Search Results

Search found 21908 results on 877 pages for 'content catalog'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 529/877 | < Previous Page | 525 526 527 528 529 530 531 532 533 534 535 536  | Next Page >

  • Accessing datagrid cell in ajavascript

    - by Anil
    Datagrid is in content,When trying to access client side function for the cells in the datagrid,its always showing at 0 position suppose i have 10 rows,for each row "Test button" i should invoke the client side java script. For each row "Test button" client side script is displaying message at first row only.

    Read the article

  • paperclip plugin not support for I18n

    - by user354413
    I've added I18n support for error messages: Now you can define translations for the errors messages in e.g. your YAML locale file: en: paperclip: errors: attachment: size: "Invalid file size" content_type: "Unsupported content type" presence: "Cant' be blank" when I use validates_attachemnt_zie :avatar how to get error message?

    Read the article

  • SimpleModal Strange ASP.NET Button problem

    - by bhsstudio
    Hi I have the following codes $('#<%= btnOpen.ClientID %>').click(function() { $('#content').modal(); }); <asp:Button ID="btnOpen" runat="server" Text="Open" /> When I click on the button, the modal window will appear for about 0.5 second and disappear right away.Can anyone help me please? Thanks a lot!

    Read the article

  • Fill all avaible space.

    - by Neir0
    Hi! I have a xaml code: <Grid> <WrapPanel> <TextBox ></TextBox> <Button Content="GetIt" /> </WrapPanel> </Grid> How i can to get all avaible space for textBox? i want to do something like that: |[__________][GetIt]|

    Read the article

  • Wordpress upload from localhost to server

    - by raspberry
    I uploaded my wordpress site from my Local host to a folder off my main domain (http://example.com/folder) using this tutorial http://www.webdesignerwall.com/tutorials/exporting-and-importing-wordpress/ (im working on a mac) Everything went ok - admin panel is fine homepage is fine etc - only any page apart from the homepage redirects to this (http://example.com/folder/pagename) except instead of showing the content from that page it shows the unstyled information from the index page of my main root (http://example.com/) What can I do to get this working? Thanks

    Read the article

  • How to display a page in my browser with python code that is run locally on my computer with "GAE" S

    - by brilliant
    When I run this code on my computer with the help of "Google App Engine SDK", it displays (in my browser) the HTML code of the Google home page: from google.appengine.api import urlfetch url = "http://www.google.com/" result = urlfetch.fetch(url) print result.content How can I make it display the page itself? I mean I want to see that page in my browser the way it would normally be seen by any user of the internet.

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • How can i limit parsing and display the previously parsed contents in iphone?

    - by Warrior
    I am new to iphone development.I parsing a url and displayed its content in the table.On clicking a row it plays a video.When i click a done button, i once again call the tableview.When i call the table view it parse the url once again to display the contents .I want to limit the parsing for 1 time and for the next time i want to display the contents which are parsed at the first time.How can i achieve it ?Please help me out.Thanks.

    Read the article

  • Javascript sliding (preferably jQuery)

    - by jwzk
    I am trying to think of the name of the plugin (or a plugin) that slides content in (up or down). So I have a hidden div, I click on one of the titles/header, it opens the hidden div, if I click on another header it hides the other visible div, and slides up or down the new one. I can't think of it for some reason.. anyone?

    Read the article

  • Get main article image with PHP

    - by PaulAdamDavis
    Hello! I'd like to get the main image for an article, much like Facebook does when you post a link (but without the choosing image part). The data we have to work with is the whole pages HTML as a variable. The page & URL will be different for every time this function runs. Are there any libraries or classes that are particularly good at getting the main body of content, much like Instapaper that would be of any help?

    Read the article

  • Fancybox: Get id of clicked anchor/element

    - by kastru
    I am trying to get the id of the clicked/shown element in fancybox. I have tried both "this.id" and "this.attr("id")" - but none of them works. $("a.lightbox_image").fancybox({ 'transitionIn': 'elastic', 'transitionOut': 'elastic', 'speedIn': 600, 'speedOut': 200, 'content': 'Id of element clicked'+this.attr("id") }); Any suggestions?

