Search Results

Search found 25614 results on 1025 pages for 'content filter'.

Page 531/1025 | < Previous Page | 527 528 529 530 531 532 533 534 535 536 537 538  | Next Page >

  • How to auto advance a PowerPoint slide after an exit animation is over?

    - by joooc
    PowerPoint entrance animation set up with "Start: With Previous" starts right when a new slide is advanced. However, if you set up an exit animation in the same way, it doesn't start with a slide ending sequence. Instead, the "Start: On Click" trigger needs to be used and after your exit animation is over you still need one extra click just to advance to the next slide. Workarounds to this are obvious: create a duplicate slide, make your ending animations from the original slide being your starting animations on the duplicate slide and let them be followed with whatever you want or create a transition slide with those ending animations only and set up "Change Advance slide - Automatically after - [the time it takes your animations to finish]". These workarounds will make it work for your audience, visually. However, it has an impact on slide numbers you might need to adjust accordingly and/or duplicate content changes. If you are the only one creating and using your presentation, this might be just fine. But if you are creating a presentation in collaborative mode with three other people and don't even know who will be the presenter at the end, you can mess things up. Let's be specific: most of my slides have 0.2s fly in entrance animation applied to blocks of content coming from right, bottom or left. Advancing to the next slide I want them to fly out in another 0.2s exit animation being followed by new slide 0.2s fly in entrance animation of the new blocks. The swapping of the blocks should be triggered while advancing to the next slide, as usually. As mentioned, I'm not able to achieve this without one extra click between the slides. I wrote a VBA script that should start together with an exit animation and will auto advance a slide after 0.3s when the exit animation is over. That way I should get rid of those extra clicks which are needed right now. Sub nextslide() iTime = 0.3 Start = Timer While Timer < Start + iTime DoEvents Wend With SlideShowWindows(1).View .GotoSlide (ActivePresentation.SlideShowWindow.View.Slide.SlideIndex + 1) End With End Sub It works well when binded on a box, button or another object. But I can't make it run on a single click (anywhere on the slide) so that it could start together with the exit animation onclick trigger. Creating a big transparent rectangular shape over the whole slide and binding the macro on it doesn't help either. By clicking it you only get the macro running, exit animation is not triggered. Anyway, I don't want to bind the macro to any other workaround object but the slide itself. Anyone knows how to trigger a PowerPoint VBA script on slide onclick event? Anyone knows a secret setting that will make the exit animation work as expected i.e. animating right before exiting a slide while transitioning to the next one? Anyone knows how to beat this dragon? Thank you!

    Read the article

  • Burn 30GB zip file to DVD

    - by Joel Coehoorn
    I have a zip 30GB zip file containing an archive a digital materials available in the school library that I want to burn to dvd. Of course, 30Gb is far too large for a single dvd and the content is already zipped. I'm open to ideas, but leaning towards suggestions that will help me automatically spread the file over multiple dvds, including a simple program to stitch it back together again later.

    Read the article

  • Does hosting multiple sites on one server hurt your SEO?

    - by MarathonStudios
    I have a handful of (content unrelated) sites with decent PRs and I'm considering hosting them all on the same server. I've heard that if you do this, internal linking between two seperate domains on that server may be seen as less "valid" by Google in PageRank terms (since you obviously own both of the sites as they share an IP address). Anyone have any experience in this? I'd love to save some hosting cash by consolidating, but not at the expense of losing the ability to link my sites together powerfully.

    Read the article

  • How to use rsync when filenames contain double quotes?

    - by wfoolhill
    I am trying to synchronize the content of the directory my_dir/ from /home to /backup. This directory contains a file which name has a double quote in it, such as to"to. Here is my rsync command: rsync -Cazh /home/my_dir/ /backup/my_dir/ And I get the following message: rsync: mkstemp "/backup/my_dir/.to"to.d93PZr" failed: Invalid argument (22) For info, rsync works well when the synchronized filenames contain single quote, parenthesis and space. Thus, why is it bugging with a double quote? Thanks for any help.

    Read the article

  • nginx url rewrites for php-urls

    - by Tronic
    i have to permament redirect some old urls in nginx. the old urls are old-style php urls including a parameter for loading content. they look like this: http://www.foo.com/index.php?site=foo http://www.foo.com/index.php?site=bar i want to redirect them to other urls like: http://www.foo.com/news http://www.foo.com/gallery any advice on how i can achieve this? my tries failed. thanks in advance!

    Read the article

  • How can I read out internal pdf creation/modified date with Windows PowerShell?

    - by Martin
    PDF files seem to have a separate set of file properties which contain (among others) a creation date and a modified date (see screenshot here: http://ventajamarketing.com/writingblog/wp-content/uploads/2012/02/Acrobat-Document-Properties1-300x297.png). Those date obviously can differ from the creation and modified date shown in the file system (Windows Explorer). How can I access the date information in the PDF file and read it out in Windows 7 with Windows PowerShell (or maybe another method)?

