Search Results

Search found 8886 results on 356 pages for 'parse tree'.

Page 48/356 | < Previous Page | 44 45 46 47 48 49 50 51 52 53 54 55  | Next Page >

  • How to Add a File from my source tree to Maven Site

    - by Charles O.
    I have a Maven 2 RESTful application using Jersey/JAXB. I generate the JAXB beans from a schema file, where the schema file is in my resources directory, e.g., src/main/resources/foo.xsd. I want to include foo.xsd file in the generated Maven site for my project, so that clients can see the XML schema when writing RESTful calls. How can I include foo.xsd in the site? I could have a copy of the file in src/main/site/..., and then update my site.xml to point to it (or have a .apt whose contents point to it), but I don't like that because I'm still tweaking foo.xsd, and don't want to have to remember to copy it each time I update it. And that's just bad practice. I also tried having a .apt file that has a link to the foo.xsd which gets copied to the target/classes directory. That works until I do a site:deploy, because that only copies the target/site directory. Thanks, Charles

    Read the article

  • parse results in MySQL via REGEX

    - by Derek Adair
    Hi, I'm a bit confused on the functionality of the REGEX support for MySQL and I have yet to find a solid example on how to separate a result with REGEX within an sql statement. Example: How could I pull data from a table emails that looks something like... +-------------------------+ |Emails | |-------------------------| |[email protected]| +-------------------------+ and return something through an sql statement that looks like... +------------------------------+ |Username | Domain | TLD | |-----------|------------|-----| |some.email | yourdomain | com | +------------------------------+

    Read the article

  • When to use http status code 404

    - by Sybiam
    I am working on a project and after arguing with people at work for about more than a hour. I decided to know what people on stack-exchange might say. We're writing an API for a system, there is a query that should return a tree of Organization or a tree of Goals. The tree of Organization is the organization in which the user is present, In other words, this tree should always exists. In the organization, a tree of goal should be always present. (that's where the argument started). In case where the tree doesn't exist, my co-worker decided that it would be right to answer response with status code 200. And then started asking me to fix my code because the application was falling apart when there is no tree. I'll try to spare flames and fury. I suggested to raise a 404 error when there is no tree. It would at least let me know that something is wrong. When using 200, I have to add special check to my response in the success callback to handle errors. I'm expecting to receive an object, but I may actually receive an empty response because nothing is found. It sounds totally fair to mark the response as a 404. And then war started and I got the message that I didn't understand HTTP status code schema. So I'm here and asking what's wrong with 404 in this case? I even got the argument "It found nothing, so it's right to return 200". I believe that it's wrong since the tree should be always present. If we found nothing and we are expecting something, it should be a 404. Extra Also, I believe the best answer to the problem is to create default objects when organizations are created, having no tree shouldn't be a valid case and should be seen as an undefined behavior. There is no way an account can be used without both trees. For that reasons, they should be always present.

    Read the article

  • PyYAML parse into arbitary object

    - by Philip Fourie
    I have the following Python 2.6 program and YAML definition (using PyYAML): import yaml x = yaml.load( """ product: name : 'Product X' sku : 123 features : - size : '10x30cm' weight : '10kg' """ ) print type(x) print x Which results in the following output: <type 'dict'> {'product': {'sku': 123, 'name': 'Product X', 'features': [{'weight': '10kg', 'size': '10x30cm'}]}} It is possible to create a strongly typed object from x? I would like to the following: print x.features(0).size I am aware that it is possible to create and instance from an existent class, but that is not what I want for this particular scenario.

