Search Results

Search found 40117 results on 1605 pages for 'general java'.

Page 510/1605 | < Previous Page | 506 507 508 509 510 511 512 513 514 515 516 517  | Next Page >

  • Synchronizing issue: I want the main thread to be run before another thread but it sometimes doesn´t

    - by Rox
    I have done my own small concurrency framework (just for learning purposes) inspired by the java.util.concurrency package. This is about the Callable/Future mechanism. My code below is the whole one and is compilable and very easy to understand. My problem is that sometimes I run into a deadlock where the first thread (the main thread) awaits for a signal from the other thread. But then the other thread has already notified the main thread before the main thread went into waiting state, so the main thread cannot wake up. FutureTask.get() should always be run before FutureTask.run() but sometimes the run() method (which is called by new thread) runs before the get() method (which is called by main thread). I don´t know how I can prevent that. This is a pseudo code of how I want the two threads to be run. //From main thread: Executor.submit().get() (in get() the main thread waits for new thread to notify) ->submit() calls Executor.execute(FutureTask object) -> execute() starts new thread -> new thread shall notify `main thread` I cannot understand how the new thread can start up and run faster than the main thread that actually starts the new thread. Main.java: public class Main { public static void main(String[] args) { new ExecutorServiceExample(); } public Main() { ThreadExecutor executor = new ThreadExecutor(); Integer i = executor.submit(new Callable<Integer>() { @Override public Integer call() { return 10; } }).get(); System.err.println("Value: "+i); } } ThreadExecutor.java: public class ThreadExecutor { public ThreadExecutor() {} protected <V> RunnableFuture<V> newTaskFor(Callable c) { return new FutureTask<V>(c); } public <V> Future<V> submit(Callable<V> task) { if (task == null) throw new NullPointerException(); RunnableFuture<V> ftask = newTaskFor(task); execute(ftask); return ftask; } public void execute(Runnable r) { new Thread(r).start(); } } FutureTask.java: import java.util.concurrent.locks.Condition; import java.util.concurrent.locks.ReentrantLock; import java.util.logging.Level; import java.util.logging.Logger; public class FutureTask<V> implements RunnableFuture<V> { private Callable<V> callable; private volatile V result; private ReentrantLock lock = new ReentrantLock(); private Condition condition = lock.newCondition(); public FutureTask(Callable callable) { if (callable == null) throw new NullPointerException(); this.callable = callable; } @Override public void run() { acquireLock(); System.err.println("RUN"+Thread.currentThread().getName()); V v = this.callable.call(); set(v); condition.signal(); releaseLock(); } @Override public V get() { acquireLock(); System.err.println("GET "+Thread.currentThread().getName()); try { condition.await(); } catch (InterruptedException ex) { Logger.getLogger(FutureTask.class.getName()).log(Level.SEVERE, null, ex); } releaseLock(); return this.result; } public void set(V v) { this.result = v; } private void acquireLock() { lock.lock(); } private void releaseLock() { lock.unlock(); } } And the interfaces: public interface RunnableFuture<V> extends Runnable, Future<V> { @Override void run(); } public interface Future<V> { V get(); } public interface Callable<V> { V call(); }

    Read the article

  • is it right to call ejb bean from thread by ThreadPoolExecutor?

    - by kislo_metal
    I trying to call some ejb bean method from tread. and getting error : (as is glassfish v3) Log Level SEVERE Logger javax.enterprise.system.std.com.sun.enterprise.v3.services.impl Name-Value Pairs {_ThreadName=Thread-1, _ThreadID=42} Record Number 928 Message ID java.lang.NullPointerException at ua.co.rufous.server.broker.TempLicService.run(TempLicService.java Complete Message 35) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:637) here is tread public class TempLicService implements Runnable { String hash; //it`s Stateful bean @EJB private LicActivatorLocal lActivator; public TempLicService(String hash) { this.hash= hash; } @Override public void run() { lActivator.proccessActivation(hash); } } my ThreadPoolExecutor public class RequestThreadPoolExecutor extends ThreadPoolExecutor { private boolean isPaused; private ReentrantLock pauseLock = new ReentrantLock(); private Condition unpaused = pauseLock.newCondition(); private static RequestThreadPoolExecutor threadPool; private RequestThreadPoolExecutor() { super(1, Integer.MAX_VALUE, 10, TimeUnit.SECONDS, new LinkedBlockingQueue<Runnable>()); System.out.println("RequestThreadPoolExecutor created"); } public static RequestThreadPoolExecutor getInstance() { if (threadPool == null) threadPool = new RequestThreadPoolExecutor(); return threadPool; } public void runService(Runnable task) { threadPool.execute(task); } protected void beforeExecute(Thread t, Runnable r) { super.beforeExecute(t, r); pauseLock.lock(); try { while (isPaused) unpaused.await(); } catch (InterruptedException ie) { t.interrupt(); } finally { pauseLock.unlock(); } } public void pause() { pauseLock.lock(); try { isPaused = true; } finally { pauseLock.unlock(); } } public void resume() { pauseLock.lock(); try { isPaused = false; unpaused.signalAll(); } finally { pauseLock.unlock(); } } public void shutDown() { threadPool.shutdown(); } //<<<<<< creating thread here public void runByHash(String hash) { Runnable service = new TempLicService(hash); threadPool.runService(service); } } and method where i call it (it is gwt servlet, but there is no proble to call thread that not contain ejb) : @Override public Boolean submitHash(String hash) { System.out.println("submiting hash"); try { if (tBoxService.getTempLicStatus(hash) == 1) { //<<< here is the call RequestThreadPoolExecutor.getInstance().runByHash(hash); return true; } } catch (NoResultException e) { e.printStackTrace(); } return false; } I need to organize some pool of submitting hash to server (calls of LicActivator bean), is ThreadPoolExecutor design good idea and why it is not working in my case? (as I know we can`t create thread inside bean, but could we call bean from different threads? ). If No, what is the bast practice for organize such request pool? Thanks. << Answer: I am using DI (EJB 3.1) soo i do not need any look up here. (application packed in ear and both modules in it (web module and ejb), it works perfect for me). But I can use it only in managed classes. So.. 2.Can I use manual look up in Tread ? Could I use Bean that extends ThreadPoolExecutor and calling another bean that implements Runnable ? Or it is not allowed ?

    Read the article

  • applet does not load

    - by jcp
    We have a legacy program that was ported from Java 1.3 to Java 1.5. This application involves applets which worked fine before. After porting however, the applet would not load. However there are no errors or exceptions. The app would just try to load it forever. We tried to run it with Java 1.6 and poof! No problems whatsoever. Isn't Java 6 backwards compatible? So how come it would run in that version and not in 1.5? ==== Java Console log for Java 1.5.0_19 basic: Registered modality listener basic: Registered modality listener basic: Registered modality listener liveconnect: Invoking JS method: document liveconnect: Invoking JS method: document liveconnect: Invoking JS method: document liveconnect: Invoking JS method: URL liveconnect: Invoking JS method: URL liveconnect: Invoking JS method: URL basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=1 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=2 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Added progress listener: sun.plugin.util.GrayBoxPainter@b0bad7 basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Added progress listener: sun.plugin.util.GrayBoxPainter@ba9340 basic: Added progress listener: sun.plugin.util.GrayBoxPainter@1198891 basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 network: Connecting <something>.jar with proxy=HTTP @ proxy/<ip address> basic: Loading <something>.jar from cache basic: No certificate info, this is unsigned JAR file. Left START init() Left END init() Right START init() Control start() Waiting for Left Panel to load... Right START start() network: Connecting socket://<ip address>:14444 with proxy=DIRECT Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... my HostName : <ip address> Thread-19 Check : Thread-19 Check : Monitor : run : start Thread-20 Monitor : Monitor: run() start Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... the last message goes on forever... and now with the working version: ==== Java Console log for Java 1.6.0_15 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@1b000e7 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@12611a7 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@1807ca8 network: CleanupThread used 6 us network: CleanupThread used 5 us network: CleanupThread used 6 us cache: Skip blacklist check as cached value is ok. network: Cache entry found [url: <something>.jar, version: null] network: Connecting <something>.jar with proxy=HTTP @ proxy/<ip address> network: ResponseCode for <something>.jar : 304 network: Encoding for <something>.jar : null network: Disconnect connection to <something>.jar Reading certificates from 11 <something>.jar | <something>.idx network: No certificate info for unsigned JAR file: <something>.jar basic: Applet loaded. basic: Applet loaded. basic: Applet resized and added to parent container basic: Applet resized and added to parent container basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27768955 us, TotalTime: 28099230 us Right START init() basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27770563 us, TotalTime: 28100838 us Left START init() basic: Applet loaded. basic: Applet resized and added to parent container basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27779332 us, TotalTime: 28109607 us Left END init() basic: Applet initialized basic: Removed progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@12611a7 basic: Applet made visible And that's it. Still haven't figured out why it works with java6 and not java5. @valli: the object tag was used, not applet @thorbjorn: i tried that already... it just keeps saying loading applet... @aaron: how can i know what exception it is, if there really is one? and yes we have considered that its a java bug but i still havent found what that bug is. i have to submit a report tomorrow and i've scoured the net but came up with nothing as of yet... @all: thank you for your replies