    Read the article

  • Beginner server local installation

    - by joanjgm
    Here's the thing I own a small business and currently my emails are being managed by some regular hosting using cpanel and that I bought a small server and installed windows server and exchange Can you tell what I did wrong here Installed and configured my current existing domain Configured all email address Installed noip in case my public address change In the cpanel of the domain I've added an MX record to the noip domain of the server with priority 0 so now emails are being received by my own server Now whenever I send an email to anyone gmail hotmail etc I get a response that cannot be delivered since may be junk This didn't happen when I sent emails from the hosting What's missing what did I do wrong heres the code mx.google.com rejected your message to the following e-mail addresses: Joan J. Guerra Makaren ([email protected]) mx.google.com gave this error: [186.88.202.13 12] Our system has detected that this message is likely unsolicited mail. To reduce the amount of spam sent to Gmail, this message has been blocked. Please visit http://support.google.com/mail/bin/answer.py?hl=en&answer=188131 for more information. cn9si815432vcb.71 - gsmtp Your message wasn't delivered due to a permission or security issue. It may have been rejected by a moderator, the address may only accept e-mail from certain senders, or another restriction may be preventing delivery. Diagnostic information for administrators: Generating server: SERVERMEGA.megaconstrucciones.com.ve [email protected] mx.google.com #550-5.7.1 [186.88.202.13 12] Our system has detected that this message is 550-5.7.1 likely unsolicited mail. To reduce the amount of spam sent to Gmail, 550-5.7.1 this message has been blocked. Please visit 550-5.7.1 http://support.google.com/mail/bin/answer.py?hl=en&answer=188131 for 550 5.7.1 more information. cn9si815432vcb.71 - gsmtp ## Original message headers: Received: from SERVERMEGA.megaconstrucciones.com.ve ([fe80::9096:e9c2:405b:6112]) by SERVERMEGA.megaconstrucciones.com.ve ([fe80::9096:e9c2:405b:6112%10]) with mapi; Thu, 29 May 2014 11:32:19 -0430 From: prueba <[email protected]> To: "Joan J. Guerra Makaren" <[email protected]> Subject: Probando correos Thread-Topic: Probando correos Thread-Index: Ac97V1eW4OBFmoqJTRGoD7IPTC2azg== Date: Thu, 29 May 2014 16:04:35 +0000 Message-ID: <[email protected]> Accept-Language: en-US, es-VE Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: Content-Type: multipart/alternative; boundary="_000_000f42494487966276f7b241megaconstruccionescomve_" MIME-Version: 1.0

    Read the article

  • Recover not properly burned DVD from camcoder

    - by tomo
    Can anybody suggest me any good and preferably free software - working on Vista / 7 - for recovering content from DVD disks? A few DVD-R VOB files cannot be read from disk by Windows. Probably the camera failed to burn it correctly. What I want to achieve is to skip a few invalid frames in VOB files and recreate proper MPEG stream - without re-encoding whole stream and loosing the quality.

    Read the article

  • Force www. on multi domain site and retain http or https [closed]

    - by John Isaacks
    I am using CakePHP which already contains an .htaccess file that looks like: <IfModule mod_rewrite.c> RewriteEngine on RewriteRule ^$ app/webroot/ [L] RewriteRule (.*) app/webroot/$1 [L] </IfModule> I want to force www. (unless it is a subdomain) to avoid duplicate content penalties. It needs to retain http or https Also This application will have multiple domains pointing to it. So the code needs to be able to work with any domain.

    Read the article

  • Mails are coming from mail server to my account automatically...???

    - by Jayakrishnan T
    Hi all, i am getting same mail from admin account of my mail server every day automatically.The content of the mail is given below. Click here to access your spam quarantine. The spam quarantine contains emails that are being held from your email account. Quarantined emails can be released to your inbox or deleted using the spam quarantine link. Please give me an advice to solve this problem.

    Read the article

  • Is the guideline: don't open email attachments or execute downloads or run plug-ins (Flash, Java) from untrusted sites enough to avert infection?

    - by therobyouknow
    I'd like to know if the following is enough to avert malware as I feel that the press and other advisory resources aren't always precisely clear on all the methods as to how PCs get infected. To my mind, the key step to getting infected is a conscious choice by the user to run an executable attachment from an email or download, but also viewing content that requires a plug-in (Flash, Java or something else). This conscious step breaks down into the following possibilities: don't open email attachments: certainly agree with this. But lets try to be clear: email comes in 2 parts -the text and the attachment. Just reading the email should not be risky, right? But opening (i.e. running) email attachments IS risky (malware can be present in the attachment) don't execute downloads (e.g. from sites linked from in suspect emails or otherwise): again certainly agree with this (malware can be present in the executable). Usually the user has to voluntary click to download, or at least click to run the executable. Question: has there ever been a case where a user has visited a site and a download has completed on its own and run on its own? don't run content requiring plug-ins: certainly agree: malware can be present in the executable. I vaguely recall cases with Flash but know of the Java-based vulnerabilities much better. Now, is the above enough? Note that I'm much more cautious than this. What I'm concerned about is that the media is not always very clear about how the malware infection occurs. They talk of "booby-trapped sites", "browser attacks" - HOW exactly? I'd presume the other threat would be malevolent use of Javascript to make an executable run on the user's machine. Would I be right and are there details I can read up on about this. Generally I like Javascript as a developer, please note. An accepted answer would fill in any holes I've missed here so we have a complete general view of what the threats are (even though the actual specific details of new threats vary, but the general vectors are known).

