Data.SqlClient.SqlException: Login failed. The login is from an untrusted domain and cannot be used with Windows authentication. Any ideas?

    Read the article

  • Facebook Connect via Javascript doesn't close and doesn't pass session id

    - by ensnare
    I'm trying to authenticate users via Facebook Connect using a custom Javascript button: <form> <input type="button" value="Connect with Facebook" onclick="window.open('http://www.facebook.com/login.php?api_key=XXXXX&extern=1&fbconnect=1&req_perms=publish_stream,email&return_session=0&v=1.0&next=http%3A%2F%2Fwww.example.com%2Fxd_receiver.htm&fb_connect=1&cancel_url=http%3A%2F%2Fwww.example.com%2Fregister%2Fcancel', '_blank', 'top=442,width=480,height=460,resizable=yes', true)" onlogin='window.location="/register/step2"' /> </form> I am able to authenticate users. However after authentication, the popup window just stays open and the main window is not directed anywhere. In fact, it is the popup window that goes to "/register/step2" How can I get the login window to close as expected, and to pass the facebook session id to /register/step2? Thanks!

    Read the article

  • What's the difference between sudo su - postgres and sudo -u postgres?

    - by Craig Ringer
    PostgreSQL users peer authentication on unix sockets by default, where the unix user must be the same as the PostgreSQL user. So people frequently use su or sudo to become the postgres superuser. I often see people using constructs like: sudo su - postgres rather than sudo -u postgres -i and I'm wondering why. Similarly, I've seen: sudo su - postgres -c psql instead of sudo -u postgres psql Without the leading sudo the su versions would make some sense if you were on an old platform without sudo. But why on a less than prehisoric UNIX or Linux would you use sudo su ?

    Read the article

< Previous Page | 469 470 471 472 473 474 475 476 477 478 479 480  | Next Page >