Search Results

Search found 37414 results on 1497 pages for 'open port'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 529/1497 | < Previous Page | 525 526 527 528 529 530 531 532 533 534 535 536  | Next Page >

  • How do I determine which C/C++ compiler to use?

    - by Adam Siddhi
    Greetings, I am trying to figure out which C/C++ compiler to use. I found this list of C/C++ compilers at Wikipedia: http://en.wikipedia.org/wiki/List_of_compilers#C.2FC.2B.2B_compilers I am fairly certain that I want to go with an open source compiler. I feel that if it is open source then it will be a more complete compiler since many programmer perspectives are used to make it better. Please tell me if you disagree. I should mention that I plan on learning C/C++ mainly to program 2D/3D game applications that will be compatible with Windows, Linux, MAC and iPhone operating systems. I am currently using Windows Vista x64 OS. Thanks, Adam

    Read the article

  • Strange Email Activity Ruby on Rails

    - by Stranger
    Environment.rb ActionMailer::Base.delivery_method = :sendmail ActionMailer::Base.sendmail_settings = { :address = "mail.example.org", :domain = "example.org", :port = 25, :authentication = :login, :user_name = "email+email.org", :password = "password" } ActionMailer::Base.perform_deliveries = true ActionMailer::Base.raise_delivery_errors = true ActionMailer::Base.default_charset = "utf-8" Development.log Sent mail to [email protected] Date: Sat, 17 Apr 2010 19:38:08 -0500 From: example.org To: [email protected] Subject: Hello Mime-Version: 1.0 Content-Type: text/plain; charset=utf-8 The process of sending email is ok but when I check my email I didn't recive any. What seems to be wrong?

    Read the article

  • Python UTF-16 encoding hex representation

    - by Romeno
    I have a string in Python 2.7.2 say u"\u0638". When I write it to file: f = open("J:\\111.txt", "w+") f.write(u"\u0638".encode('utf-16')) f.close() In hex it looks like: FF FE 38 06 When i print such a string to stdout i will see: '\xff\xfe8\x06'. The querstion: Where is \x38 in the string output to stdout? In other words why the string output to stdout is not '\xff\xfe\x38\x06'? If I write the string to file twice: f = open("J:\\111.txt", "w+") f.write(u"\u0638".encode('utf-16')) f.write(u"\u0638".encode('utf-16')) f.close() The hex representation in file contains byte order mark (BOM) \xff\xfe twice: FF FE 38 06 FF FE 38 06 I wonder what is the techique to avoid writting BOM in UTF-16 encoded strings?

    Read the article

  • How do I access Glassfish V3 Administration Console Website from a remote host

    - by Tom
    I have installed Glassfish v3 on a standalone server running ubuntu-server 9.10. I can open the Admin website if I use a browser running on the server by browsing to: http:// localhost:4848/ I would like to access it from a remote machine by browsing to something like http:// mydomain.com:4848/ The firewall is definitely allowing traffic through on that port (4848) and I can access the application server by browsing to: http:// mydomain.com:8080/ How can I allow remote access to the administration website?

    Read the article

  • Jqm is not a function

    - by kris
    Hi all, I'm having some trouble with Jquery and JqModal, and I hope you are able to help, since I've been struggling for hours.. Having a single button element with an onclick action running my method "test" (shown below): $('#picture_form').jqm({ajax: '/test.php'}); $('#picture_form').jqmShow(); This will load the ajax content of test.php into my div element picture_form, shown using JqModal as its supposed to! Though when I close this window, and re-clicks the button I'm getting the error: $("#picture_form").jqm is not a function. As a solution I've tried to use the JqModal trigger function, and this leaves me able to open and close the JqModal windows as many times as I want to. Sadly I can only call the 'trigger' using test environment, in my production code I have to open the JqModal window using a function.. Does anyone have a clue why this 'bug' appears when calling the opening when using a function? Thanks in advance

    Read the article

  • How to make Python check if ftp directory exists?

    - by Phil
    I'm using this script to connect to sample ftp server and list available directories: from ftplib import FTP ftp = FTP('ftp.cwi.nl') # connect to host, default port (some example server, i'll use other one) ftp.login() # user anonymous, passwd anonymous@ ftp.retrlines('LIST') # list directory contents ftp.quit() How do I use ftp.retrlines('LIST') output to check if directory (for example public_html) exists, if it exists cd to it and then execute some other code and exit; if not execute code right away and exit?

