Search Results

Search found 48839 results on 1954 pages for 'java ee next'.

Page 501/1954 | < Previous Page | 497 498 499 500 501 502 503 504 505 506 507 508  | Next Page >

  • Package <blah> does not exist - NetBeans 6.8 & Windows 7

    - by bjmac
    I'm using NetBeans 6.8 on Windows 7. Upgrade from WinXP and NetBEans 6.7. Now my existing java web app project is no longer able to import/find the packages I've developed. And yet the project still compiles and runs OK. I've tried changing the Java Platform/JDK from 1.6.0_10 back to JDK 1.5.0_22 but I still receive errors package does not exist. All other libraries and packages are able to import OK ...

    Read the article

  • GlassFish change port of web-service

    - by Dror
    Hi, I am new to Java and Linux. I have a JSP site and a java web service deployed on a GlassFish server (working OK). I need to change the port of both the application and web-service. I have changed the listener port in the domain.xml file, but the web application is still trying to connect to the WSDL on port 8080. How can I change the configuration of the web service port? Thanks

    Read the article

  • set JAVA_HOME in windows but "ant build" still fails

    - by patrickinmpls
    I set JAVA_HOME in windows environment preferences echo %JAVA_HOME% C:\Program Files (x86)\Java\jdk1.6.0_20 but then I try to run ant build and I get Perhaps JAVA_HOME does not point to the JDK. It is currently set to "C:\Program Files\Java\jre6" I think the registry key JAVASOFT is interfering with my environment variable, but I'm not sure how to fix this

    Read the article

  • Is there a way to automatically keep Chrome/Ask Tool Bar from installing?

    - by hydroparadise
    So of lately, I've had to warn my users to watch out for unwanted programs that are coming in with Adobe Flash and Java updates. Adobe seems to be pushing Google's Chrome and Java with the Ask.com Toolbar. I admit that it could be much worse because both instance simply require an uncheck during some point of the update process, but on a large scale, prevention is better than confrontation. Any suggestions?

    Read the article

  • How to determine JAVA_HOME on Debian/Ubuntu?

    - by Witek
    On Ubuntu it is possible to have multiple JVMs at the same time. The default one is selected with update-alternatives. But this does not set the JAVA_HOME environment variable, due to a debian policy. I am writing a launcher script (bash), which starts a java application. This java application needs the JAVA_HOME environment variable. So how to get the path of the JVM which is currently selected by update-alternatives?

    Read the article

  • Error:Unable to acsess jarfile

    - by user2539617
    Whenever I turn on my HP Pavilion slimline (type of computer) it says Error:Unable to acsess jarfile C:/Users/Private/Appdata/RoamingServer258261055 The tab name is Java Virtual Machine Launcher Somehow. This effects me connecting to java programs that require online on a downloaded platform such as .exe or .bin. So if you try to login on Minecraft it won't connect. Raidcall,Skype,Sony Vegas. I really need help!

    Read the article

  • debugging JBoss 100% CPU usage

    - by Nate
    We are using JBoss to run two of our WARs. One is our web app, the other is our web service. The web app accesses a database on another machine and makes requests to the web service. The web service makes JMS requests to other machines, aggregates the data, and returns it. At our biggest client, about once a month the JBoss Java process takes 100% of all CPUs. The machine running JBoss has 8 CPUs. Our web app is still accessible during this time, however pages take about 3 minutes to load. Restarting JBoss restores everything to normal. The database machine and all the other machines are fine, only the machine running JBoss is affected. Memory usage is normal. Network utilization is normal. There are no suspect error messages in the JBoss logs. I have set up a test environment as close as possible to the client's production environment and I've done load testing with as much as 2x the number of concurrent users. I have not gotten my test environment to replicate the problem. Where do we go from here? How can we narrow down the problem? Currently the only plan we have is to wait until the problem occurs in production on its own, then do some debugging to determine the cause. So far people have just restarted JBoss when the problem occurred to minimize down time. Next time it happens they will get a developer to take a look. The question is, next time it happens, what can be done to determine the cause? We could setup a separate JBoss instance on the same box and install the web app separately from the web service. This way when the problem next occurs we will know which WAR has the problem (assuming it is our code). This doesn't narrow it down much though. Should I enable JMX remote? This way the next time the problem occurs I can connect with VisualVM and see which threads are taking the CPU and what the hell they are doing. However, is there a significant down side to enabling JMX remote in a production environment? Is there another way to see what threads are eating the CPU and to get a stacktrace to see what they are doing? Any other ideas? Thanks!

    Read the article

  • Synchronizing issue: I want the main thread to be run before another thread but it sometimes doesn´t

    - by Rox
    I have done my own small concurrency framework (just for learning purposes) inspired by the java.util.concurrency package. This is about the Callable/Future mechanism. My code below is the whole one and is compilable and very easy to understand. My problem is that sometimes I run into a deadlock where the first thread (the main thread) awaits for a signal from the other thread. But then the other thread has already notified the main thread before the main thread went into waiting state, so the main thread cannot wake up. FutureTask.get() should always be run before FutureTask.run() but sometimes the run() method (which is called by new thread) runs before the get() method (which is called by main thread). I don´t know how I can prevent that. This is a pseudo code of how I want the two threads to be run. //From main thread: Executor.submit().get() (in get() the main thread waits for new thread to notify) ->submit() calls Executor.execute(FutureTask object) -> execute() starts new thread -> new thread shall notify `main thread` I cannot understand how the new thread can start up and run faster than the main thread that actually starts the new thread. Main.java: public class Main { public static void main(String[] args) { new ExecutorServiceExample(); } public Main() { ThreadExecutor executor = new ThreadExecutor(); Integer i = executor.submit(new Callable<Integer>() { @Override public Integer call() { return 10; } }).get(); System.err.println("Value: "+i); } } ThreadExecutor.java: public class ThreadExecutor { public ThreadExecutor() {} protected <V> RunnableFuture<V> newTaskFor(Callable c) { return new FutureTask<V>(c); } public <V> Future<V> submit(Callable<V> task) { if (task == null) throw new NullPointerException(); RunnableFuture<V> ftask = newTaskFor(task); execute(ftask); return ftask; } public void execute(Runnable r) { new Thread(r).start(); } } FutureTask.java: import java.util.concurrent.locks.Condition; import java.util.concurrent.locks.ReentrantLock; import java.util.logging.Level; import java.util.logging.Logger; public class FutureTask<V> implements RunnableFuture<V> { private Callable<V> callable; private volatile V result; private ReentrantLock lock = new ReentrantLock(); private Condition condition = lock.newCondition(); public FutureTask(Callable callable) { if (callable == null) throw new NullPointerException(); this.callable = callable; } @Override public void run() { acquireLock(); System.err.println("RUN"+Thread.currentThread().getName()); V v = this.callable.call(); set(v); condition.signal(); releaseLock(); } @Override public V get() { acquireLock(); System.err.println("GET "+Thread.currentThread().getName()); try { condition.await(); } catch (InterruptedException ex) { Logger.getLogger(FutureTask.class.getName()).log(Level.SEVERE, null, ex); } releaseLock(); return this.result; } public void set(V v) { this.result = v; } private void acquireLock() { lock.lock(); } private void releaseLock() { lock.unlock(); } } And the interfaces: public interface RunnableFuture<V> extends Runnable, Future<V> { @Override void run(); } public interface Future<V> { V get(); } public interface Callable<V> { V call(); }

    Read the article

  • is it right to call ejb bean from thread by ThreadPoolExecutor?