    Read the article

  • o display an image

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • Using only alphanumeric characters(a-z) inside toCharArray

    - by Aaron
    Below you will find me using toCharArray in order to send a string to array. I then MOVE the value of the letter using a for statement... for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } However, when I use shiftCode to move the value such as... a shifted by -1; I get a symbol @. Is there a way to send the string to shiftCode or tell shiftCode to ONLY use letters? I need it to see my text, like "aaron", and when I use the for statement iterate through a-z only and ignore all symbols and numbers. I THINK it is as simple as... letter=codeWord.toCharArray(a,z); But trying different forms of that and googling it didn't give me any results. Perhaps it has to do with regex or something? Below you will find a complete copy of my program; it works exactly how I want it to do; but it iterates through letters and symbols. I also tried finding instructions online for toCharArray but if there exists any arguments I can't locate them. My program... import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Aaron L. Jones * CS219 * AaronJonesProg3 * * This program is designed to - * Work as a Ceasar Cipher */ /** * * Aaron Jones */ public class AaronJonesProg3 { static String codeWord; static int shiftCode; static int i; static char[] letter; /** * @param args the command line arguments */ public static void main(String[] args) throws IOException { // Instantiating that Buffer Class // We are going to use this to read data from the user; in buffer // For performance related reasons BufferedReader reader; // Building the reader variable here // Just a basic input buffer (Holds things for us) reader = new BufferedReader(new InputStreamReader(System.in)); // Java speaks to us here / We get it to query our user System.out.print("Please enter text to encrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); /**************************************************************** **************************************************************** ***************************************************************/ // Java speaks to us here / We get it to query our user System.out.print("Please enter text to decrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); } }

    Read the article

  • Injection of an EJB into a web java class under JBoss 7.1.1

    - by Dobbo
    I am trying to build a website using JBoss 7.1.1 and RESTeasy. I have managed to constructed and deploy and EAR with a both a WAR and an EJB-JAR contained within: voyager-app.ear META-INF/MANIFEST.MF META-INF/application.xml META-INF/jboss-app.xml lib/voyager-lib.jar voyager-adm.war voyager-ejb.jar voyager-web.war So far things are very simple. voyager-adm.war & voyager-lib.jar are empty (just the manifest file) but I know that I'm going to have code for them shortly. There is just one Stateful EJB - HarbourMasterBean (with just a local interface) and a few Database Entity Beans in the EJB jar file: voyager-ejb.jar META-INF/MANIFEST.MF META-INF/persistence.xml com/nutrastat/voyager/db/HarbourMasterBean.class com/nutrastat/voyager/db/HarbourMasterLocal.class com/nutrastat/voyager/db/PortEntity.class com/nutrastat/voyager/db/ShipEntity.class As far as I can tell the EJBs deploy correctly because the database units are created and the log shows that the publication of some HarbourMaster references: java:global/voyager-app/voyager-ejb/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:app/voyager-ejb/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:module/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:global/voyager-app/voyager-ejb/harbour-master java:app/voyager-ejb/harbour-master java:module/harbour-master The problem lies in getting the HarbourMaster EJB injected into my web bean. The reference to it is alway NULL no matter what I try. voyager-web.war META-INF/MANIFEST.MF WEB-INF/web.xml WEB-INF/classes/com/nutrastat/voyager/web/ WEB-INF/classes/com/nutrastat/voyager/web/Ships.class WEB-INF/classes/com/nutrastat/voyager/web/VoyagerApplication.class Ships.java: @Path("fleet") public class Ships { protected transient final Logger log; @EJB private HarbourMasterLocal harbourMaster; public Ships() { log = LoggerFactory.getLogger(getClass()); } @GET @Path("ships") @Produces({"text/plain"}) public String listShips() { if (log.isDebugEnabled()) log.debug("Harbour master value: " + harbourMaster); return "Harbour Master: " + harbourMaster; } } &lt;web-app xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd" version="3.0" &gt; <display-name>Voyager Web Application</display-name> <listener> <listener-class> org.jboss.resteasy.plugins.server.servlet.ResteasyBootstrap </listener-class> </listener> <servlet> <servlet-name>Resteasy</servlet-name> <servlet-class> org.jboss.resteasy.plugins.server.servlet.HttpServletDispatcher </servlet-class> <init-param> <param-name> javax.ws.rs.Application </param-name> <param-value> com.nutrastat.voyager.web.VoyagerApplication </param-value> </init-param> </servlet> <servlet-mapping> <servlet-name>Resteasy</servlet-name> <url-pattern>/*</url-pattern> </servlet-mapping> &lt;/web-app&gt; I have been searching the web for an answer and read a number of places, both on StackOverflow and elsewhere that suggests is can be done, and that the problems lies with configuration. But they post only snippets and I'm never sure if I'm doing things correctly. Many thanks for any help you can provide. Dobbo

    Read the article

  • Watching a variable for changes without polling.

    - by milkfilk
    I'm using a framework called Processing which is basically a Java applet. It has the ability to do key events because Applet can. You can also roll your own callbacks of sorts into the parent. I'm not doing that right now and maybe that's the solution. For now, I'm looking for a more POJO solution. So I wrote some examples to illustrate my question. Please ignore using key events on the command line (console). Certainly this would be a very clean solution but it's not possible on the command line and my actual app isn't a command line app. In fact, a key event would be a good solution for me but I'm trying to understand events and polling beyond just keyboard specific problems. Both these examples flip a boolean. When the boolean flips, I want to fire something once. I could wrap the boolean in an Object so if the Object changes, I could fire an event too. I just don't want to poll with an if() statement unnecessarily. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Example of checking a variable for changes. * Uses dumb if() and polls continuously. */ public class NotAvoidingPolling { public static void main(String[] args) { boolean typedA = false; String input = ""; System.out.println("Type 'a' please."); while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic if (input.equals("a")) { typedA = true; } else { typedA = false; } // problem: this is polling. if (typedA) System.out.println("Typed 'a'."); } } } Running this outputs: Type 'a' please. a Typed 'a'. On some forums people suggested using an Observer. And although this decouples the event handler from class being observed, I still have an if() on a forever loop. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; import java.util.Observable; import java.util.Observer; /* * Example of checking a variable for changes. * This uses an observer to decouple the handler feedback * out of the main() but still is polling. */ public class ObserverStillPolling { boolean typedA = false; public static void main(String[] args) { // this ObserverStillPolling o = new ObserverStillPolling(); final MyEvent myEvent = new MyEvent(o); final MyHandler myHandler = new MyHandler(); myEvent.addObserver(myHandler); // subscribe // watch for event forever Thread thread = new Thread(myEvent); thread.start(); System.out.println("Type 'a' please."); String input = ""; while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic // but it's decoupled now because there's no handler here. if (input.equals("a")) { o.typedA = true; } } } } class MyEvent extends Observable implements Runnable { // boolean typedA; ObserverStillPolling o; public MyEvent(ObserverStillPolling o) { this.o = o; } public void run() { // watch the main forever while (true) { // event fire if (this.o.typedA) { setChanged(); // in reality, you'd pass something more useful notifyObservers("You just typed 'a'."); // reset this.o.typedA = false; } } } } class MyHandler implements Observer { public void update(Observable obj, Object arg) { // handle event if (arg instanceof String) { System.out.println("We received:" + (String) arg); } } } Running this outputs: Type 'a' please. a We received:You just typed 'a'. I'd be ok if the if() was a NOOP on the CPU. But it's really comparing every pass. I see real CPU load. This is as bad as polling. I can maybe throttle it back with a sleep or compare the elapsed time since last update but this is not event driven. It's just less polling. So how can I do this smarter? How can I watch a POJO for changes without polling? In C# there seems to be something interesting called properties. I'm not a C# guy so maybe this isn't as magical as I think. private void SendPropertyChanging(string property) { if (this.PropertyChanging != null) { this.PropertyChanging(this, new PropertyChangingEventArgs(property)); } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do I prevent my form from freezing when it is loading an image from the web at the click of a button?