    Read the article

  • Parse XML function names and call within whole assembly

    - by Matt Clarkson
    Hello all, I have written an application that unit tests our hardware via a internet browser. I have command classes in the assembly that are a wrapper around individual web browser actions such as ticking a checkbox, selecting from a dropdown box as such: BasicConfigurationCommands EventConfigurationCommands StabilizationCommands and a set of test classes, that use the command classes to perform scripted tests: ConfigurationTests StabilizationTests These are then invoked via the GUI to run prescripted tests by our QA team. However, as the firmware is changed quite quickly between the releases it would be great if a developer could write an XML file that could invoke either the tests or the commands: <?xml version="1.0" encoding="UTF-8" ?> <testsuite> <StabilizationTests> <StressTest repetition="10" /> </StabilizationTests> <BasicConfigurationCommands> <SelectConfig number="2" /> <ChangeConfigProperties name="Weeeeee" timeOut="15000" delay="1000"/> <ApplyConfig /> </BasicConfigurationCommands> </testsuite> I have been looking at the System.Reflection class and have seen examples using GetMethod and then Invoke. This requires me to create the class object at compile time and I would like to do all of this at runtime. I would need to scan the whole assembly for the class name and then scan for the method within the class. This seems a large solution, so any information pointing me (and future readers of this post) towards an answer would be great! Thanks for reading, Matt

    Read the article

  • Replace newline from MySQL TEXT field to parse w/ JSON

    - by dr3w
    Hi, "replace newline" seems to be a question asked here and there like hundred times already. But however, i haven't found any working solution for myself yet. I have a textarea that i use to save data into DB. Then using AJAX I want to get data from the DB in the backend that is in TEXT field and to pass it to frontend using JSON. But pasing JSON returns an error, as new lines from DB are not valid JSON syntax, I guess i should use \n instead... But how do i replace newlinew from DB with \n? I've tried this $t = str_replace('<br />', '\n', nl2br($t)); and this $t = preg_replace("/\r\n|\n\r|\r|\n/", "\n", $t); and using CHAR(13) and CHAR(10), and still I get an error the new line in textarea is equivalent to, i guess $t = 'text with a newline'; it gives the same error. And in notepad i clearly see that it is crlf

    Read the article

  • Can't parse a 1904 date in ARPA format (email date)

    - by Ramon
    I'm processing an IMAP mailbox and running into trouble parsing the dates using the mxDateTime package. In particular, early dates like "Fri, 1 Jan 1904 00:43:25 -0400" is causing trouble: >>> import mx.DateTime >>> import mx.DateTime.ARPA >>> mx.DateTime.ARPA.ParseDateTimeUTC("Fri, 1 Jan 1904 00:43:25 -0400").gmtoffset() Traceback (most recent call last): File "<interactive input>", line 1, in <module> Error: cannot convert value to a time value >>> mx.DateTime.ARPA.ParseDateTimeUTC("Thu, 1 Jan 2009 00:43:25 -0400").gmtoffset() <mx.DateTime.DateTimeDelta object for '-08:00:00.00' at 1497b60> >>> Note that an almost identical date from 2009 works fine. I can't find any description of date limitations in mxDateTime itself. Any ideas why this might be? Thx, Ramon

    Read the article

  • Angularjs: addition of integers even after I parse the variable as integer

    - by Shiv Kumar
    I really have a weird problem in adding two numbers. Here is my code, in the first controller everything is working fine, but in the second controller instead of 0 if I add 10, the output is completely weird Here is html code <div ng-app=""> <div ng-controller="Controller1"> <br/>**** Controller-1 <br/>Add 0 : {{update1(0)}} <br/>Add 10 : {{update1(10)}} <br/>Add 50 : {{update1(50)}} <br/>Add -60 : {{update1(-60)}}</div> <div ng-controller="Controller2"> <br/>**** Controller-2 <br/>Add 10 : {{update2(10)}} <br/>Add 10 : {{update2(10)}} <br/>Add 50 : {{update2(50)}} <br/>Add -60 : {{update2(-60)}}</div> </div> Here is my javascript function Controller1($scope) { var x = 0; $scope.update1 = function (smValue) { x += parseInt(smValue); return x; } } function Controller2($scope) { var y = 0; $scope.update2 = function (smValue) { y += parseInt(smValue); return y; } } and here is the output **** Controller-1 Add 0 : 0 Add 10 : 10 Add 50 : 60 Add -60 : 0 **** Controller-2 Add 0 : 110 Add 10 : 120 Add 50 : 170 Add -60 : 110 here is the link to try: http://jsfiddle.net/6VqqN/ can anyone please explain me why it is behaving like that. Even if I add a 3or4 digit number, output is completely different then what I expected.