    - by kislo_metal
    I trying to call some ejb bean method from tread. and getting error : (as is glassfish v3) Log Level SEVERE Logger javax.enterprise.system.std.com.sun.enterprise.v3.services.impl Name-Value Pairs {_ThreadName=Thread-1, _ThreadID=42} Record Number 928 Message ID java.lang.NullPointerException at ua.co.rufous.server.broker.TempLicService.run(TempLicService.java Complete Message 35) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:637) here is tread public class TempLicService implements Runnable { String hash; //it`s Stateful bean @EJB private LicActivatorLocal lActivator; public TempLicService(String hash) { this.hash= hash; } @Override public void run() { lActivator.proccessActivation(hash); } } my ThreadPoolExecutor public class RequestThreadPoolExecutor extends ThreadPoolExecutor { private boolean isPaused; private ReentrantLock pauseLock = new ReentrantLock(); private Condition unpaused = pauseLock.newCondition(); private static RequestThreadPoolExecutor threadPool; private RequestThreadPoolExecutor() { super(1, Integer.MAX_VALUE, 10, TimeUnit.SECONDS, new LinkedBlockingQueue<Runnable>()); System.out.println("RequestThreadPoolExecutor created"); } public static RequestThreadPoolExecutor getInstance() { if (threadPool == null) threadPool = new RequestThreadPoolExecutor(); return threadPool; } public void runService(Runnable task) { threadPool.execute(task); } protected void beforeExecute(Thread t, Runnable r) { super.beforeExecute(t, r); pauseLock.lock(); try { while (isPaused) unpaused.await(); } catch (InterruptedException ie) { t.interrupt(); } finally { pauseLock.unlock(); } } public void pause() { pauseLock.lock(); try { isPaused = true; } finally { pauseLock.unlock(); } } public void resume() { pauseLock.lock(); try { isPaused = false; unpaused.signalAll(); } finally { pauseLock.unlock(); } } public void shutDown() { threadPool.shutdown(); } //<<<<<< creating thread here public void runByHash(String hash) { Runnable service = new TempLicService(hash); threadPool.runService(service); } } and method where i call it (it is gwt servlet, but there is no proble to call thread that not contain ejb) : @Override public Boolean submitHash(String hash) { System.out.println("submiting hash"); try { if (tBoxService.getTempLicStatus(hash) == 1) { //<<< here is the call RequestThreadPoolExecutor.getInstance().runByHash(hash); return true; } } catch (NoResultException e) { e.printStackTrace(); } return false; } I need to organize some pool of submitting hash to server (calls of LicActivator bean), is ThreadPoolExecutor design good idea and why it is not working in my case? (as I know we can`t create thread inside bean, but could we call bean from different threads? ). If No, what is the bast practice for organize such request pool? Thanks. << Answer: I am using DI (EJB 3.1) soo i do not need any look up here. (application packed in ear and both modules in it (web module and ejb), it works perfect for me). But I can use it only in managed classes. So.. 2.Can I use manual look up in Tread ? Could I use Bean that extends ThreadPoolExecutor and calling another bean that implements Runnable ? Or it is not allowed ?

    Read the article

  • applet does not load

    - by jcp
    We have a legacy program that was ported from Java 1.3 to Java 1.5. This application involves applets which worked fine before. After porting however, the applet would not load. However there are no errors or exceptions. The app would just try to load it forever. We tried to run it with Java 1.6 and poof! No problems whatsoever. Isn't Java 6 backwards compatible? So how come it would run in that version and not in 1.5? ==== Java Console log for Java 1.5.0_19 basic: Registered modality listener basic: Registered modality listener basic: Registered modality listener liveconnect: Invoking JS method: document liveconnect: Invoking JS method: document liveconnect: Invoking JS method: document liveconnect: Invoking JS method: URL liveconnect: Invoking JS method: URL liveconnect: Invoking JS method: URL basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=1 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=2 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Added progress listener: sun.plugin.util.GrayBoxPainter@b0bad7 basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Added progress listener: sun.plugin.util.GrayBoxPainter@ba9340 basic: Added progress listener: sun.plugin.util.GrayBoxPainter@1198891 basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 network: Connecting <something>.jar with proxy=HTTP @ proxy/<ip address> basic: Loading <something>.jar from cache basic: No certificate info, this is unsigned JAR file. Left START init() Left END init() Right START init() Control start() Waiting for Left Panel to load... Right START start() network: Connecting socket://<ip address>:14444 with proxy=DIRECT Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... my HostName : <ip address> Thread-19 Check : Thread-19 Check : Monitor : run : start Thread-20 Monitor : Monitor: run() start Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... the last message goes on forever... and now with the working version: ==== Java Console log for Java 1.6.0_15 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@1b000e7 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@12611a7 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@1807ca8 network: CleanupThread used 6 us network: CleanupThread used 5 us network: CleanupThread used 6 us cache: Skip blacklist check as cached value is ok. network: Cache entry found [url: <something>.jar, version: null] network: Connecting <something>.jar with proxy=HTTP @ proxy/<ip address> network: ResponseCode for <something>.jar : 304 network: Encoding for <something>.jar : null network: Disconnect connection to <something>.jar Reading certificates from 11 <something>.jar | <something>.idx network: No certificate info for unsigned JAR file: <something>.jar basic: Applet loaded. basic: Applet loaded. basic: Applet resized and added to parent container basic: Applet resized and added to parent container basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27768955 us, TotalTime: 28099230 us Right START init() basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27770563 us, TotalTime: 28100838 us Left START init() basic: Applet loaded. basic: Applet resized and added to parent container basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27779332 us, TotalTime: 28109607 us Left END init() basic: Applet initialized basic: Removed progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@12611a7 basic: Applet made visible And that's it. Still haven't figured out why it works with java6 and not java5. @valli: the object tag was used, not applet @thorbjorn: i tried that already... it just keeps saying loading applet... @aaron: how can i know what exception it is, if there really is one? and yes we have considered that its a java bug but i still havent found what that bug is. i have to submit a report tomorrow and i've scoured the net but came up with nothing as of yet... @all: thank you for your replies