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • JSF tags not being rendered as HTML

    - by Toto
    I'm following the Java EE firstcup tutorial using Netbeans and Glassfish. When I execute the JSF web tier I've been instructed to code, the browser gets the same JSF markup coded in the .xhtml file, and the tags are not rendered as HTML tags. I know this by using the view source code in my browser. For example, for this code: <html xmlns="http://www.w3.org/1999/xhtml" xmlns:f="http://java.sun.com/jsf/core" xmlns:h="http://java.sun.com/jsf/html"> <h:head> <title>Page title here</title> </h:head> <h:body> <h2> <h:outputText value="#{bundle.WelcomeMessage}" /> </h2> </h:body> </html> The browser should get something like: <html ...> <head> <title>Page title here</title> </head> <body> <h2> the welcome message goes here </h2> </body> </html> Right? Well, my browser is getting jsf code (the first piece of code above) and not the html code (the second piece of code above). It seems to be a configuration problem in netbeans or glassfish but don't know what. Any ideas? This is my web.xml file: <?xml version="1.0" encoding="UTF-8"?> <web-app version="3.0" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd"> <context-param> <param-name>javax.faces.PROJECT_STAGE</param-name> <param-value>Development</param-value> </context-param> <servlet> <servlet-name>Faces Servlet</servlet-name> <servlet-class>javax.faces.webapp.FacesServlet</servlet-class> <load-on-startup>1</load-on-startup> </servlet> <servlet-mapping> <servlet-name>Faces Servlet</servlet-name> <url-pattern>/firstcup/*</url-pattern> </servlet-mapping> <session-config> <session-timeout> 30 </session-timeout> </session-config> <welcome-file-list> <welcome-file>greetings.xhtml</welcome-file> </welcome-file-list> </web-app> This is my faces-config.xml file: <?xml version='1.0' encoding='UTF-8'?> <!-- =========== FULL CONFIGURATION FILE ================================== --> <faces-config version="2.0" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-facesconfig_2_0.xsd"> <application> <resource-bundle> <base-name>firstcup.web.WebMessages</base-name> <var>bundle</var> </resource-bundle> <locale-config> <default-locale>en</default-locale> <supported-locale>es</supported-locale> </locale-config> </application> <navigation-rule> <from-view-id>/greetings.xhtml</from-view-id> <navigation-case> <from-outcome>success</from-outcome> <to-view-id>/response.xhtml</to-view-id> </navigation-case> </navigation-rule> </faces-config> Moreover: The url I'm entering in the browser is http://localhost:8081/firstcup/ but I've also tried: http://localhost:8081/firstcup/greetings.xhtml I've checked Glassfish logs and there's no information about not being able to load FacesServlet

    Read the article

  • maven-ear-plugin works if jboss version is 4.2, but not 5. Why ?

    - by NSINGH
    I am using maven to configure maven-ear-plugin. I am getting following exception when I say jboss version is 5 (See below code, under tag). It works if I replace version to 4.2 <build> <finalName>tactical</finalName> <plugins> <plugin> <artifactId>maven-ear-plugin</artifactId> <configuration> <version>5</version> <defaultJavaBundleDir>lib</defaultJavaBundleDir> <jboss> <version>5</version> <loader-repository>seam.jboss.org:loader=tactical</loader-repository> </jboss> <modules> <ejbModule> <groupId>${project.groupId}</groupId> <artifactId>tactical-jar</artifactId> </ejbModule> </modules> </configuration> </plugin> </plugins> </build> Why it works fine for jboss 4.2 but not for 5. What ?? I get the following exception: [INFO] Failed to initialize JBoss configuration Embedded error: Invalid JBoss configuration, version[5] is not supported. [INFO] ------------------------------------------------------------------------ [INFO] Trace org.apache.maven.lifecycle.LifecycleExecutionException: Failed to initialize JBoss configuration at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:583) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoalWithLifecycle(DefaultLifecycleExecutor.java:49 9) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoal(DefaultLifecycleExecutor.java:478) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoalAndHandleFailures(DefaultLifecycleExecutor.jav a:330) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeTaskSegments(DefaultLifecycleExecutor.java:291) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.execute(DefaultLifecycleExecutor.java:142) at org.apache.maven.DefaultMaven.doExecute(DefaultMaven.java:336) at org.apache.maven.DefaultMaven.execute(DefaultMaven.java:129) at org.apache.maven.cli.MavenCli.main(MavenCli.java:287) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.codehaus.classworlds.Launcher.launchEnhanced(Launcher.java:315) at org.codehaus.classworlds.Launcher.launch(Launcher.java:255) at org.codehaus.classworlds.Launcher.mainWithExitCode(Launcher.java:430) at org.codehaus.classworlds.Launcher.main(Launcher.java:375) Caused by: org.apache.maven.plugin.MojoExecutionException: Failed to initialize JBoss configuration at org.apache.maven.plugin.ear.AbstractEarMojo.execute(AbstractEarMojo.java:159) at org.apache.maven.plugin.ear.GenerateApplicationXmlMojo.execute(GenerateApplicationXmlMojo.java:96) at org.apache.maven.plugin.DefaultPluginManager.executeMojo(DefaultPluginManager.java:451) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:558) ... 16 more Caused by: org.apache.maven.plugin.ear.EarPluginException: Invalid JBoss configuration, version[5] is not supported. at org.apache.maven.plugin.ear.JbossConfiguration.(JbossConfiguration.java:95) at org.apache.maven.plugin.ear.AbstractEarMojo.initializeJbossConfiguration(AbstractEarMojo.java:296) at org.apache.maven.plugin.ear.AbstractEarMojo.execute(AbstractEarMojo.java:155) ... 19 more [INFO] ------------------------------------------------------------------------ [INFO] Total time: 2 seconds Any idea. Thanks

    Read the article

  • Error showing is NullPointerException [duplicate]