    Read the article

  • Excel 2010 Access to path is denied temp

    - by Chris Anderson
    I am using excel data reader to read data from an excel file. FileStream stream = File.Open(filePath, FileMode.Open, FileAccess.Read); //1. Reading from a binary Excel file ('97-2003 format; *.xls) IExcelDataReader excelReader = ExcelReaderFactory.CreateBinaryReader(stream); //2. Reading from a OpenXml Excel file (2007 format; *.xlsx) IExcelDataReader excelReader = ExcelReaderFactory.CreateOpenXmlReader(stream); http://exceldatareader.codeplex.com/ This reads excel 1997-2003 format and excel 2007 format on my local machine and when we move it to our test server. However, when moved to production, it works for excel 97-2003 files, but when I try to read 2007 files I receive the following error: Access to the path 'C:\Documents and Settings\PORTALS03\ASPNET\LOCALS~1\Temp\TMP_Z129388041687919815' is denied. How is it possible that the 97-2003 excel file can be read but the 2007 files throw access is denied?

    Read the article

  • Extract a C/C++ header file from a C# class exposed to COM

    - by isorfir
    I'm not sure I've setup everything I've needed to in my C# class to properly, but it does work in COM. I've been looking for an example of a C# class that was successfully used in a C/C++ project, but haven't come across anything. I've tried using the OLE/COM Object View app to open the .tlb file and save as .h, but it gives some errors: MIDL1009: unknown argument ignored; MIDL1001: cannot open input file Studio "Studio" isn't the name of the file, it's Syslog, so that raises a red flag to me. Any ideas?

    Read the article

  • Read entire file in Scala?

    - by Brendan OConnor
    What's a simple and canonical way to read an entire file into memory in Scala? (Ideally, with control over character encoding.) The best I can come up with is: scala.io.Source.fromPath("file.txt").getLines.reduceLeft(_+_) or am I supposed to use one of Java's god-awful idioms, the best of which (without using an external library) seems to be: import java.util.Scanner import java.io.File new Scanner(new File("file.txt")).useDelimiter("\\Z").next() From reading mailing list discussions, it's not clear to me that scala.io.Source is even supposed to be the canonical I/O library. I don't understand what its intended purpose is, exactly. ... I'd like something dead-simple and easy to remember. For example, in these languages it's very hard to forget the idiom ... Ruby open("file.txt").read Ruby File.read("file.txt") Python open("file.txt").read()

    Read the article

  • Error while compiling the Xcode project (IPhone)

    - by Sridhar
    Hello, I added ffmpeg iphone port into my library and I can able to use a few of its functions like avcodec_init(),.. without any errors. But when I include this function call "avcodec_register_all" Xcode is giving error after compilation The error message is : *--------------- ld: ldr 12-bit displacement out of range (4276 max +/-4096) in _CFRelease$stub in _CFRelease$stub from /Users/foxit/Documents/CameraTest/build/CameraTest.build/Debug-iphoneos/CameraTest.build/Objects-normal/armv6/CameraTest Command /Developer/Platforms/iPhoneOS.platform/Developer/usr/bin/gcc-4.2 failed with exit code 1 *------------- Does anyone know whats wrong with this ? Regards, Raghu

    Read the article

  • How do I modify a HTTP response packet with winpcap?

    - by httpinterpret
    There are two problems here: What if content is encoded:gzip... Do I also need to change the header part to make the HTTP packet valid(checksums if any?) UPDATE Can someone with actual experience elaborate the steps involved? I'm using winpcap and bpf tcp and src port 80 to filter the traffic,so my job lies in this callback function: void packet_handler(u_char *param, const struct pcap_pkthdr *header, const u_char *pkt_data)

    Read the article

  • Web service reference location?