    Read the article

  • o display an image

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • Using only alphanumeric characters(a-z) inside toCharArray

    - by Aaron
    Below you will find me using toCharArray in order to send a string to array. I then MOVE the value of the letter using a for statement... for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } However, when I use shiftCode to move the value such as... a shifted by -1; I get a symbol @. Is there a way to send the string to shiftCode or tell shiftCode to ONLY use letters? I need it to see my text, like "aaron", and when I use the for statement iterate through a-z only and ignore all symbols and numbers. I THINK it is as simple as... letter=codeWord.toCharArray(a,z); But trying different forms of that and googling it didn't give me any results. Perhaps it has to do with regex or something? Below you will find a complete copy of my program; it works exactly how I want it to do; but it iterates through letters and symbols. I also tried finding instructions online for toCharArray but if there exists any arguments I can't locate them. My program... import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Aaron L. Jones * CS219 * AaronJonesProg3 * * This program is designed to - * Work as a Ceasar Cipher */ /** * * Aaron Jones */ public class AaronJonesProg3 { static String codeWord; static int shiftCode; static int i; static char[] letter; /** * @param args the command line arguments */ public static void main(String[] args) throws IOException { // Instantiating that Buffer Class // We are going to use this to read data from the user; in buffer // For performance related reasons BufferedReader reader; // Building the reader variable here // Just a basic input buffer (Holds things for us) reader = new BufferedReader(new InputStreamReader(System.in)); // Java speaks to us here / We get it to query our user System.out.print("Please enter text to encrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); /**************************************************************** **************************************************************** ***************************************************************/ // Java speaks to us here / We get it to query our user System.out.print("Please enter text to decrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); } }

    Read the article

  • Watching a variable for changes without polling.

    - by milkfilk
    I'm using a framework called Processing which is basically a Java applet. It has the ability to do key events because Applet can. You can also roll your own callbacks of sorts into the parent. I'm not doing that right now and maybe that's the solution. For now, I'm looking for a more POJO solution. So I wrote some examples to illustrate my question. Please ignore using key events on the command line (console). Certainly this would be a very clean solution but it's not possible on the command line and my actual app isn't a command line app. In fact, a key event would be a good solution for me but I'm trying to understand events and polling beyond just keyboard specific problems. Both these examples flip a boolean. When the boolean flips, I want to fire something once. I could wrap the boolean in an Object so if the Object changes, I could fire an event too. I just don't want to poll with an if() statement unnecessarily. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Example of checking a variable for changes. * Uses dumb if() and polls continuously. */ public class NotAvoidingPolling { public static void main(String[] args) { boolean typedA = false; String input = ""; System.out.println("Type 'a' please."); while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic if (input.equals("a")) { typedA = true; } else { typedA = false; } // problem: this is polling. if (typedA) System.out.println("Typed 'a'."); } } } Running this outputs: Type 'a' please. a Typed 'a'. On some forums people suggested using an Observer. And although this decouples the event handler from class being observed, I still have an if() on a forever loop. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; import java.util.Observable; import java.util.Observer; /* * Example of checking a variable for changes. * This uses an observer to decouple the handler feedback * out of the main() but still is polling. */ public class ObserverStillPolling { boolean typedA = false; public static void main(String[] args) { // this ObserverStillPolling o = new ObserverStillPolling(); final MyEvent myEvent = new MyEvent(o); final MyHandler myHandler = new MyHandler(); myEvent.addObserver(myHandler); // subscribe // watch for event forever Thread thread = new Thread(myEvent); thread.start(); System.out.println("Type 'a' please."); String input = ""; while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic // but it's decoupled now because there's no handler here. if (input.equals("a")) { o.typedA = true; } } } } class MyEvent extends Observable implements Runnable { // boolean typedA; ObserverStillPolling o; public MyEvent(ObserverStillPolling o) { this.o = o; } public void run() { // watch the main forever while (true) { // event fire if (this.o.typedA) { setChanged(); // in reality, you'd pass something more useful notifyObservers("You just typed 'a'."); // reset this.o.typedA = false; } } } } class MyHandler implements Observer { public void update(Observable obj, Object arg) { // handle event if (arg instanceof String) { System.out.println("We received:" + (String) arg); } } } Running this outputs: Type 'a' please. a We received:You just typed 'a'. I'd be ok if the if() was a NOOP on the CPU. But it's really comparing every pass. I see real CPU load. This is as bad as polling. I can maybe throttle it back with a sleep or compare the elapsed time since last update but this is not event driven. It's just less polling. So how can I do this smarter? How can I watch a POJO for changes without polling? In C# there seems to be something interesting called properties. I'm not a C# guy so maybe this isn't as magical as I think. private void SendPropertyChanging(string property) { if (this.PropertyChanging != null) { this.PropertyChanging(this, new PropertyChangingEventArgs(property)); } }

