Search Results

Search found 18756 results on 751 pages for 'generate images'.

Page 509/751 | < Previous Page | 505 506 507 508 509 510 511 512 513 514 515 516  | Next Page >

• View Animation (Resizing a Ball)

  - by user270811

  hi, i am trying to do this: 1) user long touches the screen, 2) a circle/ball pops up (centered around the user's finger) and grows in size as long as the user is touching the screen 3) once the user lets go of the finger, the ball (now in its final size) will bounce around. i think i have the bouncing around figure out from the DivideAndConquer example, but i am not sure how to animate the ball's growth. i looked at various view flipper examples such as this: http://www.inter-fuser.com/2009/08/android-animations-3d-flip.html but it seems like view flipper is best for swapping two static pictures. i wasn't able to find a good view animator example other than the flippers. also, i would prefer to use images as opposed to just a circle. can someone point me in the right direction? thanks.

  Read the article

• Example of tree.drop_mode with jQuery sortable anywhere

  - by fred

  Hello Everyone, I have a working tree of galleries next to a sortable list of image thumbnails. I've been vainly trying to set up the galleries tree so that users can add images to the galleries by dropping the sortable thumbnails on to the galleries tree. I've been told this requires drop_mode. All efforts to get it to work have failed and I can't really make heads or tails of the drop_mode documentation. I've sought out some working examples via Google of just such an application but have failed. Can anyone point me to a working example of either a draggable or sortable list that successfully drops on to a tree and passes along some parameters between the two? Thanks!

  Read the article

• doctrine behaviors , if i did it like this , would be correct ??

  - by tawfekov

  Hi , I am doing a web application in ZF + Doctrine 1.2.3 but i had an old database , it had pretty good structure so i think i can reverse engineer it with doctrine commad ./dcotrine generate-models-db , its amazing but i stopped when i wanted to use some doctrine behaviors like : searchable as an example , my question : if i went to my model and added these two lines : $this->actAs('Searchable', array( 'fields' => array('title', 'content') ) ); i am not sure if that enough and would work as expected , if you had any more tips about creating other behaviors like (versionable , i18n , sluggable or soft delete ) manually or reverse engineer it with doctrine behaviors , could you please list them

  Read the article

• Extra blank page when converting HTML to PDF using abcPDF

  - by ProfK

  I have an HTML report, with each print page contained by a <div class="page">. The page class is defined as width: 180mm; height: 250mm; page-break-after: always; background-position: centre top; background-image: url(Images/MainBanner.png); background-repeat: no-repeat; padding-top: 30mm; After making a few changes to my report content, when I call abcPDF to convert the report to PDF, suddenly I'm getting a blank page inserted after every real report page. I don't want to roll back the changes I've just made to remove this problem, so I'm hoping someone may know why the extra pages are being inserted.

  Read the article

• jqueryForm and empty uploads

  - by Aiden Bell

  Hi All, Been scratching my head for too long on this: Using jquery.form, (http://malsup.com/jquery/form) with PHP ... my $_FILES['someimage'] gets set but the error number is always UPLOAD_ERR_NO_FILE, size is also 0. The JavaScript: $('form input[type=file]').change(function(){ $(this).clone().appendTo('#imgform'); $('#imgform').ajaxForm(); $('#imgform').ajaxSubmit( { type:'POST' } ); }); Which appends to: <form id="imgform" method="POST" action="/api/images.php" enctype="multipart/form-data"></form> From another form which has bog-standard file inputs. PHP logs are clean, but var_dumping $_FILES always shows that the index is set to the name of the form element ... but no data. Thanks guys! (Sorry, I know jQuery-like questions are too frequent round these parts).

  Read the article

• XSD file, where to get xmlns argument?

  - by Daok

  <?xml version="1.0" encoding="utf-8"?> <xs:schema id="abc" targetNamespace="http://schemas.businessNameHere.com/SoftwareNameHere" elementFormDefault="qualified" xmlns="http://schemas.businessNameHere.com/SoftwareNameHere" xmlns:mstns="http://schemas.businessNameHere.com/SoftwareNameHere" xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:element name="..." type="..." /> <xs:complexType name="..."> I am working on a project using XSD to generate .cs file. My question is concerning the string "http://schemas.businessNameHere.com/SoftwareNameHere" If I change it, it doesn't work. But the http:// is not a valid one... what is the logic behind and where can I can information about what to put there or how to change it?