    - by Damien Dennehy
    I have a Visual Studio 2008 solution that's currently consisting of three projects: A DataFactory project for Business Logic/Data Access. A Web project consisting of the actual user interface, pages, controls, etc. A Web.Core project consisting of utility classes, etc. The application requires consuming a web service. Normally I'd add the service reference to the Web project, but I'm not sure if this is best practice or not. The following options are open to me: Add the reference to the Web project. Add the reference to the Web.Core project, and create a wrapper method that Web will call to consume the web service. Add a new project called Web.Services, and copy step 2. This project is expected to increase in size so I'm open to any suggestions.

    Read the article

  • How can I parse this configuration file format (allowing comments) in Perl?

    - by rockyurock
    I am reading some parameters (from user input) from a .txt file and want to make sure that my script could read it even a space or tab is left before that particular parameter by user. Also if I want to add a comment for each parameter followed by # , after the parameter (e.g 7870 # this is default port number) to let the user know about the parameter How can I achieve it in same file? Right now, I am using split /\|\s/. Code: $data_file="config.txt"; open(RAK, $data_file)|| die("Could not open file!"); @raw_data=<RAK>; @Ftp_Server =split(/\|\s/,$raw_data[32]); config.txt (user input file) PING_TTL | 1 CLIENT_PORT | 7870 FTP_SERVER | 192.162.522.222 Could any body suggest me a robust way to do it? /rocky

    Read the article

  • Access Denied Java FileWriter / FileInputStream

    - by Matt
    My program downloads a websites source code, modifies it, creates the file, and then reuploads it through the FTP. However, I receive the following error when trying to open the created file: java.io.FileNotFoundException: misc.html (Access is denied) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.<init>(Unknown Source) at Manipulator.uploadSource(Manipulator.java:63) at Start.addPicture(Start.java:130) at Start$2.actionPerformed(Start.java:83) at javax.swing.AbstractButton.fireActionPerformed(Unknown Source) at javax.swing.AbstractButton$Handler.actionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.fireActionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.setPressed(Unknown Source) at javax.swing.plaf.basic.BasicButtonListener.mouseReleased(Unknown Source) at java.awt.Component.processMouseEvent(Unknown Source) at javax.swing.JComponent.processMouseEvent(Unknown Source) at java.awt.Component.processEvent(Unknown Source) at java.awt.Container.processEvent(Unknown Source) at java.awt.Component.dispatchEventImpl(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.LightweightDispatcher.retargetMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.processMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.dispatchEvent(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Window.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.EventQueue.dispatchEvent(Unknown Source) at java.awt.EventDispatchThread.pumpOneEventForFilters(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForFilter(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForHierarchy(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.run(Unknown Source) When I navigate to the folder directory and attempt to open "misc.html" with Notepad I receive Access is Denied. My code is fairly simple: File f = new File(page.sourceFileName); try { FileWriter out = new FileWriter(f); out.write(page.source); out.close(); } catch (IOException e) { e.printStackTrace(); } InputStream input = new FileInputStream(f); This is the vital excerpt from my program. I have copied this into a different test program and it works fine, I create a misc.html file and reopen it with both FileInputStream and manually. I would be worried about Administrator rights but the Test program works fine when I run it RIGHT after the problem program. I also have checked if the file exists and is a file with File methods and it is as well. Is this a result of me not closing a previous Input/Output properly? I've tried to check everything and I am fairly positive I close all streams as soon as they finish... Help! :)

    Read the article

  • SharePoint 2010 is forcing me to safe PDF when opening from doc library

    - by Tobias Funke
    I have a document library with a PDF file. Whenever I click on the PDF file, I am prompted to save the file. I do not get the option of opening the file, I am forced to save it. What I want is for the PDF file to open, either in the browser or in a separate Adobe Reader window, depending on the Adobe Reader settings. I'm pretty sure SharePoint is responsible for this behavior, because if I put the PDF on my hard drive, then create a HTML file with a link to the file, it opens in the browser when I click on it. Please note: I looked at this question and did not help. I don't care if the PDF opens in the browser or in a separate Adobe Reader window, I just want it to open.