    Read the article

  • Injection of an EJB into a web java class under JBoss 7.1.1

    - by Dobbo
    I am trying to build a website using JBoss 7.1.1 and RESTeasy. I have managed to constructed and deploy and EAR with a both a WAR and an EJB-JAR contained within: voyager-app.ear META-INF/MANIFEST.MF META-INF/application.xml META-INF/jboss-app.xml lib/voyager-lib.jar voyager-adm.war voyager-ejb.jar voyager-web.war So far things are very simple. voyager-adm.war & voyager-lib.jar are empty (just the manifest file) but I know that I'm going to have code for them shortly. There is just one Stateful EJB - HarbourMasterBean (with just a local interface) and a few Database Entity Beans in the EJB jar file: voyager-ejb.jar META-INF/MANIFEST.MF META-INF/persistence.xml com/nutrastat/voyager/db/HarbourMasterBean.class com/nutrastat/voyager/db/HarbourMasterLocal.class com/nutrastat/voyager/db/PortEntity.class com/nutrastat/voyager/db/ShipEntity.class As far as I can tell the EJBs deploy correctly because the database units are created and the log shows that the publication of some HarbourMaster references: java:global/voyager-app/voyager-ejb/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:app/voyager-ejb/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:module/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:global/voyager-app/voyager-ejb/harbour-master java:app/voyager-ejb/harbour-master java:module/harbour-master The problem lies in getting the HarbourMaster EJB injected into my web bean. The reference to it is alway NULL no matter what I try. voyager-web.war META-INF/MANIFEST.MF WEB-INF/web.xml WEB-INF/classes/com/nutrastat/voyager/web/ WEB-INF/classes/com/nutrastat/voyager/web/Ships.class WEB-INF/classes/com/nutrastat/voyager/web/VoyagerApplication.class Ships.java: @Path("fleet") public class Ships { protected transient final Logger log; @EJB private HarbourMasterLocal harbourMaster; public Ships() { log = LoggerFactory.getLogger(getClass()); } @GET @Path("ships") @Produces({"text/plain"}) public String listShips() { if (log.isDebugEnabled()) log.debug("Harbour master value: " + harbourMaster); return "Harbour Master: " + harbourMaster; } } &lt;web-app xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd" version="3.0" &gt; <display-name>Voyager Web Application</display-name> <listener> <listener-class> org.jboss.resteasy.plugins.server.servlet.ResteasyBootstrap </listener-class> </listener> <servlet> <servlet-name>Resteasy</servlet-name> <servlet-class> org.jboss.resteasy.plugins.server.servlet.HttpServletDispatcher </servlet-class> <init-param> <param-name> javax.ws.rs.Application </param-name> <param-value> com.nutrastat.voyager.web.VoyagerApplication </param-value> </init-param> </servlet> <servlet-mapping> <servlet-name>Resteasy</servlet-name> <url-pattern>/*</url-pattern> </servlet-mapping> &lt;/web-app&gt; I have been searching the web for an answer and read a number of places, both on StackOverflow and elsewhere that suggests is can be done, and that the problems lies with configuration. But they post only snippets and I'm never sure if I'm doing things correctly. Many thanks for any help you can provide. Dobbo

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do I prevent my form from freezing when it is loading an image from the web at the click of a button?

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • maven-ear-plugin works if jboss version is 4.2, but not 5. Why ?

    - by NSINGH
    I am using maven to configure maven-ear-plugin. I am getting following exception when I say jboss version is 5 (See below code, under tag). It works if I replace version to 4.2 <build> <finalName>tactical</finalName> <plugins> <plugin> <artifactId>maven-ear-plugin</artifactId> <configuration> <version>5</version> <defaultJavaBundleDir>lib</defaultJavaBundleDir> <jboss> <version>5</version> <loader-repository>seam.jboss.org:loader=tactical</loader-repository> </jboss> <modules> <ejbModule> <groupId>${project.groupId}</groupId> <artifactId>tactical-jar</artifactId> </ejbModule> </modules> </configuration> </plugin> </plugins> </build> Why it works fine for jboss 4.2 but not for 5. What ?? I get the following exception: [INFO] Failed to initialize JBoss configuration Embedded error: Invalid JBoss configuration, version[5] is not supported. [INFO] ------------------------------------------------------------------------ [INFO] Trace org.apache.maven.lifecycle.LifecycleExecutionException: Failed to initialize JBoss configuration at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:583) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoalWithLifecycle(DefaultLifecycleExecutor.java:49 9) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoal(DefaultLifecycleExecutor.java:478) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoalAndHandleFailures(DefaultLifecycleExecutor.jav a:330) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeTaskSegments(DefaultLifecycleExecutor.java:291) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.execute(DefaultLifecycleExecutor.java:142) at org.apache.maven.DefaultMaven.doExecute(DefaultMaven.java:336) at org.apache.maven.DefaultMaven.execute(DefaultMaven.java:129) at org.apache.maven.cli.MavenCli.main(MavenCli.java:287) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.codehaus.classworlds.Launcher.launchEnhanced(Launcher.java:315) at org.codehaus.classworlds.Launcher.launch(Launcher.java:255) at org.codehaus.classworlds.Launcher.mainWithExitCode(Launcher.java:430) at org.codehaus.classworlds.Launcher.main(Launcher.java:375) Caused by: org.apache.maven.plugin.MojoExecutionException: Failed to initialize JBoss configuration at org.apache.maven.plugin.ear.AbstractEarMojo.execute(AbstractEarMojo.java:159) at org.apache.maven.plugin.ear.GenerateApplicationXmlMojo.execute(GenerateApplicationXmlMojo.java:96) at org.apache.maven.plugin.DefaultPluginManager.executeMojo(DefaultPluginManager.java:451) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:558) ... 16 more Caused by: org.apache.maven.plugin.ear.EarPluginException: Invalid JBoss configuration, version[5] is not supported. at org.apache.maven.plugin.ear.JbossConfiguration.(JbossConfiguration.java:95) at org.apache.maven.plugin.ear.AbstractEarMojo.initializeJbossConfiguration(AbstractEarMojo.java:296) at org.apache.maven.plugin.ear.AbstractEarMojo.execute(AbstractEarMojo.java:155) ... 19 more [INFO] ------------------------------------------------------------------------ [INFO] Total time: 2 seconds Any idea. Thanks

    Read the article

  • Error showing is NullPointerException [duplicate]