  Read the article

• Jquery autocomplete for input form, using Textpattern category list as a source

  - by John Stephens

  I'm using the Textpattern CMS to build a discussion site-- I have a firm grasp of XHTML and CSS, as well as Textpattern's template language, but PHP and Javascript are a bit beyond my cunning. On the input form to begin a new topic, users need to select a category from a list of over 5,000 options. Using the HTML select-type input element is very unwieldy, but it works. I would like to use some kind of Javascript magic to display a text-type input element that will read user input and display matches or autocomplete from the available categories, passing the required option's value into the appropriate database field. I've seen several autocomplete plugins for jquery, but the instructions presuppose that you understand how Javascript works. As I mentioned above, it's easy for me to generate the category list as a select-type input element, and I can hide that element using CSS. Is it possible to control select-list input using an autocomplete mechanism in a text-type input element? How would I do that?

  Read the article

• how to apply Discrete wavelet transform on image

  - by abuasis

  I am implementing an android application that will verify signature images , decided to go with the Discrete wavelet transform method (symmlet-8) the method requires to apply the discrete wavelet transform and separate the image using low-pass and high-pass filter and retrieve the wavelet transform coefficients. the equations show notations that I cant understand thus can't do the math easily , also didn't know how to apply low-pass and high-pass filters to my x and y points. is there any tutorial that shows you how to apply the discrete wavelet transform to my image easily that breaks it out in numbers? thanks alot in advance.

  Read the article

• PIL saves image colour wrong

  - by Tom Viner

  I have an image. I want to resize it using PIL, but it come out like this. Even without a resize it still messes up the colour. Minimal code: from PIL import Image import os import urllib import webbrowser orig_url = 'http://mercedesclub.org.uk/images/stackoverflow-question/least-popular-colours-_-500-x-500.jpg' temp_fn, _ = urllib.urlretrieve(orig_url) im = Image.open(temp_fn) fn = os.tempnam() + '.jpg' im.save(fn) webbrowser.open(fn) I've tried Image.open(temp_fn).convert(format) with 'RGB', 'CMYK' and 'L' as formats, but still get weirdly coloured or grey results. When I load the image from my hard drive and I can see: >>>im.info {'adobe': 100, 'progression': 1, 'exif': 'Exif\x00\x00MM\x00*...\x7f\xff\xd9', 'adobe_transform': 100} >>>im.format 'JPEG' >>>im.mode 'CMYK' >>> im._getexif() {40961: 65535, 40962: 500, 40963: 500, 296: 2, 34665: 164, 274: 1, 305: 'Adobe Photoshop CS Macintosh', 306: '2010:02:26 12:46:54', 282: (300, 1), 283: (300, 1)} Thanks and let me know if you need any more data.

  Read the article

• Creating an image from webcam every x miliseconds

  - by Rita

  Hello everyone, I am using c# to integrate with a web cam. I need to generate a snapshot image every x miliseconds and save it to file. I already have the code up and running to save to file on a button click event, however I wonder what am I supposed to do when taking snapshots in the background - Should this be multi threaded? I'm honestly not sure. I could just block the UI thread, put Thread.Sleep and then just take the snapshot, but I don't know if this is right. I thought of using a background worker, but I am now experiencing cross threaded difficulties with SendMessage... So I wonder if I should even go and bother to multi-thread or just block the UI. Help greatly appertained, thanks in advance.

  Read the article

• ImageView doesn't rescale Image to selected size

  - by Buni

  I'm using a ImageView with a fixed size for adding an icon to a menu. In my application, I use it a lot of times, but on this ImageView the Layout Params seem to not work. Unlike the others ImageViews, in this case, I'm using a template directly, but I think that's not the problem. <?xml version="1.0" encoding="utf-8"?> <ImageView xmlns:android="http://schemas.android.com/apk/res/android" android:layout_width="1dp" android:layout_height="1dp" android:scaleType="fitCenter" android:src="@drawable/ic_menu_moreoverflow_normal_holo_dark" android:contentDescription="ICON" /> Its been used in code as follows. ImageView iview =(ImageView) View.inflate(context, R.layout.icon, null); Theoretically, It should resize automatically the image, however, the images continues with the original size, although the size was 1dp. Where is the problem? Thanks a lot!

  Read the article

• How do I avoid symlinks using an Ant FileSet?

  - by Will

  I have a directory tree that includes a symlink to . (the current directory). When I attempt to iterate over this using an Ant FileSet, I get the following error: Caught error while checking for symbolic links at org.apache.tools.ant.DirectoryScanner.causesIllegalSymlinkLoop(DirectoryScanner.java:1859) The code that I am using to generate the scanner is: FileSet files = new FileSet(); Project project = new Project(); project.setBasedir( dir ); files.setProject( project ); files.setDir( project.getBaseDir() ); files.getDirectoryScanner().setFollowSymlinks( false ); for( Iterator iter = files.iterator(); iter.hasNext(); ) {}

  Read the article

• print web on dot matrix receipt printer

  - by nightingale2k1

  Hi, I need to print a receipt from my web based apps using dot matrix printer epson tm-u220d (pos printer). I need to know, should I generate the receipt in html or in plain text ? I ever saw some commands for dot matrix printer to change the font size, line feed etc .. but I don't remember that commands. if I have to use plain text I need to use that commands. anyone knows where i can get the references ? Thanks

  Read the article

• XNA 4.0 - What happens when the window is minimized?