    - by user3659612
    This question already has an answer here: How to check a string against null in java? 11 answers I was trying to code a wifi scanner which does 20 scans but it shows NullPointerException at if(bssid[j].equals(null)){ My code is slightly huge package com.example.scanner; import java.io.File; import java.io.FileNotFoundException; import java.io.FileOutputStream; import java.io.IOException; import java.io.OutputStreamWriter; import java.text.SimpleDateFormat; import java.util.Date; import java.util.List; import android.annotation.SuppressLint; import android.content.BroadcastReceiver; import android.content.Context; import android.content.Intent; import android.content.IntentFilter; import android.net.wifi.ScanResult; import android.net.wifi.WifiInfo; import android.net.wifi.WifiManager; import android.os.Bundle; import android.os.Environment; import android.support.v7.app.ActionBarActivity; import android.view.Menu; import android.view.View; import android.widget.ArrayAdapter; import android.widget.Button; import android.widget.ListView; import android.widget.Toast; public class MainActivity extends ActionBarActivity { WifiManager wifi; WifiScanReceiver wifireciever; WifiInfo info; Button scan, save; List<ScanResult> wifilist; ListView list; String wifis[]; String name; String[] ssid = new String[100]; String[] bssid = new String[100]; int[] lvl = new int[100]; int[] count = new int[100]; @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.fragment_main); list=(ListView)findViewById(R.id.listView1); scan=(Button)findViewById(R.id.button1); save=(Button)findViewById(R.id.button2); scan.setOnClickListener(new View.OnClickListener() { @Override public void onClick(View v) { // TODO Auto-generated method stub wifi=(WifiManager)getSystemService(Context.WIFI_SERVICE); if (wifi.isWifiEnabled()==false){ wifi.setWifiEnabled(true); } wifireciever = new WifiScanReceiver(); for (int i=0;i<20;i++){ registerReceiver(wifireciever, new IntentFilter(WifiManager.SCAN_RESULTS_AVAILABLE_ACTION)); wifi.startScan(); if (i==19){ Toast.makeText(getBaseContext(), "Scan Finish", Toast.LENGTH_LONG).show(); } } } }); save.setOnClickListener(new View.OnClickListener() { @Override public void onClick(View v) { // TODO Auto-generated method stub savedata(); } }); } protected void savedata() { // TODO Auto-generated method stub try { File sdcard = Environment.getExternalStorageDirectory(); File directory = new File(sdcard.getAbsolutePath() + "/WIFI_RESULT"); directory.mkdirs(); name = new SimpleDateFormat("yyyy-MM-dd HH mm ss").format(new Date()); File file = new File(directory,name + "wifi_data.txt"); FileOutputStream fou = new FileOutputStream(file); OutputStreamWriter osw = new OutputStreamWriter(fou); try { for (int i =0; i < list.getCount(); i++){ osw.append(list.getItemAtPosition(i).toString()); } osw.flush(); osw.close(); Toast.makeText(getBaseContext(), "Saved", Toast.LENGTH_LONG).show(); } catch (IOException e){ e.printStackTrace(); } } catch (FileNotFoundException e){ e.printStackTrace(); } } class WifiScanReceiver extends BroadcastReceiver { @SuppressLint("UseValueOf") public void onReceive(Context c, Intent intent) { int a =0; wifi.startScan(); List<ScanResult> wifilist = wifi.getScanResults(); if (a<wifilist.size()){ a=wifilist.size(); } for(int j=0;j<wifilist.size();j++){ if(bssid[j].equals(null)){ ssid[j] = wifilist.get(j).SSID.toString(); bssid[j] = wifilist.get(j).BSSID.toString(); lvl[j] = wifilist.get(j).level; count[j]++; } else if (bssid[j].equals(wifilist.get(j).BSSID.toString())){ lvl[j] = lvl[j] + wifilist.get(j).level; count[j]++; } } wifis = new String[a]; for (int i =0; i<a; i++){ wifis[i] = ("\n" + ssid[i] + "\n AP Address" + bssid[i] + "\n Signal Strength:" + lvl[i]/count[i]).toString(); } list.setAdapter(new ArrayAdapter<String>(getApplicationContext(), android.R.layout.simple_list_item_1,wifis)); } } protected void onDestroy() { unregisterReceiver(wifireciever); super.onPause(); } protected void onResume() { registerReceiver(wifireciever, new IntentFilter(WifiManager.SCAN_RESULTS_AVAILABLE_ACTION)); super.onResume(); } @Override public boolean onCreateOptionsMenu(Menu menu) { // Inflate the menu; this adds items to the action bar if it is present. getMenuInflater().inflate(R.menu.main, menu); return true; } } NullPointerException at that point mean my array bssid isn't initialize. So I just want to know how to initialize it in main activity so that I can use that string bssid anywhere.

    Read the article

  • What's the difference between General Ledger Transfer Program, Create Accounting and Submit Accounting?

    - by Oracle_EBS
    In Release 12, the General Ledger Transfer Program is no longer used. Use Create Accounting or Submit Accounting instead. Submit Accounting spawns the Revenue Recognition Process. The Create Accounting program does not. So if you create transactions with rules, then you would want to run Submit Accounting Process to spawn Revenue Recognition to create the distribution rows, which Create Accounting is then spawned to process to the GL. Create Accounting Submit Accounting Short Name for Concurrent Program XLAACCPB ARACCPB Specific to Receivables No Yes Runs Revenue Recognition automatically No Yes Can be run real-time for one Transaction/Receipt at a time Yes No Spawns the following Programs 1) XLAACCPB module: Create Accounting 2) XLAACCUP module: Accounting Program 3) GLLEZL module: Journal Import 1) ARTERRPM module: Revenue Recognition Master Program 2) ARTERRPW module: Revenue Recognition with parallel workers - could be numerous 3) ARREVSWP - Revenue Contingency Analyzer 4) XLAACCPB module: Create Accounting 5) XLAACCUP module: Accounting Program 5) GLLEZL module: Journal Import Keep in mind, Reports owned by application 'Subledger Accounting' cannot be seen when running the report from Receivables responsibility. You may want to request your sysadmin to attach the following SLA reports/programs to your AR responsibility as you will need these for your AR closing process: XLAPEXRPT : Subledger Period Close Exception Report - shows transactions in status final, incomplete and unprocessed. XLAGLTRN : Transfer Journal Entries to GL - transfers transactions in final status and manually created transactions to GL To add reports/programs owned by application 'Subledger Accounting' (Subledger Period Close Exception Report and Transfer Journal Entries to GL_ Add to the request group as follows: Let's use Subledger Accounting Report XLATBRPT: Open Account Balances Listing Report as an example. Responsibility: System Administrator Navigation: Security > Responsibility > Define Query the name of your Receivables Responsibility and note the Request Group (ie. Receivables All) Navigation: Security > Responsibility > Request Query the Request Group Go to Request Zone and Click on Add Record Enter the following: Type: Program Name: Open Account Balances Listing Save Responsibility: Receivables Manager Navigation: Control > Requests > Run In the list of values you should now see 'Open Account Balances Listing' report References: Note: 748999.1 How to add reports for application subledger accounting to receivables responsibiilty Note: 759534.1 R12 ARGLTP General Ledger Transfer Program Errors Out Note: 1121944.1 Understanding and Troubleshooting Revenue Recognition in Oracle Receivables

    Read the article

  • BOEING, EA and UNDERWRITER LABS @ Oracle Open World 2012 General Session (GEN9504): Innovation Platform for Oracle Apps, including Oracle Fusion Applications

    - by Sanjeev Sharma
     What does it take to deliver social, mobile, cloud and business analytic      capabilities? Oracle Fusion Middleware is the leading innovation platform for today’s new    business  applications and the building-block of Oracle Fusion Applications.  Join Amit Zavery,  Vice President of Fusion Middleware Product Management discuss Oracle Fusion  Applications’ architecture and the strategy roadmap for Oracle Fusion Middleware. Underwriter Laboratories is the world’s leading provider of product safety and certification testing services.  To support its business growth from $1B to $5B in the next 5 years Underwriter Laboratories is undergoing a major business transformation. Underpinning Underwriter Laboratories's growth plans and associated business transformation is a major Datacenter Modernization effort to consolidate its existing Oracle Applications (E-Business Suite, Siebel CRM, BI etc.) and middleware components (Oracle SOA Suite, Oracle AIA etc.) on a standardized application platform. Underwriter Labs has identified Oracle Engineered Systems (Exalogic and Exadata) as the cornerstone of its Datacenter Modernization endeavor which will eventually support 10,000 employees, 87,000 manufactures and 600,000 catalog items.  Hear senior business leaders from Boeing, Electronic Arts and Underwriters  Laboratories discuss how their organizations are leveraging Oracle Fusion Middleware and  Oracle Applications to improve productivity, lower IT costs and lay a  foundation for business  innovation at the following general session at Oracle Open World 2012: Session:  GEN9504 - General Session: Innovation Platform for Oracle Apps, Including Oracle Fusion ApplicationsDate: Monday, 1 Oct, 2012Time: 10:45 am - 11:45 am (PST)Venue: Moscone West (3002 / 3004)

    Read the article

  • What are some general guidelines for setting up an iOS project I will want to personally publish but sell in the future?

    - by RLH
    I have an idea for a personal iOS project that I would like to write and release to the iOS store. I'm the type of developer who enjoys developing and publishing. I want to write quality software and take care of my customers. Assuming that I wrote an application that had reasonable success, there is a fair chance that I would want to sell the ownership rights of the app to another party and I'd use the proceeds to develop my next personal project which, in turn, I'd probably want to sell in the future. With that said, what are some general guidelines for creating, making and publishing an iOS project that I will eventually want to transfer to another company/developer? I know this is a bit of a broad question, but I request that the given advice be a general list of tips, suggestions and pitfalls to avoid. If any particular bullet point on your list needs more explanation, I'll either search for the answer or post a new question specific to that requirement. Thank you! Note Regarding this Question I am posting this question on Programmers.SO because I think that this is an issue of software architecting, seeking advice for setting a new application project and publishing a project to the Apple iOS store-- all within the requirements for questions on this site.