    - by user3659612
    This question already has an answer here: How to check a string against null in java? 11 answers I was trying to code a wifi scanner which does 20 scans but it shows NullPointerException at if(bssid[j].equals(null)){ My code is slightly huge package com.example.scanner; import java.io.File; import java.io.FileNotFoundException; import java.io.FileOutputStream; import java.io.IOException; import java.io.OutputStreamWriter; import java.text.SimpleDateFormat; import java.util.Date; import java.util.List; import android.annotation.SuppressLint; import android.content.BroadcastReceiver; import android.content.Context; import android.content.Intent; import android.content.IntentFilter; import android.net.wifi.ScanResult; import android.net.wifi.WifiInfo; import android.net.wifi.WifiManager; import android.os.Bundle; import android.os.Environment; import android.support.v7.app.ActionBarActivity; import android.view.Menu; import android.view.View; import android.widget.ArrayAdapter; import android.widget.Button; import android.widget.ListView; import android.widget.Toast; public class MainActivity extends ActionBarActivity { WifiManager wifi; WifiScanReceiver wifireciever; WifiInfo info; Button scan, save; List<ScanResult> wifilist; ListView list; String wifis[]; String name; String[] ssid = new String[100]; String[] bssid = new String[100]; int[] lvl = new int[100]; int[] count = new int[100]; @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.fragment_main); list=(ListView)findViewById(R.id.listView1); scan=(Button)findViewById(R.id.button1); save=(Button)findViewById(R.id.button2); scan.setOnClickListener(new View.OnClickListener() { @Override public void onClick(View v) { // TODO Auto-generated method stub wifi=(WifiManager)getSystemService(Context.WIFI_SERVICE); if (wifi.isWifiEnabled()==false){ wifi.setWifiEnabled(true); } wifireciever = new WifiScanReceiver(); for (int i=0;i<20;i++){ registerReceiver(wifireciever, new IntentFilter(WifiManager.SCAN_RESULTS_AVAILABLE_ACTION)); wifi.startScan(); if (i==19){ Toast.makeText(getBaseContext(), "Scan Finish", Toast.LENGTH_LONG).show(); } } } }); save.setOnClickListener(new View.OnClickListener() { @Override public void onClick(View v) { // TODO Auto-generated method stub savedata(); } }); } protected void savedata() { // TODO Auto-generated method stub try { File sdcard = Environment.getExternalStorageDirectory(); File directory = new File(sdcard.getAbsolutePath() + "/WIFI_RESULT"); directory.mkdirs(); name = new SimpleDateFormat("yyyy-MM-dd HH mm ss").format(new Date()); File file = new File(directory,name + "wifi_data.txt"); FileOutputStream fou = new FileOutputStream(file); OutputStreamWriter osw = new OutputStreamWriter(fou); try { for (int i =0; i < list.getCount(); i++){ osw.append(list.getItemAtPosition(i).toString()); } osw.flush(); osw.close(); Toast.makeText(getBaseContext(), "Saved", Toast.LENGTH_LONG).show(); } catch (IOException e){ e.printStackTrace(); } } catch (FileNotFoundException e){ e.printStackTrace(); } } class WifiScanReceiver extends BroadcastReceiver { @SuppressLint("UseValueOf") public void onReceive(Context c, Intent intent) { int a =0; wifi.startScan(); List<ScanResult> wifilist = wifi.getScanResults(); if (a<wifilist.size()){ a=wifilist.size(); } for(int j=0;j<wifilist.size();j++){ if(bssid[j].equals(null)){ ssid[j] = wifilist.get(j).SSID.toString(); bssid[j] = wifilist.get(j).BSSID.toString(); lvl[j] = wifilist.get(j).level; count[j]++; } else if (bssid[j].equals(wifilist.get(j).BSSID.toString())){ lvl[j] = lvl[j] + wifilist.get(j).level; count[j]++; } } wifis = new String[a]; for (int i =0; i<a; i++){ wifis[i] = ("\n" + ssid[i] + "\n AP Address" + bssid[i] + "\n Signal Strength:" + lvl[i]/count[i]).toString(); } list.setAdapter(new ArrayAdapter<String>(getApplicationContext(), android.R.layout.simple_list_item_1,wifis)); } } protected void onDestroy() { unregisterReceiver(wifireciever); super.onPause(); } protected void onResume() { registerReceiver(wifireciever, new IntentFilter(WifiManager.SCAN_RESULTS_AVAILABLE_ACTION)); super.onResume(); } @Override public boolean onCreateOptionsMenu(Menu menu) { // Inflate the menu; this adds items to the action bar if it is present. getMenuInflater().inflate(R.menu.main, menu); return true; } } NullPointerException at that point mean my array bssid isn't initialize. So I just want to know how to initialize it in main activity so that I can use that string bssid anywhere.

    Read the article

  • Prepping the Raspberry Pi for Java Excellence (part 1)

    - by HecklerMark
    I've only recently been able to begin working seriously with my first Raspberry Pi, received months ago but hastily shelved in preparation for JavaOne. The Raspberry Pi and other diminutive computing platforms offer a glimpse of the potential of what is often referred to as the embedded space, the "Internet of Things" (IoT), or Machine to Machine (M2M) computing. I have a few different configurations I want to use for multiple Raspberry Pis, but for each of them, I'll need to perform the following common steps to prepare them for their various tasks: Load an OS onto an SD card Get the Pi connected to the network Load a JDK I've been very happy to see good friend and JFXtras teammate Gerrit Grunwald document how to do these things on his blog (link to article here - check it out!), but I ran into some issues configuring wi-fi that caused me some needless grief. Not knowing if any of the pitfalls were caused by my slightly-older version of the Pi and not being able to find anything specific online to help me get past it, I kept chipping away at it until I broke through. The purpose of this post is to (hopefully) help someone else recognize the same issues if/when they encounter them and work past them quickly. There is a great resource page here that covers several ways to get the OS on an SD card, but here is what I did (on a Mac): Plug SD card into reader on/in Mac Format it (FAT32) Unmount it (diskutil unmountDisk diskn, where n is the disk number representing the SD card) Transfer the disk image for Debian to the SD card (dd if=2012-08-08-wheezy-armel.img of=/dev/diskn bs=1m) Eject the card from the Mac (diskutil eject diskn) There are other ways, but this is fairly quick and painless, especially after you do it several times. Yes, I had to do that dance repeatedly (minus formatting) due to the wi-fi issues, as it kept killing the ability of the Pi to boot. You should be able to dramatically reduce the number of OS loads you do, though, if you do a few things with regard to your wi-fi. Firstly, I strongly recommend you purchase the Edimax EW-7811Un wi-fi adapter. This adapter/chipset has been proven with the Raspberry Pi, it's tiny, and it's cheap. Avoid unnecessary aggravation and buy this one! Secondly, visit this page for a script and instructions regarding how to configure your new wi-fi adapter with your Pi. Here is the rub, though: there is a missing step. At least for my combination of Pi version, OS version, and uncanny gift of timing and luck there was. :-) Here is the sequence of steps I used to make the magic happen: Plug your newly-minted SD card (with OS) into your Pi and connect a network cable (for internet connectivity) Boot your Pi. On the first boot, do the following things: Opt to have it use all space on the SD card (will require a reboot eventually) Disable overscan Set your timezone Enable the ssh server Update raspi-config Reboot your Pi. This will reconfigure the SD to use all space (see above). After you log in (UID: pi, password: raspberry), upgrade your OS. This was the missing step for me that put a merciful end to the repeated SD card re-imaging and made the wi-fi configuration trivial. To do so, just type sudo apt-get upgrade and give it several minutes to complete. Pour yourself a cup of coffee and congratulate yourself on the time you've just saved.  ;-) With the OS upgrade finished, now you can follow Mr. Engman's directions (to the letter, please see link above), download his script, and let it work its magic. One aside: I plugged the little power-sipping Edimax directly into the Pi and it worked perfectly. No powered hub needed, at least in my configuration. To recap, that OS upgrade (at least at this point, with this combination of OS/drivers/Pi version) is absolutely essential for a smooth experience. Miss that step, and you're in for hours of "fun". Save yourself! I'll pick up next time with more of the Java side of the RasPi configuration, but as they say, you have to cross the moat to get into the castle. Hopefully, this will help you do just that. Until next time! All the best, Mark 