  - by Conrad Clark

  Hello. I'm learning F#, and decided to try making simple XNA games for windows using F# (pure enthusiasm) , and got a window with some images showing up. Here's the code: (*Methods*) member self.DrawSprites() = _spriteBatch.Begin() for i = 0 to _list.Length-1 do let spentity = _list.List.ElementAt(i) _spriteBatch.Draw(spentity.ImageTexture,new Rectangle(100,100,(int)spentity.Width,(int)spentity.Height),Color.White) _spriteBatch.End() (*Overriding*) override self.Initialize() = ChangeGraphicsProfile() _graphicsDevice <- _graphics.GraphicsDevice _list.AddSprite(0,"NagatoYuki",992.0,990.0) base.Initialize() override self.LoadContent() = _spriteBatch <- new SpriteBatch(_graphicsDevice) base.LoadContent() override self.Draw(gameTime : GameTime) = base.Draw(gameTime) _graphics.GraphicsDevice.Clear(Color.CornflowerBlue) self.DrawSprites() And the AddSprite Method: member self.AddSprite(ID : int,imageTexture : string , width : float, height : float) = let texture = content.Load<Texture2D>(imageTexture) list <- list @ [new SpriteEntity(ID,list.Length, texture,Vector2.Zero,width,height)] The _list object has a ContentManager, here's the constructor: type SpriteList(_content : ContentManager byref) = let mutable content = _content let mutable list = [] But I can't minimize the window, since when it regains its focus, i get this error: ObjectDisposedException Cannot access a disposed object. Object name: 'GraphicsDevice'. What is happening?

  Read the article

• how to run javascript from c# code ?

  - by dotnetcoder

  I have a webrequest that returns a html response which has form inside with hidden fields with some javascript that submits the form automatically on pageload ( if this was run in a browser). If I save this file as *.html and run this file in browser , the java script code automatically posts the form and the output is excel file. I want to be able to generate this file from a c# code which is not running in broswer. I tried mocking thr form post but its complicated and has various scenarios based on the original webrequest querystring. any pointers.... i know its not possible to probably run JS code that posts the form - from within c# code but still thought of chekcing if someone has done that.

  Read the article

• Saving Blob data from SQLite database to a file

  - by Felipe

  Hello, I'm trying to save blob data from a SQLite database (Safari cache: Cache.db) to a file, but for some reason sqlite won't read the whole blob. I eventually would like to do this in ruby, but for now something that works directly in sqlite command prompt is fine. Also, I've read all of the entries that talk about this here on stackoverflow, but most of them only discuss the performance of saving images in blobs and the one entry that does show to save blobs to file is in C# which does not help me. Here is what I've tried: sqlite select * from cfurl_cache_response limit 1; 3501|0|945281827|0|http://www.gospelz.com/components/com_jomcomment/smilies/guest.gif|2010-02-24 16:20:07 sqlite select receiver_data from cfurl_cache_blob_data where entry_ID = 3501; GIF89a( A hexdump of the original (guest.gif) file shows that sqlite stops reading the blob after the first null value: $ hexdump -C guest.gif 00000000 47 49 46 38 39 61 28 00 28 00 f7 00 00 f1 f5 fd |GIF89a(.(.......| sqlite .output test.gif sqlite select receiver_data from cfurl_cache_blob_data where entry_ID = 3501; $ hexdump -C test.gif 00000000 47 49 46 38 39 61 28 0a |GIF89a(.|

  Read the article

• Symfony: Weird routing issue

  - by Tom

  Hi, I've got following URL in symfony (specifics not important): /frontend_dev.php/something/25/apple ... and a routing rule: /something/:id/:word The URL works fine when clicked through to on the site, but not when I type in the URL. Instead, symfony says: Unable to find a matching route to generate url for params "NULL". The weird thing is that I can navigate to this page and it works, but when hitting Enter in the browser address bar, it no longer finds it. Any thoughts on what might be the cause of something like this generally? I should also add that the URL was working fine when typed in the address bar earlier, but doesn't anymore, and I'm not sure what's there that might be interfering with it. Thanks in advance.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Prevent Visual Studio Web Test from changing request details

  - by keithwarren7

  I have a service that accepts Xmla queries for Analysis services, often times those queries themselves will have a string that contains a fragment that looks something like {{[Time].[Year].[All]}} Recording these requests works fine but when I try to re-run the test I get an error from the test runner... Request failed: Exception occurred: There is no context parameter with the name ' [Time].[Year].[All]' in the WebTestContext This was confusing for some time but when I asked VS to generate a coded version of the test I was able to see the problem a bit better. VS searches for the '{{' and '}}' tokens and makes changes, considering those areas to refer to Context parameters, the code looks like this.Context["\n\t[Time].[Year].[All]"].ToString() Anyone know how to instruct Visual Studio to not perform this replacement operation? Or another way around this issue?

