Search Results

Search found 21197 results on 848 pages for 'webcenter content'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 508/848 | < Previous Page | 504 505 506 507 508 509 510 511 512 513 514 515  | Next Page >

  • How to POST data to an HTTP page from an HTTPS page

    - by buster55
    I know this is a long shot, but I figured I'd ask the question anyway. I have an HTTPS page and am dynamically creating a form. I want to POST the form to an HTTP page. Is this possible without the browser popping up a warning? When I do this on IE8, I get the following message: Do you want to view only the webpage content that was delivered securely? Essentially, I'm asking about the inverse of question 1554237.

    Read the article

  • Free ASP.Net (MVC/WebForms) based CMS which has plugins built in for connecting to Orkut and Faceboo

    - by SharePoint Newbie
    I looking for free ASP.NET based content management system (CMS) which has the following features: Blogs (Admin, some super users can have their own blogs) Forums (Admins can create forums. Some moderation features) Admin Dashboard Integration with LinkedIn, Orkut and Facebook (native or through freely available add-ons) Support for moderated user registration (moderated by Admin) Windows Sharepoint services 3.0 is an option. With some tweaking, it supports all the above and there are free third party web parts available. NB: The CMS listed must be free, as in beer.

    Read the article

  • Is there a way to stop all javascript on the page?

    - by M28
    I need to stop all the javascript running on the page, but I have a limitation: I cannot control the tags content, I am editing the page after it's being loaded. Also, I need to remove all the variables defined by the old script that was running and stop all the intervals.

    Read the article

  • Google App Engine Python Datastore

    - by python appengine
    Basically what Im trying to make is a data structure where it has the users name, id, and datejoined. Then i want a "sub-structure" where it has the users "text" and the date it was modified. and the user will have multiple instances of this text. class User(db.Model): ID = db.IntegerProperty() name = db.StringProperty() datejoined = db.DateTimeProperty(auto_now_add=True) class Content(db.Model): text = db.StringProperty() datemod= db.DateTimeProperty(auto_now_add = True) Is the code set up correctly?

    Read the article

  • Flex 4: use google APIs in RIA without server side code?

    - by grapkulec
    Just to confirm what I think I understand from reading about use of google APIs in RIAs (FLEX 4 and ActionScript) there is no way to connect to blogger API for example, directly from RIA because of google's crossdomain.xml file, right? So if I want to use their APIs to get some data like content of my mailbox or list of posts on my blog I have to have some code running server side and RIA would just use that code as httpservice to collect data from google? Or maybe I got it completly wrong?

    Read the article

  • jQuery equivalent of PHP's file_exists()?

    - by Scott B
    In the code snippet below, from my jQuery setup, I need to check if the image file actually exists and if not, I'd like to substitute a default image. Currently if the file does not exist, I just get a broken image placeholder... $('#myTheme').change ( function() { var myImage = $('#myTheme :selected').text(); $('.selectedImage img').attr('src','../wp-content/themes/myTheme/styles/'+myImage+'/screenshot.jpg'); //if screenshot.jpg does not exist, use "../../default.jpg" instead } );

    Read the article

  • CSS: How to make a Div of text underneath another Div selectable?

    - by jesse
    Hi, I have a few empty Divs on a page that are basically empty boxes to help me position some stuff to make a "liquid" website. Now I've got content underneath these Divs but I can't highlight/click on the links because these empty Divs are blocking it. I've got a reason I need to have the empty Divs to be on the top layer so I need a way to "click through" these Divs. What can I do? Thanks.

    Read the article

  • jQuery load to multiple divs

    - by afcdesign
    I have this code $("body").on({ click: function(event){ event.preventDefault(); var aLink = $(this).attr("href"); $("#content").load(aLink+" #loader", function(){ //Callback here }); $("#crumbbar").load(aLink+' .breadcrumbs', function(){ //Callback here }); } }, "a"); Can this be optimized in such a way that I only have 1 load command?

    Read the article

  • Javascript sliding (preferably jQuery)

    - by jwzk
    I am trying to think of the name of the plugin (or a plugin) that slides content in (up or down). So I have a hidden div, I click on one of the titles/header, it opens the hidden div, if I click on another header it hides the other visible div, and slides up or down the new one. I can't think of it for some reason.. anyone?

    Read the article

  • Triggering jquery event when an element appears on screen

    - by 0al0
    I want to show a fade effect as soon as the element appears on screen. There is a lot of content before this element so if I trigger the efect on document.ready, at certain resolutions the vistors wont´t see it. Is it possible to trigger an event when, after scrolling down, the element becomes visible? I am almost sure I have seen this effect before, but have no idea how to achieve it. Thank you!

    Read the article

  • How do I do a cross domain GET of an XML feed in a WordPress plugin?

    - by MM.
    I would like to use AJAX to display dynamic content via my wordpress plugin. The data source is an xml feed from a remote domain (not owned by me). I have tried using JQuery plugins that use YQL to do cross domain Ajax calls; however, they are geared towards json and tend to return the data to me in a mangled state. My question is, is there a way of obtaining an xml feed using ajax from a remote domain?

    Read the article

  • Date based publishing ASP.NET MVC

    - by kayluhb
    I am building a custom CMS in ASP.NET MVC and one of the requirements is that the content has a start and end date that dictates whether or not the page appears on the site. What is the best approach to this? Should I run some sort of chron job to mark the status of the page according to its publish dates? Does anyone have any resources or advice on the matter?

    Read the article

  • include and Get not working on index

    - by diego
    I have a problem with my index.php, i have this small script that decides what content to deliver <?php $clase = $_GET['clase']; if ($clase == empresa) {include ("empresa.php");} elseif ($clase == productos) {include("productos.php");} else {include ($_SERVER['DOCUMENT_ROOT']."/inicio.html"); } ?> it works when i go to www.mysite.com/index.php but when i go to www.mysite.com it doesnt and i cant just figure our why.

    Read the article

  • How to test chrome extensions?

    - by swampsjohn
    Is there a good way to do this? I'm writing an extension that interacts with a website as a content script and saves data using localstorage. Are there any tools, frameworks, etc. that I can use to test this behavior? I realize there are some generic tools for testing javascript, but are those sufficiently power to test an extension? Unit testing is most important, but I'm also interested in other types of testing (such as integration testing).

    Read the article

  • How to display a page in my browser with python code that is run locally on my computer with "GAE" S

    - by brilliant
    When I run this code on my computer with the help of "Google App Engine SDK", it displays (in my browser) the HTML code of the Google home page: from google.appengine.api import urlfetch url = "http://www.google.com/" result = urlfetch.fetch(url) print result.content How can I make it display the page itself? I mean I want to see that page in my browser the way it would normally be seen by any user of the internet.

    Read the article

  • paperclip plugin not support for I18n

    - by user354413
    I've added I18n support for error messages: Now you can define translations for the errors messages in e.g. your YAML locale file: en: paperclip: errors: attachment: size: "Invalid file size" content_type: "Unsupported content type" presence: "Cant' be blank" when I use validates_attachemnt_zie :avatar how to get error message?

    Read the article

  • Fancybox: Get id of clicked anchor/element

    - by kastru
    I am trying to get the id of the clicked/shown element in fancybox. I have tried both "this.id" and "this.attr("id")" - but none of them works. $("a.lightbox_image").fancybox({ 'transitionIn': 'elastic', 'transitionOut': 'elastic', 'speedIn': 600, 'speedOut': 200, 'content': 'Id of element clicked'+this.attr("id") }); Any suggestions?

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 504 505 506 507 508 509 510 511 512 513 514 515  | Next Page >