    Read the article

  • Rule of thumb in RAM estimate for static pages? [closed]

    - by IMB
    Possible Duplicate: How do you do Load Testing and Capacity Planning for Web Sites I've seen tutorials saying they can run decent websites on 64MB RAM (Debian/Lighttpd/PHP/MySQL) however it's not clearly defined how much hits/traffic a "decent" site gets. Is there a rule of thumb on how much RAM a web server needs? To keep things simple, let's say you're running a site with static content and it's averaging at 100,000 hits per hour (HTML + images combined, no MySQL). How much RAM is the minimum requirement for that?

    Read the article

  • IIS, SSL, and Virtual Directories

    - by yodie
    I'm running a webserver on WS 2k3, IIS 6.0. Some of the content is on that server, but most is in a virtual directory linked to another server. Everything works (almost) fine when no SSL is used. However, when using SSL, I cannot access the files in the virtual directory. Instead I get a generic error 500. Any advice?

    Read the article

  • Copying SharePoint DB to a new SharePoint 2010 server

    - by LJe
    Hi - we would like to know what is the best and easy way to configure a new SharePoint 2010 Server, we have backup the existing DB of SharePoint 2007 (up and running). We would like to mirror the same settings and content of our current SharePoint setup to the new server using the SharePoint 2010.

    Read the article

  • How to allow only specific directories to use htaccess?

    - by DisgruntledGoat
    Currently in apache2.conf I have AllowOverride all set for /var/www which simply allows htaccess for all the sites on the server (which is Ubuntu, 9.04). However, I'd rather only allow overrides in each site root directory and nothing else. In other words, /var/www/site1, /var/www/site2, etc. can have a htaccess, but all other directories including /var/www and /var/www/site1/content cannot. Is there a way to do this without having to write a rule for every site on the server?

    Read the article

  • Create a certificate file

    - by saeed hardan
    I have a proxy that I want to test. The proxy generates a private key and a certificate like here . I have tried to copy the content as in the link in a file and name it x.CER , then clicked on it and i got the message : This file is invalid for use as the following : Security Certificate how can i install them on windows ? note: I have set in internet options that all the traffic goes throw the proxy

    Read the article

  • Where should I configure software installed by 3rd-party chef recipes?

    - by FRKT
    I'm provisioning a Vagrant virtual machine with Chef and it's amazing, but I'm unsure where I should put code to configure software installed by 3rd-party chef recipes. For example, I'm installing NGINX with this recipe but I need to configure the default virtual host to serve content from /vagrant/public instead of /var/www/nginx-default. Should I change the template of the 3rd-party recipe, or create another recipe that reconfigures it?

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Java application delivery through CDN

    - by tuler
    We have a java application bundled as an applet or as webstart. The client java plugin caches the jar files on the client machine and downloads a new version if there is one. Is it possible to deliver this jar files using a CDN? What are the issues involved? Which CDNs would work for jar delivery? Is this different from static content delivery like images or video?

    Read the article

  • source command in Linux

    - by Rodnower
    My question is: why if I run some file with name aliases for example with content such as: alias lsa="ls -a" directly: $ ./aliases it don't create the alias (may be only in script context). But if I run it with command "source": $ source aliases it do the work? I mean after execution the alias "lsa" existing in context of command shell? "man source" give: "No manual entry for source", and in google I just found that it runs Tcl, but why Tcl influence shell context and bush not?

    Read the article

  • How do I configure Gnome 3 so that it doesn't pop up a dialog for 'open with files' when I mount a drive?

    - by michael
    I am running Gnome 3 on Ubuntu 11.10. In the file manager, when I click a drive under 'Devices', Gnome 3 always pops up a dialog with the choices 'open with files' and 'eject' and then I need to click 'open with files' to get rid of that dialog. Is there a way to configure Gnome 3 not to do that? I am in file manager already, clicking a drive should show the content in the right pane. Why does it still ask me to 'open with files'?

    Read the article

  • Windows XP restarts itself suddenly

    - by LaD
    My computer (Windows XP sp3) gets stuck suddenly and restarts itself. When Windows loads I get the following message: error Signature: BCCode : 100000d1 BCP1 : 0000674B BCP2 : 00000002 BCP3 : 00000000 BCP4 : BA9910DC OSVer : 5_1_2600 SP : 3_0 Product : 256_1 error report content: C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\Mini090909-02.dmp C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\sysdata.xml Help! Thanks.

    Read the article

  • Cisco 861 Router forces one-to-one NAT

    - by Slurpee
    I have a cisco 861 router that only allows one-to-one NATs in order to access the Internet. I would like for computers to get an address via DHCP from this router, and be able to access the Internet without needing to set a static NAT to one of my public IPs. What is wrong with the configuration? I have a basic understanding of the IOS CLI, most of the configuration file (edited for content) was created by my company's long gone Senior Network Engineer.

    Read the article

< Previous Page | 527 528 529 530 531 532 533 534 535 536 537 538  | Next Page >