    Read the article

  • Javascript/iframe/embed/object question

    - by thinkfuture
    OK, so here is my issue. I'm building a system which will allow people to embed lists of links on their pages. When the link is clicked, i'd like to use something like Lightview or Lightwindow to open it up over the whole window, not just in the iframe. I don't have access to the page that the user will be embedding this object into. Everything I've tried so far tells me that I can't open anything over the parent window, since I don't have access to it from the iframe or object, javacript security issue. However, I've seen sites that do that kind of overlay. so it must be possible. If anyone can point me to any resources that could help, that would be great. if it matters, i'm using Ruby on Rails... Thanks...chris

    Read the article

  • Algorithmic trading software safety guards

    - by Adal
    I'm working on an automatic trading system. What sorts of safe-guards should I have in place? The main idea I have is to have multiple pieces checking each other. I will have a second independent little process which will also connect to the same trading account and monitor simple things, like ensuring the total net position does not go over a certain limit, or that there are no more than N orders in 10 minutes for example, or more than M positions open simultaneously. You can also check that the actual open positions correspond to what the strategy process thinks it actually holds. As a bonus I could run this checker process on a different machine/network provider. Besides the checks in the main strategy, this will ensure that whatever weird bug occurs, nothing really bad can happen. Any other things I should monitor and be aware of?

    Read the article

  • Programatically change cursor speed in windows

    - by Juan Manuel Formoso
    Since getting a satisfactory answer on SuperUser is very difficult, I want to rephrase this question and ask: Is there any way to programatically detect a mouse was plugged in the usb port, and change the cursor speed in windows (perhaps through an API)? I'd like to use C#, but I'm open to any language that can run on a windows 7 machine.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How can I load a file into a DataBag from within a Yahoo PigLatin UDF?

    - by Cervo
    I have a Pig program where I am trying to compute the minimum center between two bags. In order for it to work, I found I need to COGROUP the bags into a single dataset. The entire operation takes a long time. I want to either open one of the bags from disk within the UDF, or to be able to pass another relation into the UDF without needing to COGROUP...... Code: # **** Load files for iteration **** register myudfs.jar; wordcounts = LOAD 'input/wordcounts.txt' USING PigStorage('\t') AS (PatentNumber:chararray, word:chararray, frequency:double); centerassignments = load 'input/centerassignments/part-*' USING PigStorage('\t') AS (PatentNumber: chararray, oldCenter: chararray, newCenter: chararray); kcenters = LOAD 'input/kcenters/part-*' USING PigStorage('\t') AS (CenterID:chararray, word:chararray, frequency:double); kcentersa1 = CROSS centerassignments, kcenters; kcentersa = FOREACH kcentersa1 GENERATE centerassignments::PatentNumber as PatentNumber, kcenters::CenterID as CenterID, kcenters::word as word, kcenters::frequency as frequency; #***** Assign to nearest k-mean ******* assignpre1 = COGROUP wordcounts by PatentNumber, kcentersa by PatentNumber; assignwork2 = FOREACH assignpre1 GENERATE group as PatentNumber, myudfs.kmeans(wordcounts, kcentersa) as CenterID; basically my issue is that for each patent I need to pass the sub relations (wordcounts, kcenters). In order to do this, I do a cross and then a COGROUP by PatentNumber in order to get the set PatentNumber, {wordcounts}, {kcenters}. If I could figure a way to pass a relation or open up the centers from within the UDF, then I could just GROUP wordcounts by PatentNumber and run myudfs.kmeans(wordcount) which is hopefully much faster without the CROSS/COGROUP. This is an expensive operation. Currently this takes about 20 minutes and appears to tack the CPU/RAM. I was thinking it might be more efficient without the CROSS. I'm not sure it will be faster, so I'd like to experiment. Anyway it looks like calling the Loading functions from within Pig needs a PigContext object which I don't get from an evalfunc. And to use the hadoop file system, I need some initial objects as well, which I don't see how to get. So my question is how can I open a file from the hadoop file system from within a PIG UDF? I also run the UDF via main for debugging. So I need to load from the normal filesystem when in debug mode. Another better idea would be if there was a way to pass a relation into a UDF without needing to CROSS/COGROUP. This would be ideal, particularly if the relation resides in memory.. ie being able to do myudfs.kmeans(wordcounts, kcenters) without needing the CROSS/COGROUP with kcenters... But the basic idea is to trade IO for RAM/CPU cycles. Anyway any help will be much appreciated, the PIG UDFs aren't super well documented beyond the most simple ones, even in the UDF manual.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 525 526 527 528 529 530 531 532 533 534 535 536  | Next Page >