    Read the article

  • NetBeans Podcast 69

    - by TinuA
    Podcast Guests: Terrence Barr, Simon Ritter, Jaroslav Tulach (It's an all-Oracle lineup!) Download mp3: 47 Minutes – 39.5 mb Subscribe on iTunes NetBeans Community News with Geertjan and Tinu If you missed the first two Java Virtual Developer Day events in early May, there's still one more LIVE training left on May 28th. Sign up here to participate live in the APAC time zone or watch later ON DEMAND. Video: Get started with Vaadin development using NetBeans IDE NetBeans IDE was at JavaCro 2014 and at Hippo Get-together 2014 Another great lineup is in the works for NetBeans Day at JavaOne 2014. More details coming soon! NetBeans' Facebook page is almost at 40,000 Likes! Help us crack that milestone in the next few weeks! Other great ways to stay updated about NetBeans? Twitter and Google+. 09:28 / Terrence Barr - What to Know about Java Embedded Terrence Barr, a Senior Technologist and Principal Product Manager for Embedded and Mobile technologies at Oracle, discusses new features of the Java SE Embedded and Java ME Embedded platforms, and sheds some light on the differences between them and what they have to offer to developers. Learn more about Java SE Embedded Tutorial: Using Oracle Java SE Embedded Support in NetBeans IDE Learn more about Java ME Embedded Video: NetBeans IDE Support for Java ME 8 Video: Installing and Using Java ME SDK 8.0 Plugins in NetBeans IDE Follow Terrence Barr to keep up with news in the Embedded space: Blog and Twitter 26:02 / Simon Ritter - A Massive Serving of Raspberry Pi Oracle's Raspberry Pi virtual course is back by popular demand! Simon Ritter, the head of Oracle's Java Technology Evangelism team, chats about the second run of the free Java Embedded course (starting May 30th), what participants can expect to learn, NetBeans' support for Java ME development, and other Java trainings coming to a desktop, laptop or user group near you. Sign up for the Oracle MOOC: Develop Java Embedded Applications Using Raspberry Pi Find out when Simon Ritter and the Java Evangelism team are coming to a Java event or JUG in your area--follow them on Twitter: Simon Ritter Angela Caicedo Steven Chin Jim Weaver 36:58 / Jaroslav Tulach - A Perfect Translation Jaroslav Tulach returns to the NetBeans podcast with tales about the Japanese translation of the Practical API Design book, which he contends surpasses all previous translations, including the English edition! Order "Practical API Design" (Japanese Version)  Find out why the Japanese translation is the best edition yet *Have ideas for NetBeans Podcast topics? Send them to ">nbpodcast at netbeans dot org. *Subscribe to the official NetBeans page on Facebook! Check us out as well on Twitter, YouTube, and Google+.

    Read the article

  • VS20 next, test frameworks and what you want to see?

    - by andrewstopford
    VS2010 is right around the corner and thoughts now turn to the next version of VS. One thing I am seeking dear reader is how in the next version you would like to improve how VS interacts with test frameworks and tools, could that be made better and what would you most want to see (better reporting, better interaction with TFS, better templating support for test frameworks etc)?

    Read the article

  • Towards Database Continuous Delivery – What Next after Continuous Integration? A Checklist