    Read the article

  • Parse Directory Structure (Strings) to JSON using PHP

    - by Ecropolis
    I have an array of file-path strings like this videos/funny/jelloman.wmv videos/funny/bellydance.flv videos/abc.mp4 videos/june.mp4 videos/cleaver.mp4 fun.wmv jimmy.wmv herman.wmv Is there a library or easy way I can get to a data structure json or xml? Something like this: (I see there are a lot of snippets available for traversing actual folders, but again, I just have strings.) { files:{ file:[ { filename:'fun.wmv' }, { filename:'jimmy.wmv' }, { filename:'herman.wmv' } ], folder:{ foldername:'videos', file:[ { filename:'abc.mp4' }, { filename:'june.mp4' }, { filename:'cleaver.mp4' } ], folder:{ foldername:'funny', file:[ { filename:'jelloman.wmv' }, { filename:'bellydance.flv' } ] } } } }

    Read the article

  • JQuery - Adding Cells to Dynamic Tree Table

    - by BPotocki
    I can't quite wrap my head around this one... A table like the one below is spit out by a renderer from some XML. The XML it comes from has a variable depth. (Please point out if I'm using the rowspans in a horrific manner as well, I just came to this table with some experimentation). <table border="1"> <tr> <td rowspan="12">> 1</td> </tr> <tr> <td rowspan="3">1 > 2</td> </tr> <tr> <td>1 > 2 > 5</td> </tr> <tr> <td>1 > 2 > 6</td> </tr> <tr> <td rowspan="3">1 > 3</td> </tr> <tr> <td>1 > 3 > 7</td> </tr> <tr> <td>1 > 3 > 8</td> </tr> <tr> <td rowspan="3">1 > 4</td> </tr> <tr> <td>1 > 4 > 9</td> </tr> <tr> <td>1 > 4 > 10</td> </tr> </table> What I'm trying to accomplish in JQuery is this... User clicks cell "1 2" (which will have an ID). An item is dynamically added to the third level, but UNDER "1 2 6". What I could do is just add another row underneath "1 2" and increase the rowspan from "1 2", but the new cell would then appear out of order amongst "1 2 5" and "1 2 6". I don't really need the exact code to do this, just something to stop my head from spinning around this...Thanks!

    Read the article

  • XamlReader.Parse throws exception on empty String

    - by sub-jp
    In our app, we need to save properties of objects to the same database table regardless of the type of object, in the form of propertyName, propertyValue, propertyType. We decided to use XamlWriter to save all of the given object's properties. We then use XamlReader to load up the XAML that was created, and turn it back into the value for the property. This works fine for the most part, except for empty strings. The XamlWriter will save an empty string as below. <String xmlns="clr-namespace:System;assembly=mscorlib" xml:space="preserve" /> The XamlReader sees this string and tries to create a string, but can't find an empty constructor in the String object to use, so it throws a ParserException. The only workaround that I can think of is to not actually save the property if it is an empty string. Then, as I load up the properties, I can check for which ones did not exist, which means they would have been empty strings. Is there some workaround for this, or is there even a better way of doing this?

    Read the article

  • JPA query for getting the whole tree

    - by Javi
    Hello, I have a class which models all categories and they can be ordered hierarchically. @Entity @Table(name="categories") public class Category { @Id @GeneratedValue(strategy=GenerationType.SEQUENCE, generator="sequence") @SequenceGenerator(name="sequence", sequenceName="categories_pk_seq", allocationSize=1) @Column(name="id") private Long id; @Column private String name; @OneToOne @JoinColumn(name="idfather") private Category father; } I need to get all categories ordered hierarchically (I mean every father followed by its children and fathers ordered alphabetically on each level) as they could be made for example with PRIOR in oracle. Is it possible to do this with a JPA Query (not a SQL one)? Thanks.

    Read the article

  • How to parse app.config using ConfigurationManager?