    Read the article

  • NetBeans Podcast 69

    - by TinuA
    Podcast Guests: Terrence Barr, Simon Ritter, Jaroslav Tulach (It's an all-Oracle lineup!) Download mp3: 47 Minutes – 39.5 mb Subscribe on iTunes NetBeans Community News with Geertjan and Tinu If you missed the first two Java Virtual Developer Day events in early May, there's still one more LIVE training left on May 28th. Sign up here to participate live in the APAC time zone or watch later ON DEMAND. Video: Get started with Vaadin development using NetBeans IDE NetBeans IDE was at JavaCro 2014 and at Hippo Get-together 2014 Another great lineup is in the works for NetBeans Day at JavaOne 2014. More details coming soon! NetBeans' Facebook page is almost at 40,000 Likes! Help us crack that milestone in the next few weeks! Other great ways to stay updated about NetBeans? Twitter and Google+. 09:28 / Terrence Barr - What to Know about Java Embedded Terrence Barr, a Senior Technologist and Principal Product Manager for Embedded and Mobile technologies at Oracle, discusses new features of the Java SE Embedded and Java ME Embedded platforms, and sheds some light on the differences between them and what they have to offer to developers. Learn more about Java SE Embedded Tutorial: Using Oracle Java SE Embedded Support in NetBeans IDE Learn more about Java ME Embedded Video: NetBeans IDE Support for Java ME 8 Video: Installing and Using Java ME SDK 8.0 Plugins in NetBeans IDE Follow Terrence Barr to keep up with news in the Embedded space: Blog and Twitter 26:02 / Simon Ritter - A Massive Serving of Raspberry Pi Oracle's Raspberry Pi virtual course is back by popular demand! Simon Ritter, the head of Oracle's Java Technology Evangelism team, chats about the second run of the free Java Embedded course (starting May 30th), what participants can expect to learn, NetBeans' support for Java ME development, and other Java trainings coming to a desktop, laptop or user group near you. Sign up for the Oracle MOOC: Develop Java Embedded Applications Using Raspberry Pi Find out when Simon Ritter and the Java Evangelism team are coming to a Java event or JUG in your area--follow them on Twitter: Simon Ritter Angela Caicedo Steven Chin Jim Weaver 36:58 / Jaroslav Tulach - A Perfect Translation Jaroslav Tulach returns to the NetBeans podcast with tales about the Japanese translation of the Practical API Design book, which he contends surpasses all previous translations, including the English edition! Order "Practical API Design" (Japanese Version)  Find out why the Japanese translation is the best edition yet *Have ideas for NetBeans Podcast topics? Send them to ">nbpodcast at netbeans dot org. *Subscribe to the official NetBeans page on Facebook! Check us out as well on Twitter, YouTube, and Google+.

    Read the article

  • android View not attached to window manager...

    - by Daniel Benedykt
    Hi I am having some of the following exceptions: java.lang.IllegalArgumentException: View not attached to window manager at android.view.WindowManagerImpl.findViewLocked(WindowManagerImpl.java:355) at android.view.WindowManagerImpl.updateViewLayout(WindowManagerImpl.java:191) at android.view.Window$LocalWindowManager.updateViewLayout(Window.java:428) at android.app.Dialog.onWindowAttributesChanged(Dialog.java:596) at android.view.Window.setDefaultWindowFormat(Window.java:1013) at com.android.internal.policy.impl.PhoneWindow.access$700(PhoneWindow.java:86) at com.android.internal.policy.impl.PhoneWindow$DecorView.drawableChanged(PhoneWindow.java:1951) at com.android.internal.policy.impl.PhoneWindow$DecorView.fitSystemWindows(PhoneWindow.java:1889) at android.view.ViewRoot.performTraversals(ViewRoot.java:727) at android.view.ViewRoot.handleMessage(ViewRoot.java:1633) at android.os.Handler.dispatchMessage(Handler.java:99) at android.os.Looper.loop(Looper.java:123) at android.app.ActivityThread.main(ActivityThread.java:4338) at java.lang.reflect.Method.invokeNative(Native Method) at java.lang.reflect.Method.invoke(Method.java:521) at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) at dalvik.system.NativeStart.main(Native Method) I have google it and see that it has something to do with popups and turning the screen, but there is no reference to my code. The questions are: 1) is there a way to find out exactly when this issue is happening? 2) other than turning the screen, is there another event or action that triggers this error? 3) how do I prevent this to happen? Thanks

