Search Results

Search found 25009 results on 1001 pages for 'content encoding'.

Page 490/1001 | < Previous Page | 486 487 488 489 490 491 492 493 494 495 496 497  | Next Page >

  • Rule of thumb in RAM estimate for static pages? [closed]

    - by IMB
    Possible Duplicate: How do you do Load Testing and Capacity Planning for Web Sites I've seen tutorials saying they can run decent websites on 64MB RAM (Debian/Lighttpd/PHP/MySQL) however it's not clearly defined how much hits/traffic a "decent" site gets. Is there a rule of thumb on how much RAM a web server needs? To keep things simple, let's say you're running a site with static content and it's averaging at 100,000 hits per hour (HTML + images combined, no MySQL). How much RAM is the minimum requirement for that?

    Read the article

  • Mails are coming from mail server to my account automatically...???

    - by Jayakrishnan T
    Hi all, i am getting same mail from admin account of my mail server every day automatically.The content of the mail is given below. Click here to access your spam quarantine. The spam quarantine contains emails that are being held from your email account. Quarantined emails can be released to your inbox or deleted using the spam quarantine link. Please give me an advice to solve this problem.

    Read the article

  • Is the guideline: don't open email attachments or execute downloads or run plug-ins (Flash, Java) from untrusted sites enough to avert infection?

    - by therobyouknow
    I'd like to know if the following is enough to avert malware as I feel that the press and other advisory resources aren't always precisely clear on all the methods as to how PCs get infected. To my mind, the key step to getting infected is a conscious choice by the user to run an executable attachment from an email or download, but also viewing content that requires a plug-in (Flash, Java or something else). This conscious step breaks down into the following possibilities: don't open email attachments: certainly agree with this. But lets try to be clear: email comes in 2 parts -the text and the attachment. Just reading the email should not be risky, right? But opening (i.e. running) email attachments IS risky (malware can be present in the attachment) don't execute downloads (e.g. from sites linked from in suspect emails or otherwise): again certainly agree with this (malware can be present in the executable). Usually the user has to voluntary click to download, or at least click to run the executable. Question: has there ever been a case where a user has visited a site and a download has completed on its own and run on its own? don't run content requiring plug-ins: certainly agree: malware can be present in the executable. I vaguely recall cases with Flash but know of the Java-based vulnerabilities much better. Now, is the above enough? Note that I'm much more cautious than this. What I'm concerned about is that the media is not always very clear about how the malware infection occurs. They talk of "booby-trapped sites", "browser attacks" - HOW exactly? I'd presume the other threat would be malevolent use of Javascript to make an executable run on the user's machine. Would I be right and are there details I can read up on about this. Generally I like Javascript as a developer, please note. An accepted answer would fill in any holes I've missed here so we have a complete general view of what the threats are (even though the actual specific details of new threats vary, but the general vectors are known).

    Read the article

  • Create a certificate file

    - by saeed hardan
    I have a proxy that I want to test. The proxy generates a private key and a certificate like here . I have tried to copy the content as in the link in a file and name it x.CER , then clicked on it and i got the message : This file is invalid for use as the following : Security Certificate how can i install them on windows ? note: I have set in internet options that all the traffic goes throw the proxy

    Read the article

  • Where should I configure software installed by 3rd-party chef recipes?

    - by FRKT
    I'm provisioning a Vagrant virtual machine with Chef and it's amazing, but I'm unsure where I should put code to configure software installed by 3rd-party chef recipes. For example, I'm installing NGINX with this recipe but I need to configure the default virtual host to serve content from /vagrant/public instead of /var/www/nginx-default. Should I change the template of the 3rd-party recipe, or create another recipe that reconfigures it?

    Read the article

  • source command in Linux

    - by Rodnower
    My question is: why if I run some file with name aliases for example with content such as: alias lsa="ls -a" directly: $ ./aliases it don't create the alias (may be only in script context). But if I run it with command "source": $ source aliases it do the work? I mean after execution the alias "lsa" existing in context of command shell? "man source" give: "No manual entry for source", and in google I just found that it runs Tcl, but why Tcl influence shell context and bush not?

    Read the article

  • How do I configure Gnome 3 so that it doesn't pop up a dialog for 'open with files' when I mount a drive?

    - by michael
    I am running Gnome 3 on Ubuntu 11.10. In the file manager, when I click a drive under 'Devices', Gnome 3 always pops up a dialog with the choices 'open with files' and 'eject' and then I need to click 'open with files' to get rid of that dialog. Is there a way to configure Gnome 3 not to do that? I am in file manager already, clicking a drive should show the content in the right pane. Why does it still ask me to 'open with files'?

    Read the article

  • Force www. on multi domain site and retain http or https [closed]

    - by John Isaacks
    I am using CakePHP which already contains an .htaccess file that looks like: <IfModule mod_rewrite.c> RewriteEngine on RewriteRule ^$ app/webroot/ [L] RewriteRule (.*) app/webroot/$1 [L] </IfModule> I want to force www. (unless it is a subdomain) to avoid duplicate content penalties. It needs to retain http or https Also This application will have multiple domains pointing to it. So the code needs to be able to work with any domain.

    Read the article

  • How to allow only specific directories to use htaccess?

    - by DisgruntledGoat
    Currently in apache2.conf I have AllowOverride all set for /var/www which simply allows htaccess for all the sites on the server (which is Ubuntu, 9.04). However, I'd rather only allow overrides in each site root directory and nothing else. In other words, /var/www/site1, /var/www/site2, etc. can have a htaccess, but all other directories including /var/www and /var/www/site1/content cannot. Is there a way to do this without having to write a rule for every site on the server?