  Read the article

• wrapp a function whose parameters are out type pointer to structure using swig

  - by pierr

  I have following function : typedef struct tagT{ int a ; int b ; }Point; int lib_a_f_5(Point *out_t) { out_t->a = 20; out_t->b = 30; return 0; } How should I direct the SWIG to generate the correct code for ruby (or lua)? When putting following statement to the interface file : %apply SWIGTYPE Point* {Point *out_t}; I got a warning : liba.i:7: Warning(453): Can't apply (Point *OUTPUT). No typemaps are defined. Did i need to write a typemap? How should I do it?

  Read the article

• UIPopover Sizing

  - by Echilon

  I have a UIPopoverController which I'm trying to show from a UIBarButtonItem in a navigation bar. Despite setting the resizing mask for the tableview inside the popover's content viewController, it takes up the whole height of the screen. The only thing which has any effect on the content size is menuPopover.contentViewController.view setFrame:CGRect. I'm using the code below to show the popover inside the left hand side of a UISplitViewController // menuPopover and editVc are properties on the parent viewController menuPopover = [[UIPopoverController alloc] initWithContentViewController:editVc]; [menuPopover presentPopoverFromBarButtonItem:btnMenu permittedArrowDirections:UIPopoverArrowDirectionAny animated:true]; [menuPopover setPopoverContentSize:CGSizeMake(400, 500) animated:true]; [menuPopover.contentViewController.view setFrame:CGRectMake(0,0,400, 500)]; Yet this is what I'm seeing. The arrow shows where the menu button was which showed the popover: http://imageshack.us/photo/my-images/545/screenshot20120312at191.png/ It's as though the content view is just expanding vertically.

  Read the article

• PHP/Apache: Permission settings for uploaded JPEG image files not correct.

  - by Mike

  I just setup a LAMP development server and am still trouble-shooting some things. The server is installed on one computer and I use a Windows laptop to write my code and test the site via the web browser. My file uploading script works in that JPEG image files are successfully uploaded to the server, but when I try to view the images in the web browser, permission is denied. I check the permissions on the file via the server and they are 600. I can fix the issue by chmod 777 theimage.jpg, but this doesn't seem like a good solution at all. Does the solution have something to do with Apache configuration? Or is there something else I should be doing. Thank-you, Mike

  Read the article

• gwt internationalization

  - by blub

  Hello guys, there are three (open) questions about the internationalization of GWT, I have: 1) Is it a (huge) performance issue, to use only "Messages" for constant and parameterized text (that's possible), where you would use both "Messages" and "Constants" usually? 2) Is there a way to specify the original text in the source code, whose translations can then be specified somewhere? (e.g. Translate("Hello") in the source code and than in a properties file for e.g. spanish: Hello = ¡Hola!) 3) Do you know any translation-tools, which generate the properties and interfaces for you? Thanks in Advance!

  Read the article

• Problem with migrating a model in ruby

  - by Shreyas Satish

  I run script/generate model query edit query.rb in models.. class Query < ActiveRecord::Base #I even tried Migrations instead of Base def sef.up create table :queries do|t| t.string :name end end def self.down drop_table :queries end end ,run rake db:migrate. and what I see in db is this: mysql> desc queries; +------------+----------+------+-----+---------+----------------+ | Field | Type | Null | Key | Default | Extra | +------------+----------+------+-----+---------+----------------+ | id | int(11) | NO | PRI | NULL | auto_increment | | created_at | datetime | YES | | NULL | | | updated_at | datetime | YES | | NULL | | +------------+----------+------+-----+---------+----------------+ Where is the "name" field? HELP ! Cheers !

  Read the article

• Question regarding XST bitstream generation

  - by Richi

  Hi all, I have a very simple VHDL module, consisting of a few lines of code. The thing is, when I generate the bitstream, I end up with a huge bitstream. The reason for this is, I guess, that XST adds lots of extra information so that the bitstream can run standalone on a FPGA. However, for my purpose it would be interesting to see the size of the bitstream of the module alone without any extra bits and pieces, just the vaniall module alone. Is there an option in Xilinx ISE 12.1 that allows me to do that? Many thanks, Richi

  Read the article

< Previous Page | 505 506 507 508 509 510 511 512 513 514 515 516  | Next Page >