    Read the article

  • OpenLDAP and SSL

    - by Stormshadow
    I am having trouble trying to connect to a secure OpenLDAP server which I have set up. On running my LDAP client code java -Djavax.net.debug=ssl LDAPConnector I get the following exception trace (java version 1.6.0_17) trigger seeding of SecureRandom done seeding SecureRandom %% No cached client session *** ClientHello, TLSv1 RandomCookie: GMT: 1256110124 bytes = { 224, 19, 193, 148, 45, 205, 108, 37, 101, 247, 112, 24, 157, 39, 111, 177, 43, 53, 206, 224, 68, 165, 55, 185, 54, 203, 43, 91 } Session ID: {} Cipher Suites: [SSL_RSA_WITH_RC4_128_MD5, SSL_RSA_WITH_RC4_128_SHA, TLS_RSA_WITH_AES_128_CBC_SHA, TLS_DHE_RSA_WITH_AES_128_CBC_SHA, TLS_DHE_DSS_WITH_AES_128_CBC_SHA, SSL_RSA_W ITH_3DES_EDE_CBC_SHA, SSL_DHE_RSA_WITH_3DES_EDE_CBC_SHA, SSL_DHE_DSS_WITH_3DES_EDE_CBC_SHA, SSL_RSA_WITH_DES_CBC_SHA, SSL_DHE_RSA_WITH_DES_CBC_SHA, SSL_DHE_DSS_WITH_DES_CBC_SH A, SSL_RSA_EXPORT_WITH_RC4_40_MD5, SSL_RSA_EXPORT_WITH_DES40_CBC_SHA, SSL_DHE_RSA_EXPORT_WITH_DES40_CBC_SHA, SSL_DHE_DSS_EXPORT_WITH_DES40_CBC_SHA] Compression Methods: { 0 } *** Thread-0, WRITE: TLSv1 Handshake, length = 73 Thread-0, WRITE: SSLv2 client hello message, length = 98 Thread-0, received EOFException: error Thread-0, handling exception: javax.net.ssl.SSLHandshakeException: Remote host closed connection during handshake Thread-0, SEND TLSv1 ALERT: fatal, description = handshake_failure Thread-0, WRITE: TLSv1 Alert, length = 2 Thread-0, called closeSocket() main, handling exception: javax.net.ssl.SSLHandshakeException: Remote host closed connection during handshake javax.naming.CommunicationException: simple bind failed: ldap.natraj.com:636 [Root exception is javax.net.ssl.SSLHandshakeException: Remote host closed connection during hands hake] at com.sun.jndi.ldap.LdapClient.authenticate(Unknown Source) at com.sun.jndi.ldap.LdapCtx.connect(Unknown Source) at com.sun.jndi.ldap.LdapCtx.<init>(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getUsingURL(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getUsingURLs(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getLdapCtxInstance(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getInitialContext(Unknown Source) at javax.naming.spi.NamingManager.getInitialContext(Unknown Source) at javax.naming.InitialContext.getDefaultInitCtx(Unknown Source) at javax.naming.InitialContext.init(Unknown Source) at javax.naming.InitialContext.<init>(Unknown Source) at javax.naming.directory.InitialDirContext.<init>(Unknown Source) at LDAPConnector.CallSecureLDAPServer(LDAPConnector.java:43) at LDAPConnector.main(LDAPConnector.java:237) Caused by: javax.net.ssl.SSLHandshakeException: Remote host closed connection during handshake at com.sun.net.ssl.internal.ssl.SSLSocketImpl.readRecord(Unknown Source) at com.sun.net.ssl.internal.ssl.SSLSocketImpl.performInitialHandshake(Unknown Source) at com.sun.net.ssl.internal.ssl.SSLSocketImpl.readDataRecord(Unknown Source) at com.sun.net.ssl.internal.ssl.AppInputStream.read(Unknown Source) at java.io.BufferedInputStream.fill(Unknown Source) at java.io.BufferedInputStream.read1(Unknown Source) at java.io.BufferedInputStream.read(Unknown Source) at com.sun.jndi.ldap.Connection.run(Unknown Source) at java.lang.Thread.run(Unknown Source) Caused by: java.io.EOFException: SSL peer shut down incorrectly at com.sun.net.ssl.internal.ssl.InputRecord.read(Unknown Source) ... 9 more I am able to connect to the same secure LDAP server however if I use another version of java (1.6.0_14) I have created and installed the server certificates in the cacerts of both the JRE's as mentioned in this guide -- OpenLDAP with SSL When I run ldapsearch -x on the server I get # extended LDIF # # LDAPv3 # base <dc=localdomain> (default) with scope subtree # filter: (objectclass=*) # requesting: ALL # # localdomain dn: dc=localdomain objectClass: top objectClass: dcObject objectClass: organization o: localdomain dc: localdomain # admin, localdomain dn: cn=admin,dc=localdomain objectClass: simpleSecurityObject objectClass: organizationalRole cn: admin description: LDAP administrator # search result search: 2 result: 0 Success # numResponses: 3 # numEntries: 2 On running openssl s_client -connect ldap.natraj.com:636 -showcerts , I obtain the self signed certificate. My slapd.conf file is as follows ####################################################################### # Global Directives: # Features to permit #allow bind_v2 # Schema and objectClass definitions include /etc/ldap/schema/core.schema include /etc/ldap/schema/cosine.schema include /etc/ldap/schema/nis.schema include /etc/ldap/schema/inetorgperson.schema # Where the pid file is put. The init.d script # will not stop the server if you change this. pidfile /var/run/slapd/slapd.pid # List of arguments that were passed to the server argsfile /var/run/slapd/slapd.args # Read slapd.conf(5) for possible values loglevel none # Where the dynamically loaded modules are stored modulepath /usr/lib/ldap moduleload back_hdb # The maximum number of entries that is returned for a search operation sizelimit 500 # The tool-threads parameter sets the actual amount of cpu's that is used # for indexing. tool-threads 1 ####################################################################### # Specific Backend Directives for hdb: # Backend specific directives apply to this backend until another # 'backend' directive occurs backend hdb ####################################################################### # Specific Backend Directives for 'other': # Backend specific directives apply to this backend until another # 'backend' directive occurs #backend <other> ####################################################################### # Specific Directives for database #1, of type hdb: # Database specific directives apply to this databasse until another # 'database' directive occurs database hdb # The base of your directory in database #1 suffix "dc=localdomain" # rootdn directive for specifying a superuser on the database. This is needed # for syncrepl. rootdn "cn=admin,dc=localdomain" # Where the database file are physically stored for database #1 directory "/var/lib/ldap" # The dbconfig settings are used to generate a DB_CONFIG file the first # time slapd starts. They do NOT override existing an existing DB_CONFIG # file. You should therefore change these settings in DB_CONFIG directly # or remove DB_CONFIG and restart slapd for changes to take effect. # For the Debian package we use 2MB as default but be sure to update this # value if you have plenty of RAM dbconfig set_cachesize 0 2097152 0 # Sven Hartge reported that he had to set this value incredibly high # to get slapd running at all. See http://bugs.debian.org/303057 for more # information. # Number of objects that can be locked at the same time. dbconfig set_lk_max_objects 1500 # Number of locks (both requested and granted) dbconfig set_lk_max_locks 1500 # Number of lockers dbconfig set_lk_max_lockers 1500 # Indexing options for database #1 index objectClass eq # Save the time that the entry gets modified, for database #1 lastmod on # Checkpoint the BerkeleyDB database periodically in case of system # failure and to speed slapd shutdown. checkpoint 512 30 # Where to store the replica logs for database #1 # replogfile /var/lib/ldap/replog # The userPassword by default can be changed # by the entry owning it if they are authenticated. # Others should not be able to see it, except the # admin entry below # These access lines apply to database #1 only access to attrs=userPassword,shadowLastChange by dn="cn=admin,dc=localdomain" write by anonymous auth by self write by * none # Ensure read access to the base for things like # supportedSASLMechanisms. Without this you may # have problems with SASL not knowing what # mechanisms are available and the like. # Note that this is covered by the 'access to *' # ACL below too but if you change that as people # are wont to do you'll still need this if you # want SASL (and possible other things) to work # happily. access to dn.base="" by * read # The admin dn has full write access, everyone else # can read everything. access to * by dn="cn=admin,dc=localdomain" write by * read # For Netscape Roaming support, each user gets a roaming # profile for which they have write access to #access to dn=".*,ou=Roaming,o=morsnet" # by dn="cn=admin,dc=localdomain" write # by dnattr=owner write ####################################################################### # Specific Directives for database #2, of type 'other' (can be hdb too): # Database specific directives apply to this databasse until another # 'database' directive occurs #database <other> # The base of your directory for database #2 #suffix "dc=debian,dc=org" ####################################################################### # SSL: # Uncomment the following lines to enable SSL and use the default # snakeoil certificates. #TLSCertificateFile /etc/ssl/certs/ssl-cert-snakeoil.pem #TLSCertificateKeyFile /etc/ssl/private/ssl-cert-snakeoil.key TLSCipherSuite TLS_RSA_AES_256_CBC_SHA TLSCACertificateFile /etc/ldap/ssl/server.pem TLSCertificateFile /etc/ldap/ssl/server.pem TLSCertificateKeyFile /etc/ldap/ssl/server.pem My ldap.conf file is # # LDAP Defaults # # See ldap.conf(5) for details # This file should be world readable but not world writable. HOST ldap.natraj.com PORT 636 BASE dc=localdomain URI ldaps://ldap.natraj.com TLS_CACERT /etc/ldap/ssl/server.pem TLS_REQCERT allow #SIZELIMIT 12 #TIMELIMIT 15 #DEREF never

    Read the article

  • Android Jelly bean database is locked (code 5)

    - by mtraxdroid
    Im getting a database is locked (code 5) in my ListActivity the code works in the other versions of the Emulator but fails in the 4.1 version of the emulator E/SQLiteLog( 2132): (5) database is locked E/SQLiteDatabase( 2132): Failed to open database '/data/data/id.online.mydroid/databases/geo.db'. E/SQLiteDatabase( 2132): android.database.sqlite.SQLiteDatabaseLockedException: database is locked (code 5): , while compiling: PRAGMA al_mode E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.nativePrepareStatement(Native Method) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.acquirePreparedStatement(SQLiteConnection.java:882) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.executeForString(SQLiteConnection.java:627) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.setJournalMode(SQLiteConnection.java:313) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.setWalModeFromConfiguration(SQLiteConnection.java:287) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.open(SQLiteConnection.java:215) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.open(SQLiteConnection.java:193) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnectionPool.openConnectionLocked(SQLiteConnectionPool.java:463) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnectionPool.open(SQLiteConnectionPool.java:185) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnectionPool.open(SQLiteConnectionPool.java:177) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteDatabase.openInner(SQLiteDatabase.java:804) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteDatabase.open(SQLiteDatabase.java:789) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteDatabase.openDatabase(SQLiteDatabase.java:694) E/SQLiteDatabase( 2132): at android.app.ContextImpl.openOrCreateDatabase(ContextImpl.java:804) E/SQLiteDatabase( 2132): at android.content.ContextWrapper.openOrCreateDatabase(ContextWrapper.java:221) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteOpenHelper.getDatabaseLocked(SQLiteOpenHelper.java:224) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteOpenHelper.getReadableDatabase(SQLiteOpenHelper.java:188) E/SQLiteDatabase( 2132): at id.online.mydroid.myDB.openForRead(myDB.java:158) E/SQLiteDatabase( 2132): at id.online.mydroid.mydroid.refreshCount(mydroid.java:207) E/SQLiteDatabase( 2132): at id.online.mydroid.mydroid.onResume(mydroid.java:525) Blockquote