    Read the article

  • IIS, SSL, and Virtual Directories

    - by yodie
    I'm running a webserver on WS 2k3, IIS 6.0. Some of the content is on that server, but most is in a virtual directory linked to another server. Everything works (almost) fine when no SSL is used. However, when using SSL, I cannot access the files in the virtual directory. Instead I get a generic error 500. Any advice?

    Read the article

  • Copying SharePoint DB to a new SharePoint 2010 server

    - by LJe
    Hi - we would like to know what is the best and easy way to configure a new SharePoint 2010 Server, we have backup the existing DB of SharePoint 2007 (up and running). We would like to mirror the same settings and content of our current SharePoint setup to the new server using the SharePoint 2010.

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Gzip not working in browser

    - by Cathal
    According to whatsmyip.org none of my browsers (Firefox, Chrome etc) on W7 are gzip enabled, it's saying 'NO, your browser is not requesting compressed content' which agrees with Chrome developer tools as I was testing a site and it was complaining that the page and css etc weren't compressed. I've searched for an answer but cannot find anything for this. I've tested from another pc connected to the router and that works fine, something on this pc is broke.... Any help tia

    Read the article

  • Cisco 861 Router forces one-to-one NAT

    - by Slurpee
    I have a cisco 861 router that only allows one-to-one NATs in order to access the Internet. I would like for computers to get an address via DHCP from this router, and be able to access the Internet without needing to set a static NAT to one of my public IPs. What is wrong with the configuration? I have a basic understanding of the IOS CLI, most of the configuration file (edited for content) was created by my company's long gone Senior Network Engineer.

    Read the article

  • Windows XP restarts itself suddenly

    - by LaD
    My computer (Windows XP sp3) gets stuck suddenly and restarts itself. When Windows loads I get the following message: error Signature: BCCode : 100000d1 BCP1 : 0000674B BCP2 : 00000002 BCP3 : 00000000 BCP4 : BA9910DC OSVer : 5_1_2600 SP : 3_0 Product : 256_1 error report content: C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\Mini090909-02.dmp C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\sysdata.xml Help! Thanks.

    Read the article

  • Java application delivery through CDN

    - by tuler
    We have a java application bundled as an applet or as webstart. The client java plugin caches the jar files on the client machine and downloads a new version if there is one. Is it possible to deliver this jar files using a CDN? What are the issues involved? Which CDNs would work for jar delivery? Is this different from static content delivery like images or video?

    Read the article

  • How can I configure OSX/Windows7 to send ALL traffic though VPN tunnel?

    - by lrrrgg
    While connected to a VPN (SwissVPN service), a content filter at a site I'm working at blocked a web page. This was perplexing, since the local site's filter should not be able to see my traffic, right? So I assume my web browsing activity was not going through the VPN tunnel. How can I configure the OS to send ALL traffic though the currently connected VPN tunnel? I'm using OSX Lion and Windows 7. Thanks!

    Read the article

  • How to schedule server jobs more intelligently than with cron?

    - by John
    I run a job every minute to reindex my site's content. Today, the search engine died, and when I logged in there were hundreds of orphan processes that had been started by cron. Is there another way using some kind of existing software that will let me execute a job every minute, but that won't launch another instance if that job doesn't return (i.e. because the search engine process has failed)?

    Read the article

  • Which guide do you recommend on setting up Nginx

    - by Saif Bechan
    I am setting up an LEMP (Nginx, MySQL, PHP on Linux) from scratch. There are a lot of guides available online in all different forms. Now I want a setup with virtual hosts, and only serve dynamic content (PHP). My static files(images,css,js) are on a CDN. Do you know of a good guide on setting up the LEMP installation.

    Read the article

  • Encrypt windows 8 file history

    - by SnippetSpace
    File history is great but it saves your files on the external drive without any encryption and stores them using the exact same folder structure as the originals. If a bad guy gets his hands on the hard drive it could basically not be easier to get to your important files. Is there any way to encrypt the file history backup without breaking its functionality and without having to encrypt the original content itself? Thanks for your input!

    Read the article

  • Streaming from a second computer

    - by techgod52
    I play games on my laptop, and they run at about 30-45 fps, which is bearable for me. But when I try to stream, the frame rate drops to 20 or lower, which is unplayable for me. I have a second computer though (a Mac, the laptop is Win7), and I'm wondering if there is anyway to stream the game content (onto Twitch.tv) from my laptop using my Mac. Is this possible, and how would I go about doing it?

    Read the article

  • How to register rss for a website?

    - by domainking
    I am not sure if I ask this question in the right place, because I am new to it. What I want to ask is, do I need to register/create RSS for my website? I have a website, lets say: [http://blog.domain.com] = its a 2.9.2 wordpress blog So, if I want to display the latest content in another subdomain, for example: [news.domain.com], how do I do that? I know a little bit of php and mysql.

    Read the article

  • How to append to a file as sudo? [closed]

    - by obvio171
    Possible Duplicate: sudo unable to write to /etc/profile I want to do: echo "something" >> /etc/config_file But, since only the root user has write permission to this file, I can't do that. But this: sudo echo "something" >> /etc/config_file also doesn't work. Is there any way to append to a file in that situation without having to first open it with a sudo'd editor and then appending the new content by hand?

    Read the article

< Previous Page | 486 487 488 489 490 491 492 493 494 495 496 497  | Next Page >