    - by Ben Rees
    .dbd-banner p{ font-size:0.75em; padding:0 0 10px; margin:0 } .dbd-banner p span{ color:#675C6D; } .dbd-banner p:last-child{ padding:0; } @media ALL and (max-width:640px){ .dbd-banner{ background:#f0f0f0; padding:5px; color:#333; margin-top: 5px; } } -- Database delivery patterns & practices STAGE 4 AUTOMATED DEPLOYMENT If you’ve been fortunate enough to get to the stage where you’ve implemented some sort of continuous integration process for your database updates, then hopefully you’re seeing the benefits of that investment – constant feedback on changes your devs are making, advanced warning of data loss (prior to the production release on Saturday night!), a nice suite of automated tests to check business logic, so you know it’s going to work when it goes live, and so on. But what next? What can you do to improve your delivery process further, moving towards a full continuous delivery process for your database? In this article I describe some of the issues you might need to tackle on the next stage of this journey, and how to plan to overcome those obstacles before they appear. Our Database Delivery Learning Program consists of four stages, really three – source controlling a database, running continuous integration processes, then how to set up automated deployment (the middle stage is split in two – basic and advanced continuous integration, making four stages in total). If you’ve managed to work through the first three of these stages – source control, basic, then advanced CI, then you should have a solid change management process set up where, every time one of your team checks in a change to your database (whether schema or static reference data), this change gets fully tested automatically by your CI server. But this is only part of the story. Great, we know that our updates work, that the upgrade process works, that the upgrade isn’t going to wipe our 4Tb of production data with a single DROP TABLE. But – how do you get this (fully tested) release live? Continuous delivery means being always ready to release your software at any point in time. There’s a significant gap between your latest version being tested, and it being easily releasable. Just a quick note on terminology – there’s a nice piece here from Atlassian on the difference between continuous integration, continuous delivery and continuous deployment. This piece also gives a nice description of the benefits of continuous delivery. These benefits have been summed up by Jez Humble at Thoughtworks as: “Continuous delivery is a set of principles and practices to reduce the cost, time, and risk of delivering incremental changes to users” There’s another really useful piece here on Simple-Talk about the need for continuous delivery and how it applies to the database written by Phil Factor – specifically the extra needs and complexities of implementing a full CD solution for the database (compared to just implementing CD for, say, a web app). So, hopefully you’re convinced of moving on the the next stage! The next step after CI is to get some sort of automated deployment (or “release management”) process set up. But what should I do next? What do I need to plan and think about for getting my automated database deployment process set up? Can’t I just install one of the many release management tools available and hey presto, I’m ready! If only it were that simple. Below I list some of the areas that it’s worth spending a little time on, where a little planning and prep could go a long way. It’s also worth pointing out, that this should really be an evolving process. Depending on your starting point of course, it can be a long journey from your current setup to a full continuous delivery pipeline. If you’ve got a CI mechanism in place, you’re certainly a long way down that path. Nevertheless, we’d recommend evolving your process incrementally. Pages 157 and 129-141 of the book on Continuous Delivery (by Jez Humble and Dave Farley) have some great guidance on building up a pipeline incrementally: http://www.amazon.com/Continuous-Delivery-Deployment-Automation-Addison-Wesley/dp/0321601912 For now, in this post, we’ll look at the following areas for your checklist: You and Your Team Environments The Deployment Process Rollback and Recovery Development Practices You and Your Team It’s a cliché in the DevOps community that “It’s not all about processes and tools, really it’s all about a culture”. As stated in this DevOps report from Puppet Labs: “DevOps processes and tooling contribute to high performance, but these practices alone aren’t enough to achieve organizational success. The most common barriers to DevOps adoption are cultural: lack of manager or team buy-in, or the value of DevOps isn’t understood outside of a specific group”. Like most clichés, there’s truth in there – if you want to set up a database continuous delivery process, you need to get your boss, your department, your company (if relevant) onside. Why? Because it’s an investment with the benefits coming way down the line. But the benefits are huge – for HP, in the book A Practical Approach to Large-Scale Agile Development: How HP Transformed LaserJet FutureSmart Firmware, these are summarized as: -2008 to present: overall development costs reduced by 40% -Number of programs under development increased by 140% -Development costs per program down 78% -Firmware resources now driving innovation increased by a factor of 8 (from 5% working on new features to 40% But what does this mean? It means that, when moving to the next stage, to make that extra investment in automating your deployment process, it helps a lot if everyone is convinced that this is a good thing. That they understand the benefits of automated deployment and are willing to make the effort to transform to a new way of working. Incidentally, if you’re ever struggling to convince someone of the value I’d strongly recommend just buying them a copy of this book – a great read, and a very practical guide to how it can really work at a large org. I’ve spoken to many customers who have implemented database CI who describe their deployment process as “The point where automation breaks down. Up to that point, the CI process runs, untouched by human hand, but as soon as that’s finished we revert to manual.” This deployment process can involve, for example, a DBA manually comparing an environment (say, QA) to production, creating the upgrade scripts, reading through them, checking them against an Excel document emailed to him/her the night before, turning to page 29 in his/her notebook to double-check how replication is switched off and on for deployments, and so on and so on. Painful, error-prone and lengthy. But the point is, if this is something like your deployment process, telling your DBA “We’re changing everything you do and your toolset next week, to automate most of your role – that’s okay isn’t it?” isn’t likely to go down well. There’s some work here to bring him/her onside – to explain what you’re doing, why there will still be control of the deployment process and so on. Or of course, if you’re the DBA looking after this process, you have to do a similar job in reverse. You may have researched and worked out how you’d like to change your methodology to start automating your painful release process, but do the dev team know this? What if they have to start producing different artifacts for you? Will they be happy with this? Worth talking to them, to find out. As well as talking to your DBA/dev team, the other group to get involved before implementation is your manager. And possibly your manager’s manager too. As mentioned, unless there’s buy-in “from the top”, you’re going to hit problems when the implementation starts to get rocky (and what tool/process implementations don’t get rocky?!). You need to have support from someone senior in your organisation – someone you can turn to when you need help with a delayed implementation, lack of resources or lack of progress. Actions: Get your DBA involved (or whoever looks after live deployments) and discuss what you’re planning to do or, if you’re the DBA yourself, get the dev team up-to-speed with your plans, Get your boss involved too and make sure he/she is bought in to the investment. Environments Where are you going to deploy to? And really this question is – what environments do you want set up for your deployment pipeline? Assume everyone has “Production”, but do you have a QA environment? Dedicated development environments for each dev? Proper pre-production? I’ve seen every setup under the sun, and there is often a big difference between “What we want, to do continuous delivery properly” and “What we’re currently stuck with”. Some of these differences are: What we want What we’ve got Each developer with their own dedicated database environment A single shared “development” environment, used by everyone at once An Integration box used to test the integration of all check-ins via the CI process, along with a full suite of unit-tests running on that machine In fact if you have a CI process running, you’re likely to have some sort of integration server running (even if you don’t call it that!). Whether you have a full suite of unit tests running is a different question… Separate QA environment used explicitly for manual testing prior to release “We just test on the dev environments, or maybe pre-production” A proper pre-production (or “staging”) box that matches production as closely as possible Hopefully a pre-production box of some sort. But does it match production closely!? A production environment reproducible from source control A production box which has drifted significantly from anything in source control The big question is – how much time and effort are you going to invest in fixing these issues? In reality this just involves figuring out which new databases you’re going to create and where they’ll be hosted – VMs? Cloud-based? What about size/data issues – what data are you going to include on dev environments? Does it need to be masked to protect access to production data? And often the amount of work here really depends on whether you’re working on a new, greenfield project, or trying to update an existing, brownfield application. There’s a world if difference between starting from scratch with 4 or 5 clean environments (reproducible from source control of course!), and trying to re-purpose and tweak a set of existing databases, with all of their surrounding processes and quirks. But for a proper release management process, ideally you have: Dedicated development databases, An Integration server used for testing continuous integration and running unit tests. [NB: This is the point at which deployments are automatic, without human intervention. Each deployment after this point is a one-click (but human) action], QA – QA engineers use a one-click deployment process to automatically* deploy chosen releases to QA for testing, Pre-production. The environment you use to test the production release process, Production. * A note on the use of the word “automatic” – when carrying out automated deployments this does not mean that the deployment is happening without human intervention (i.e. that something is just deploying over and over again). It means that the process of carrying out the deployment is automatic in that it’s not a person manually running through a checklist or set of actions. The deployment still requires a single-click from a user. Actions: Get your environments set up and ready, Set access permissions appropriately, Make sure everyone understands what the environments will be used for (it’s not a “free-for-all” with all environments to be accessed, played with and changed by development). The Deployment Process As described earlier, most existing database deployment processes are pretty manual. The following is a description of a process we hear very often when we ask customers “How do your database changes get live? How does your manual process work?” Check pre-production matches production (use a schema compare tool, like SQL Compare). Sometimes done by taking a backup from production and restoring in to pre-prod, Again, use a schema compare tool to find the differences between the latest version of the database ready to go live (i.e. what the team have been developing). This generates a script, User (generally, the DBA), reviews the script. This often involves manually checking updates against a spreadsheet or similar, Run the script on pre-production, and check there are no errors (i.e. it upgrades pre-production to what you hoped), If all working, run the script on production.* * this assumes there’s no problem with production drifting away from pre-production in the interim time period (i.e. someone has hacked something in to the production box without going through the proper change management process). This difference could undermine the validity of your pre-production deployment test. Red Gate is currently working on a free tool to detect this problem – sign up here at www.sqllighthouse.com, if you’re interested in testing early versions. There are several variations on this process – some better, some much worse! How do you automate this? In particular, step 3 – surely you can’t automate a DBA checking through a script, that everything is in order!? The key point here is to plan what you want in your new deployment process. There are so many options. At one extreme, pure continuous deployment – whenever a dev checks something in to source control, the CI process runs (including extensive and thorough testing!), before the deployment process keys in and automatically deploys that change to the live box. Not for the faint hearted – and really not something we recommend. At the other extreme, you might be more comfortable with a semi-automated process – the pre-production/production matching process is automated (with an error thrown if these environments don’t match), followed by a manual intervention, allowing for script approval by the DBA. One he/she clicks “Okay, I’m happy for that to go live”, the latter stages automatically take the script through to live. And anything in between of course – and other variations. But we’d strongly recommended sitting down with a whiteboard and your team, and spending a couple of hours mapping out “What do we do now?”, “What do we actually want?”, “What will satisfy our needs for continuous delivery, but still maintaining some sort of continuous control over the process?” NB: Most of what we’re discussing here is about production deployments. It’s important to note that you will also need to map out a deployment process for earlier environments (for example QA). However, these are likely to be less onerous, and many customers opt for a much more automated process for these boxes. Actions: Sit down with your team and a whiteboard, and draw out the answers to the questions above for your production deployments – “What do we do now?”, “What do we actually want?”, “What will satisfy our needs for continuous delivery, but still maintaining some sort of continuous control over the process?” Repeat for earlier environments (QA and so on). Rollback and Recovery If only every deployment went according to plan! Unfortunately they don’t – and when things go wrong, you need a rollback or recovery plan for what you’re going to do in that situation. Once you move in to a more automated database deployment process, you’re far more likely to be deploying more frequently than before. No longer once every 6 months, maybe now once per week, or even daily. Hence the need for a quick rollback or recovery process becomes paramount, and should be planned for. NB: These are mainly scenarios for handling rollbacks after the transaction has been committed. If a failure is detected during the transaction, the whole transaction can just be rolled back, no problem. There are various options, which we’ll explore in subsequent articles, things like: Immediately restore from backup, Have a pre-tested rollback script (remembering that really this is a “roll-forward” script – there’s not really such a thing as a rollback script for a database!) Have fallback environments – for example, using a blue-green deployment pattern. Different options have pros and cons – some are easier to set up, some require more investment in infrastructure; and of course some work better than others (the key issue with using backups, is loss of the interim transaction data that has been added between the failed deployment and the restore). The best mechanism will be primarily dependent on how your application works and how much you need a cast-iron failsafe mechanism. Actions: Work out an appropriate rollback strategy based on how your application and business works, your appetite for investment and requirements for a completely failsafe process. Development Practices This is perhaps the more difficult area for people to tackle. The process by which you can deploy database updates is actually intrinsically linked with the patterns and practices used to develop that database and linked application. So you need to decide whether you want to implement some changes to the way your developers actually develop the database (particularly schema changes) to make the deployment process easier. A good example is the pattern “Branch by abstraction”. Explained nicely here, by Martin Fowler, this is a process that can be used to make significant database changes (e.g. splitting a table) in a step-wise manner so that you can always roll back, without data loss – by making incremental updates to the database backward compatible. Slides 103-108 of the following slidedeck, from Niek Bartholomeus explain the process: https://speakerdeck.com/niekbartho/orchestration-in-meatspace As these slides show, by making a significant schema change in multiple steps – where each step can be rolled back without any loss of new data – this affords the release team the opportunity to have zero-downtime deployments with considerably less stress (because if an increment goes wrong, they can roll back easily). There are plenty more great patterns that can be implemented – the book Refactoring Databases, by Scott Ambler and Pramod Sadalage is a great read, if this is a direction you want to go in: http://www.amazon.com/Refactoring-Databases-Evolutionary-paperback-Addison-Wesley/dp/0321774515 But the question is – how much of this investment are you willing to make? How often are you making significant schema changes that would require these best practices? Again, there’s a difference here between migrating old projects and starting afresh – with the latter it’s much easier to instigate best practice from the start. Actions: For your business, work out how far down the path you want to go, amending your database development patterns to “best practice”. It’s a trade-off between implementing quality processes, and the necessity to do so (depending on how often you make complex changes). Socialise these changes with your development group. No-one likes having “best practice” changes imposed on them, so good to introduce these ideas and the rationale behind them early.   Summary The next stages of implementing a continuous delivery pipeline for your database changes (once you have CI up and running) require a little pre-planning, if you want to get the most out of the work, and for the implementation to go smoothly. We’ve covered some of the checklist of areas to consider – mainly in the areas of “Getting the team ready for the changes that are coming” and “Planning our your pipeline, environments, patterns and practices for development”, though there will be more detail, depending on where you’re coming from – and where you want to get to. This article is part of our database delivery patterns & practices series on Simple Talk. Find more articles for version control, automated testing, continuous integration & deployment.