    Read the article

  • jQuery animate slidding background image using mouse position wont stop... just keeps going

    - by simian
    I have a neat little jQuery script I am working on. Goal: parent div with overflow hidden holds a larger div with image. When I move the mouse to the left or right of the parent div, the div with image changes margin-left to move left or right. Problem is... if I move the mouse out of the parent div (left or right), the image keeps going. I need the image to stop when the mouse is not on the inside left or right edge of the parent div. Any ideas? <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <script type="text/javascript" src="http://code.jquery.com/jquery-latest.js"></script> <script type="text/javascript"> //<![CDATA[ jQuery.noConflict (); jQuery(document).ready(function(){ jQuery('#container').mousemove(function(e){ var parentWidth = jQuery('#container').width(); var parentWidthLeft = Math.round(.1 * jQuery('#container').width()); var parentWidthRight = Math.round(jQuery('#container').width() - parentWidthLeft); var parentHeight = jQuery('#container').height(); var parentOffset = jQuery('#container').offset(); var X = Math.round(e.pageX - parentOffset.left); var Y = Math.round(e.pageY - parentOffset.top); if (X<parentWidthLeft) { jQuery('#image').animate({'left': '-' + parentWidth }, 5000); } if (X>parentWidthRight) { jQuery('#image').animate({'left': parentWidth }, 5000); } if (X<=parentWidthRight && X>=parentWidthLeft) { jQuery('#image').stop(); } if (X<1) { jQuery('#image').stop(); } }); jQuery('#container').mouseleave(function(){ jQuery('#image').stop(); }); }); // ]]> </script> </head> <body> <div id="container" style="width: 500px; height: 500px; overflow: hidden; border: 10px solid #000; position: relative; margin: auto auto;"> <div id="image" style="position: absolute; left: 0; top: 0;"><img src="http://dump4free.com/imgdump/1/Carmen-Electra_1wallpaper1024x768.jpg" alt="" /></div> </div> </body> </html>

    Read the article

  • Problems Embedding Video using FCK Editor

    - by Exline
    Hello, I am using FCK Editor 2.6.4 and having problems trying to embed a (non-YouTube) video into a content area. I found this previous question / post: [EDIT -- as a new user, I am only able to post one link in this post. The post in question is titled, "Can I embed video using FCK Editor?") and have investigated all of the proposed solutions, but none of them work properly: 1 -- Using the "Embed Flash" button in the control panel almost works. However, the video I am attempting to add contains a querystring with parameters, like this: http://static.animoto.com/swf/w.swf?w=swf/vp1&e=1275795594&f=mGQklEgxXKs9vfEIdGnWsA&d=132&m=p&r=w&i=m&ct=Homes%20in%20Eagle%20Creek&cu=http://hometoindy.com/eagle-creek-real-estate.php&options= and in using the Flash embed tool, it encodes all of the "&" characters to "&", thus breaking them. If it were just for me, I could manually change them back, but clients who use this will not know how to do that. 2 -- I have installed the YouTube video plugin, and it works great... for YouTube. But it cannot be used to embed non-YouTube videos (it automatically changes the URL to YouTube, no matter what). 3 -- I have installed the EmbedMovies plugin, but it throws a javascript error when attempting to add a video file (such as the above) to a page. (The EmbedMovies plugin page on SourceForge says it has been updated for FCK Editor 2.6, but it does not work.) 4 -- Pasting directly into the editor window (of course) does not work. The only way I've been able to make this work is by pasting into the Source panel, and this is not a good option for clients who are not familiar with HTML. So, is there a good, working plugin for FCK editor that will allow me to quickly and easily embed a video such as the one above into a content area? I don't need to be able to see or preview it in the editor window; I just need it to work when the page is loaded on the front end. Thanks!

    Read the article

  • Best javascript i18n techniques / AJAX - dates, times, numbers, currency

    - by John Vasileff
    For server side generated content, i18n support is usually pretty easy, for example, Java provides extensive i18n support. But, these rich server side libraries are not available within the browser, which causes a problem when trying to format data client side (AJAX style.) What javascript libraries and techniques are recommended for performing client side formatting and time-zone calculations? Also - beyond simple client side formatting, how can consistency be achieved when performing both server side and client side formatting?