    - by Amokrane
    I was using a certain method for parsing my app.config file. Then I was told that using ConfigurationManager is better and simpler. But the thing is I don't know how to do it with ConfigurationManager. My original code looked like this: XmlNode xmlProvidersNode; XmlNodeList xmlProvidersList; XmlNodeList xmlTaskFactoriesList; XmlDocument xmlDoc = new XmlDocument(); xmlDoc.Load("app.config"); xmlProvidersNode = xmlDoc.DocumentElement.SelectSingleNode("TaskProviders"); xmlProvidersList = xmlProvidersNode.SelectNodes("TaskProvider"); foreach (XmlNode xmlProviderElement in xmlProvidersList) { if (xmlProviderElement.Attributes.GetNamedItem("Name").Value.Equals(_taskProvider)) { xmlTaskFactoriesList = xmlProviderElement.SelectNodes("TaskTypeFactory"); foreach (XmlNode xmlTaskFactoryElement in xmlTaskFactoriesList) { if (xmlTaskFactoryElement.Attributes.GetNamedItem("TaskType").Value.Equals(_taskType)) { taskTypeFactory = xmlTaskFactoryElement.Attributes.GetNamedItem("Class").Value; } } } } What would be the equivalent using ConfigurationManager? (Because all I can see is how to get keys not nodes..) Thanks

    Read the article

  • How could I parse this HTML file?

    - by Sergio Tapia
    <div id="main"> <style type="text/css"> </style> <script language="JavaScript"> </script> <p style="margin: 0pt 0pt 0.5em;"><b>Media from&nbsp;<a onclick="(new Image()).src='/rg/find-media-title/media_strip/images/b.gif?link=/title/tt0087538/';" href="/title/tt0087538/">The Karate Kid</a> (1984)</b></p> <style type="text/css"> </style> <table style="border-collapse: collapse;"> </table> </div> I need to somehow extract the href value of the (new Image()). How exactly would I accomplish this with HtmlAgilityPack? I'm new to it, and so far I haven't found a useful tutorial on how to effectively use it for parsing. Thanks for the help!

    Read the article

  • Parse filename from full path using regular expressions in C#

    - by WindyCityEagle
    How do I pull out the filename from a full path using regular expressions in C#? Say I have the full path C:\CoolDirectory\CoolSubdirectory\CoolFile.txt. How do I get out CoolFile.txt using the .NET flavor of regular expressions? I'm not really good with regular expressions, and my RegEx buddy and me couldn't figure this one out. Also, in the course of trying to solve this problem, I realized that I can just use System.IO.Path.GetFileName, but the fact that I couldn't figure out the regular expression is just making me unhappy and it's going to bother me until I know what the answer is.

    Read the article

  • How to parse an XML file using PHP?

    - by Jack
    Here I have a variable 'response' which is obtained by parsing an XML file. $url = 'http://xxxxx.xml'; $ch = curl_init($url); $response = curl_exec($ch); The url structure is as follows - <user> <id>734</id> <name>Peter Parker</name> - <status> <favorited>false</favorited> </status> </user> How to access each bit of info like id,name,favorited from response?

    Read the article

  • jQuery: How to parse a multidemensional array?

    - by Allen G
    I'm not sure if the array is too deep or what, but I can't seem to get anything other than the keys and undefines. Help please! I'm using Codeigniter for development. Here is the PHP then the jQuery: $term = $this->input->post('search_term'); $this->db->like('book_title', $term); $search_query = $this->db->get('books'); $return = array(); $i = 0; if ($search_query->num_rows() > 1) { foreach($search_query->result() as $s) { $return['books']['book_id'] = $s->book_id; $return['books']['book_title'] = $s->book_title; $return['books']['book_price'] = $s->book_price; $i++; } } elseif ($search_query->num_rows() == 1) { echo 1; $i = 0; $return['book_id'] = $search_query->row('book_id'); $return['book_title'] = $search_query->row('book_title'); $return['book_price'] = $search_query->row('book_price'); } elseif ($search_query->num_rows() == 0) { echo 0; } echo json_encode($return); $("#search").change(function() { var searchTerm = $(this).val(); $.post("/contentcreator/search_by_term", { search_term: searchTerm }, function(data) { $("#book_scroller").empty(); var lengthHolder = data.books; for (var i = 0; i data.books.length; i++) { var row = '<li id="book_item_' + l + '">' + data.books['book_title'] +'</li>'; $("#book_scroller").append(row); }; i++; }, "json"); }); Thanks!