    Read the article

  • The Developer's Conference Florianópolis, Brazil

    - by Tori Wieldt
    by guest blogger Yara Senger With over 2900 developers in person and another 2000 online, The Developer's Conference (TDC) in Florianópolis, Brazil, reminds us that Java is BIG in Brazil. The conference included 20 different tracks, and Java was the most popular track. Java was also a big part of the talks in the IoT, Cloud and BigData tracks. Here's my overview (in Brazilian Portguese): Several JUGs were involved in TDC Florianópolis, serving as track leads, speakers and all-around heros, including SouJava SouJava Campinas GUJava Santa Catarina JUG Vale JUG Maringá Java Bahia GOJava (Goinia) JUG Rio do Sul RS Jug (Rio Grande do Sul) and I thank them for their support and commitment. It is a vibrant and fun community! We saw that the IoT space is maturing rapidly. There are already some related to embedded in the region.  Java Evangelist Bruno Borges and Marco Antonio Maciel gave a view popular talk "Java: Tweet for Beer!" They demonstrated how to make a beer tap controlled by Java and connected to the Internet, using a visual application JavaFX with Java SE 8, running on a Rasperry Pi. Of course, they had to test the application quite throughly.   We Brazilians are training the next generation of Java developers. TDC4Kids was as big success. We made a tour with the kids in all booths and almost everybody talked about Java. Java in government managment (Betha), Java on the 2048  (Oracle), Java on the popcorn machine and Java training (Globalcode & V.Office) and of course: Java & Minecraft! OTN's Pablo Ciccarello was there to support the community.  He did several video interviews with JUG leaders and speakers (mine included). You can watch more videos on his TDC Florianópolis playlist.  Thank you, Oracle and OTN for all your support. We interacted with thousands of Java developers at The Developer's Conference Florianópolis. If you want to join us, we are planning two more conferences this year: The Developer's Conference São Paulo, July  The Developer's Conference Porto Alegre, October 

    Read the article

< Previous Page | 497 498 499 500 501 502 503 504 505 506 507 508  | Next Page >