    Read the article

  • Android 2.2 and "Bad address family" on Socket Connect

    - by Josh
    I have a fairly simple game that works perfectly on every version now up through 2.1, but with the new 2.2 (Froyo) release I am unable to create a socket. I am using the mina package for nio, and get this exception: W/System.err( 263): java.net.SocketException: Bad address family W/System.err( 263): at org.apache.harmony.luni.platform.OSNetworkSystem.connectStreamWithTimeoutSocketImpl(Native Method) W/System.err( 263): at org.apache.harmony.luni.platform.OSNetworkSystem.connect(OSNetworkSystem.java:115) W/System.err( 263): at org.apache.harmony.nio.internal.SocketChannelImpl.connect(SocketChannelImpl.java:272) W/System.err( 263): at org.apache.harmony.nio.internal.PipeImpl$SinkChannelImpl.finishConnect(PipeImpl.java:164) W/System.err( 263): at org.apache.harmony.nio.internal.PipeImpl.(PipeImpl.java:48) W/System.err( 263): at org.apache.harmony.nio.internal.SelectorProviderImpl.openPipe(SelectorProviderImpl.java:51) W/System.err( 263): at org.apache.harmony.nio.internal.SelectorImpl.(SelectorImpl.java:141) W/System.err( 263): at org.apache.harmony.nio.internal.SelectorProviderImpl.openSelector(SelectorProviderImpl.java:58) W/System.err( 263): at java.nio.channels.Selector.open(Selector.java:48) W/System.err( 263): at org.apache.mina.transport.socket.nio.SocketConnector.startupWorker(SocketConnector.java:248) W/System.err( 263): at org.apache.mina.transport.socket.nio.SocketConnector.connect(SocketConnector.java:210) W/System.err( 263): at org.apache.mina.transport.socket.nio.SocketConnector.connect(SocketConnector.java:137) W/System.err( 263): at org.apache.mina.common.support.BaseIoConnector.connect(BaseIoConnector.java:40) Later in the log, usually immediately following I get this: W/System.err( 263): java.lang.NullPointerException W/System.err( 263): at org.apache.harmony.nio.internal.SelectorImpl.wakeup(SelectorImpl.java:418) W/System.err( 263): at org.apache.mina.transport.socket.nio.SocketConnector.connect(SocketConnector.java:222) W/System.err( 263): at org.apache.mina.transport.socket.nio.SocketConnector.connect(SocketConnector.java:137) W/System.err( 263): at org.apache.mina.common.support.BaseIoConnector.connect(BaseIoConnector.java:40) I have done all the googling and looking around I can think of and found nothing. The closest I have come seems to be an old JDK bug with ipv6 support on XP and Vista machines (I'm running Vista). Recommendations included disabling ipv6 (that did not work) and disabling ipv4 and leaving ipv6 (will not work for me as my router and ISP don't support it and so could not test anyway). Any thoughts, suggestions, things I have not tried? Thanks, Josh

    Read the article

  • Java SortedMap to Scala TreeMap

    - by Dave
    I'm having trouble converting a java SortedMap into a scala TreeMap. The SortedMap comes from deserialization and needs to be converted into a scala structure before being used. Some background, for the curious, is that the serialized structure is written through XStream and on desializing I register a converter that says anything that can be assigned to SortedMap[Comparable[_],_] should be given to me. So my convert method gets called and is given an Object that I can safely cast because I know it's of type SortedMap[Comparable[_],_]. That's where it gets interesting. Here's some sample code that might help explain it. // a conversion from comparable to ordering scala> implicit def comparable2ordering[A <: Comparable[A]](x: A): Ordering[A] = new Ordering[A] { | def compare(x: A, y: A) = x.compareTo(y) | } comparable2ordering: [A <: java.lang.Comparable[A]](x: A)Ordering[A] // jm is how I see the map in the converter. Just as an object. I know the key // is of type Comparable[_] scala> val jm : Object = new java.util.TreeMap[Comparable[_], String]() jm: java.lang.Object = {} // It's safe to cast as the converter only gets called for SortedMap[Comparable[_],_] scala> val b = jm.asInstanceOf[java.util.SortedMap[Comparable[_],_]] b: java.util.SortedMap[java.lang.Comparable[_], _] = {} // Now I want to convert this to a tree map scala> collection.immutable.TreeMap() ++ (for(k <- b.keySet) yield { (k, b.get(k)) }) <console>:15: error: diverging implicit expansion for type Ordering[A] starting with method Tuple9 in object Ordering collection.immutable.TreeMap() ++ (for(k <- b.keySet) yield { (k, b.get(k)) })

    Read the article

  • Place the business logic in Java Beans?

    - by Lirik
    I was reading this page and I found the following statement: MVC in Java Server Pages Now that we have a convenient architucture to separate the view, how can we leverage that? Java Server Pages (JSP) becomes more interesting because the HTML content can be separated from the Java business objects. JSP can also make use of Java Beans. The business logic could be placed inside Java Beans. If the design is architected correctly, a Web Designer could work with HTML on the JSP site without interfering with the Java developer. Interestingly in my textbook I pulled the following quote: In the MVC architecture... the original request is always handled by a servlet. The servlet invokes the business logic and data access code and creates beans to represent the results (that’s the model). Then, the servlet decides which Java Server Page is appropriate to present those particular results and forwards the request there (the JSP is the view). The servlet decides what business logic code applies and which JSP should present the results (the servlet is the controller). The two statements seem slightly contradicting. What is the best way to use beans: should we place business logic in them or should we only place results in them? Are there ways in which beans are inadequate for representing a model?