    Read the article

  • How to select all parents of a node in a hierarchical mysql table?

    - by Ehsan Khodarahmi
    I have a MySQL table that represents data for a tree GUI component, here's the structure of my table: treeTable ( id INT NOT NULL PRIMARY KEY, parentId INT, name VARCHAR(255) ); parentId is a self-referencing foreign key. Now I want to write a stored procedure which gets a node id and returns a result set that contains that node and all of its parents. For example, suppose that my table has filled with this data: 1, null, 'root' 2, 1 , 'level_1' 3, 2 , 'level_2' Now I want to get all parent nodes of node 3 (nodes 1 and 2) and return a result set that contains all tree records. Can anybody help me please?

    Read the article

  • C# Expression Tree Simple Arithmetic

    - by Richard Adnams
    Hello, I've been trying to figure out how to achieve some simple maths using the Expression class. What I'm trying to do is this (1 + 10 * 15) When I try to do this via Expression.Add and Expression.Constant but the result I get is this ((1 + 10) * 15) Which is not right as it evaluates the 1 + 10 first instead of 10 * 15. Is there a way to combine Expression.Add/Multiply etc.. without it creating the brackets? I assume there is but I just can't find where or how! The test code I have is this var v1 = Expression.Constant(1, typeof(int)); var v2 = Expression.Constant(10, typeof(int)); var v3 = Expression.Constant(15, typeof(int)); var a1 = Expression.Add(v1, v2); var m2 = Expression.Multiply(a1, v3); Thanks for your time, Richard.

    Read the article

  • Finding the actual runtime call tree of a Java Program

    - by Chathuranga Chandrasekara
    Suppose I have a big program that consists of hundreds of methods in it. And according to the nature of input the program flow is getting changed. Think I want to make a change to the original flow. And it is big hassle to find call hierarchy/ references and understand the flow. Do I have any solution for this within Eclipse? Or a plugin? As an example, I just need a Log of method names that is in order of time. Then I don't need to worry about the methods that are not relevant with my "given input" Update : Using debug mode in eclipse or adding print messages are not feasible. The program is sooooo big. :)

    Read the article

  • How to parse json data from https client in android

    - by Madhan Shanmugam
    I try to fetch data from https client. Same code i used to fetch from http client. but its working fine. when i try to use Https client its not working. i am getting the following error. java.net.UnknownHostException: Host is unresolved: https client address:443 Error Log: 10-27 10:01:08.280: W/System.err(21826): java.net.UnknownHostException: Host is unresolved: https client address.com 443 10-27 10:01:08.290: W/System.err(21826): at java.net.Socket.connect(Socket.java:1037) 10-27 10:01:08.290: W/System.err(21826): at org.apache.http.conn.ssl.SSLSocketFactory.connectSocket(SSLSocketFactory.java:317) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.DefaultClientConnectionOperator.openConnection(DefaultClientConnectionOperator.java:129) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPoolEntry.open(AbstractPoolEntry.java:164) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPooledConnAdapter.open(AbstractPooledConnAdapter.java:119) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.DefaultRequestDirector.execute(DefaultRequestDirector.java:348) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:555) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:487) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:465) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.JSONParser.getJSONFromUrl(JSONParser.java:38) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.myfile.processThread(myfile.java:159) 10-27 10:01:08.330: W/System.err(21826): at com.peripay.PERIPay$1$1.run(myfile.java:65) 10-27 10:01:08.330: E/Buffer Error(21826): Error converting result java.lang.NullPointerException 10-27 10:01:08.330: E/JSON Parser(21826): Error parsing data org.json.JSONException: A JSONObject text must begin with '{' at character 0 of

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 44 45 46 47 48 49 50 51 52 53 54 55  | Next Page >