    Read the article

  • Is there a way to stop all javascript on the page?

    - by M28
    I need to stop all the javascript running on the page, but I have a limitation: I cannot control the tags content, I am editing the page after it's being loaded. Also, I need to remove all the variables defined by the old script that was running and stop all the intervals.

    Read the article

  • I can't access certain subkeys in an entry in the registry

    - by shifuimam
    I'm trying to get to HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\GameUX\, but the only subkey being returned in C# is MachineSettings - even though there are additional subkeys, including Games and several keys named for different user SIDs. How can I access these other keys? Even a standard user account can read the content of both Games and that account's own SID (when looking in regedit)...

    Read the article

  • Unable to use getInt() but able to use getString() for a sqlite database

    - by mwrazam
    I am using a cursor to access a sqlite database I have in my app. I am having trouble using the .getInt() on my database. My database is pre-created, and I have a few cursors that perform queries to interface with the information. Several of the columns in one of the tables are set as INTEGER type. I realize that sqlite has no built in check to make sure columns are indeed INT. However, when retrieving the data, I can use the .getString() function without any issues, but calling .getInt() causes the app to crash. Below is the relevant code. If I am missing anything, please let me know, and I'll add it in. Any help is greatly appreciated. Thank you very much. Cursor: public Cursor getSkitStats(int module, int skit) { Cursor mCursor = myDataBase.rawQuery("SELECT * FROM score WHERE mod="+module+" AND skit="+skit+"", null); if (mCursor != null) { mCursor.moveToFirst(); } return mCursor; } and I am using a simple Toast call to output the result of the query: Toast.makeText(getApplicationContext(), scoreContent.getInt(0), Toast.LENGTH_SHORT).show(); The variable scoreContent is the cursor. And here is the crash output: 07-08 23:53:31.726: E/AndroidRuntime(15685): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1659) 07-08 23:53:31.726: E/AndroidRuntime(15685): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1675) 07-08 23:53:31.726: E/AndroidRuntime(15685): at android.app.ActivityThread.access$1500(ActivityThread.java:121) 07-08 23:53:31.726: E/AndroidRuntime(15685): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:943) 07-08 23:53:31.726: E/AndroidRuntime(15685): at android.os.Handler.dispatchMessage(Handler.java:99) 07-08 23:53:31.726: E/AndroidRuntime(15685): at android.os.Looper.loop(Looper.java:130) 07-08 23:53:31.726: E/AndroidRuntime(15685): at android.app.ActivityThread.main(ActivityThread.java:3701) 07-08 23:53:31.726: E/AndroidRuntime(15685): at java.lang.reflect.Method.invokeNative(Native Method) 07-08 23:53:31.726: E/AndroidRuntime(15685): at java.lang.reflect.Method.invoke(Method.java:507) 07-08 23:53:31.726: E/AndroidRuntime(15685): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:866) 07-08 23:53:31.726: E/AndroidRuntime(15685): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:624) 07-08 23:53:31.726: E/AndroidRuntime(15685): at dalvik.system.NativeStart.main(Native Method) 07-08 23:53:31.726: E/AndroidRuntime(15685): Caused by: android.content.res.Resources$NotFoundException: String resource ID #0x2 07-08 23:53:31.726: E/AndroidRuntime(15685): at android.content.res.Resources.getText(Resources.java:205) 07-08 23:53:31.726: E/AndroidRuntime(15685): at android.widget.Toast.makeText(Toast.java:258) 07-08 23:53:31.726: E/AndroidRuntime(15685): at jp.atomicideas.ne.Summary.onCreate(Summary.java:90) 07-08 23:53:31.726: E/AndroidRuntime(15685): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1047) 07-08 23:53:31.726: E/AndroidRuntime(15685): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1623) 07-08 23:53:31.726: E/AndroidRuntime(15685): ... 11 more

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 525 526 527 528 529 530 531 532 533 534 535 536  | Next Page >