    Read the article

  • shift reduce&& reduce reduce errors in build parser for python garmmer

    - by user366580
    i wanna build buttom up parser by java cup i write code in java cup , it is for python language so i used grammer was written in this site : but not all grammer , i choice partial set ,just while , identifer also i smiplified them when i did compile for the java cup that i write by write this command in command prompt window : java java_cup.Main -parser CalcParser -symbols CalcSymbol < javacupfile.cup i get conflict errors ,they are of type reduce-shift conflict and reduce-reduce conflict you can see to print screen of the errors in these links image 1 click here to see imge1 the grammer was in EBNF form in as refernce site and i convert it to BNF form maybe i make mistake in converting so i get such errors the origanl grammmer was // grammer in EBNF form identifier ::= (letter|"_") (letter | digit | "_")* letter ::= lowercase | uppercase lowercase ::= "a"..."z" uppercase ::= "A"..."Z" digit ::= "0"..."9 compound_stmt ::= if_stmt | while_stmt for_stmt ::= "for" target_list "in" expression_list ":" suite ["else" ":" suite] while_stmt ::= "while" expression ":" suite ["else" ":" suite] suite ::= stmt_list NEWLINE stmt_list ::= simple_stmt (";" simple_stmt)* [";"] simple_stmt ::= expression_stmt expression_stmt ::= expression_list expression_list ::= expression ( "," expression )* [","] expression ::= conditional_expression conditional_expression ::= or_test ["if" or_test "else" expression] or_test ::= and_test | or_test "or" and_test and_test ::= not_test | and_test "and" not_test not_test ::= comparison | "not" not_test comparison ::= or_expr ( comp_operator or_expr )* comp_operator ::= "<" | ">" | "==" | ">=" | "<=" | "<>" | "!=" | "is" ["not"] | ["not"] "in" or_expr ::= xor_expr | or_expr "|" xor_expr xor_expr ::= and_expr | xor_expr "^" and_expr and_expr ::= "&" | and_expr the grammer after converting to BNF form identifier ::=letterletter| letterdigit| letter"_"| "_"letter | "_"digit | "_""_" letter ::= lowercase | uppercase lowercase ::= "a"..."z" uppercase ::= "A"..."Z" digit ::= "0"..."9 while_stmt ::= "while" expression ":" suite "else" ":" suite |"while" expression ":" suite suite ::= stmt_list NEWLINE stmt_list ::= simple_stmt ";" simple_stmt stmt_list|";" simple_stmt ::= expression_stmt expression_stmt ::= expression_list expression_list ::= expression "," expression expression_list| "," expression ::= conditional_expression conditional_expression ::= or_test "if" or_test "else" expression |or_test or_test ::= and_test | or_test "or" and_test and_test ::= not_test | and_test "and" not_test not_test ::= comparison | "not" not_test comparison ::= or_expr comp_operator or_expr comp_operator ::= "<" | ">" | "==" | ">=" | "<=" | "<>" | "!=" | "is" ["not"] | ["not"] "in" or_expr ::= xor_expr | or_expr "|" xor_expr xor_expr ::= and_expr | xor_expr "^" and_expr and_expr ::= "&" | and_expr and the java cup file that i compile and get those errors is import java.io.*; terminal COMA; terminal ELSE; terminal WHILE; terminal NEWLINE; terminal SEMCOLON; terminal CAMMA; terminal IF; terminal OR; terminal AND; terminal NOT; terminal LESS; terminal GREATER; terminal EQUAL; terminal GREATERorE; terminal LESSorE; terminal NEQUAL; terminal OROP; terminal XOROP; terminal ANDOP; terminal Integer DIGIT; terminal java.lang.String LOWERCASE; terminal java.lang.String UPPERCASE; non terminal java.lang.String IDENTIFIER; non terminal java.lang.String LETTER; non terminal COMPOUND_STMT; non terminal WHILE_STMT; non terminal EXPRESSION; non terminal SUITE ; non terminal STMT_LIST; non terminal SIMPLE_STMT; non terminal EXPRESSION_STMT; non terminal EXPRESSION_LIST; non terminal CONDITITONAL_EXPRESSION; non terminal OR_TEST; non terminal AND_TEST; non terminal NOT_TEST; non terminal COMPARISON; non terminal COMP_OPERATOR; non terminal OR_EXPR; non terminal XOR_EXPR; non terminal AND_EXPR; IDENTIFIER ::=LETTER{: System.out.printf("lowercase"); :}| {: System.out.printf("uppercase"); :} LETTER{: System.out.printf("lowercase"); :}| {: System.out.printf("uppercase"); :}| LETTER{: System.out.printf("lowercase"); :}| {: System.out.printf("uppercase"); :} DIGIT; LETTER ::= LOWERCASE | UPPERCASE; COMPOUND_STMT ::=WHILE_STMT; WHILE_STMT ::= WHILE{: System.out.printf( "while"); :} EXPRESSION COMA {: System.out.printf(":"); :} SUITE ELSE {: System.out.printf("else" ); :} COMA{: System.out.printf( ":" ); :} SUITE |WHILE{: System.out.printf( "while" ); :} EXPRESSION COMA{: System.out.printf( ":" ); :} SUITE; SUITE ::= STMT_LIST NEWLINE{: System.out.printf( "newline" ); :}; STMT_LIST ::= SIMPLE_STMT SEMCOLON{: System.out.printf( ";" ); :} SIMPLE_STMT STMT_LIST|SEMCOLON{: System.out.printf( ";" ); :}; SIMPLE_STMT ::=EXPRESSION_STMT; EXPRESSION_STMT ::=EXPRESSION_LIST; EXPRESSION_LIST ::= EXPRESSION CAMMA{: System.out.printf( "," ); :} EXPRESSION EXPRESSION_LIST| CAMMA{: System.out.printf( "," ); :}; EXPRESSION ::= CONDITITONAL_EXPRESSION; CONDITITONAL_EXPRESSION ::= OR_TEST IF{: System.out.printf( "if"); :} OR_TEST ELSE{: System.out.printf("else"); :} EXPRESSION |OR_TEST; OR_TEST ::= AND_TEST | OR_TEST OR{: System.out.printf( "or"); :} AND_TEST; AND_TEST ::= NOT_TEST | AND_TEST AND{: System.out.printf( "and"); :} NOT_TEST; NOT_TEST ::= COMPARISON | NOT{: System.out.printf("not"); :} NOT_TEST; COMPARISON ::= OR_EXPR COMP_OPERATOR OR_EXPR ; COMP_OPERATOR ::= LESS{: System.out.printf( "<"); :} | GREATER{: System.out.printf(">"); :} | EQUAL{: System.out.printf("=="); :} | GREATERorE{: System.out.printf(">="); :} | LESSorE{: System.out.printf("<="); :} | NEQUAL{: System.out.printf("!="); :}; OR_EXPR ::= XOR_EXPR | OR_EXPR OROP{: System.out.printf("|"); :} XOR_EXPR; XOR_EXPR ::= AND_EXPR | XOR_EXPR XOROP {: System.out.printf("^"); :}XOR_EXPR; AND_EXPR ::= ANDOP{: System.out.printf("&"); :} | AND_EXPR; can any one told me how can solve this errors to build parser correcrtly??

    Read the article

  • How to properly close a UDT server in Netty 4

    - by Steffen
    I'm trying to close my UDT server (Netty 4.0.5.Final) with shutDownGracefully() and reopen it on the same port. Unfortunately, I always get the socket exception below although it waits until the future has completed. I also added the socket option SO_REUSEADDR. What is the proper way to do this? Exception in thread "main" com.barchart.udt.ExceptionUDT: UDT Error : 5011 : another socket is already listening on the same UDP port : listen0:listen [id: 0x323d3939] at com.barchart.udt.SocketUDT.listen0(Native Method) at com.barchart.udt.SocketUDT.listen(SocketUDT.java:1136) at com.barchart.udt.net.NetServerSocketUDT.bind(NetServerSocketUDT.java:66) at io.netty.channel.udt.nio.NioUdtAcceptorChannel.doBind(NioUdtAcceptorChannel.java:71) at io.netty.channel.AbstractChannel$AbstractUnsafe.bind(AbstractChannel.java:471) at io.netty.channel.DefaultChannelPipeline$HeadHandler.bind(DefaultChannelPipeline.java:1006) at io.netty.channel.DefaultChannelHandlerContext.invokeBind(DefaultChannelHandlerContext.java:504) at io.netty.channel.DefaultChannelHandlerContext.bind(DefaultChannelHandlerContext.java:487) at io.netty.channel.ChannelDuplexHandler.bind(ChannelDuplexHandler.java:38) at io.netty.handler.logging.LoggingHandler.bind(LoggingHandler.java:254) at io.netty.channel.DefaultChannelHandlerContext.invokeBind(DefaultChannelHandlerContext.java:504) at io.netty.channel.DefaultChannelHandlerContext.bind(DefaultChannelHandlerContext.java:487) at io.netty.channel.DefaultChannelPipeline.bind(DefaultChannelPipeline.java:848) at io.netty.channel.AbstractChannel.bind(AbstractChannel.java:193) at io.netty.bootstrap.AbstractBootstrap$2.run(AbstractBootstrap.java:321) at io.netty.util.concurrent.SingleThreadEventExecutor.runAllTasks(SingleThreadEventExecutor.java:354) at io.netty.channel.nio.NioEventLoop.run(NioEventLoop.java:366) at io.netty.util.concurrent.SingleThreadEventExecutor$2.run(SingleThreadEventExecutor.java:101) at java.lang.Thread.run(Thread.java:724) A small test program demonstration the problem: public class MsgEchoServer { public static class MsgEchoServerHandler extends ChannelInboundHandlerAdapter { } public void run() throws Exception { final ThreadFactory acceptFactory = new UtilThreadFactory("accept"); final ThreadFactory connectFactory = new UtilThreadFactory("connect"); final NioEventLoopGroup acceptGroup = new NioEventLoopGroup(1, acceptFactory, NioUdtProvider.MESSAGE_PROVIDER); final NioEventLoopGroup connectGroup = new NioEventLoopGroup(1, connectFactory, NioUdtProvider.MESSAGE_PROVIDER); try { final ServerBootstrap boot = new ServerBootstrap(); boot.group(acceptGroup, connectGroup) .channelFactory(NioUdtProvider.MESSAGE_ACCEPTOR) .option(ChannelOption.SO_BACKLOG, 10) .option(ChannelOption.SO_REUSEADDR, true) .handler(new LoggingHandler(LogLevel.INFO)) .childHandler(new ChannelInitializer<UdtChannel>() { @Override public void initChannel(final UdtChannel ch) throws Exception { ch.pipeline().addLast(new MsgEchoServerHandler()); } }); final ChannelFuture future = boot.bind(1234).sync(); } finally { acceptGroup.shutdownGracefully().syncUninterruptibly(); connectGroup.shutdownGracefully().syncUninterruptibly(); } new MsgEchoServer().run(); } public static void main(final String[] args) throws Exception { new MsgEchoServer().run(); } }

    Read the article

< Previous Page | 506 507 508 509 510 511 512 513 514 515 516 517  | Next Page >