Search Results

Search found 55276 results on 2212 pages for 'eicar test string'.

Page 531/2212 | < Previous Page | 527 528 529 530 531 532 533 534 535 536 537 538  | Next Page >

  • Interfaces on an abstract class

    - by insta
    My coworker and I have different opinions on the relationship between base classes and interfaces. I'm of the belief that a class should not implement an interface unless that class can be used when an implementation of the interface is required. In other words, I like to see code like this: interface IFooWorker { void Work(); } abstract class BaseWorker { ... base class behaviors ... public abstract void Work() { } protected string CleanData(string data) { ... } } class DbWorker : BaseWorker, IFooWorker { public void Work() { Repository.AddCleanData(base.CleanData(UI.GetDirtyData())); } } The DbWorker is what gets the IFooWorker interface, because it is an instantiatable implementation of the interface. It completely fulfills the contract. My coworker prefers the nearly identical: interface IFooWorker { void Work(); } abstract class BaseWorker : IFooWorker { ... base class behaviors ... public abstract void Work() { } protected string CleanData(string data) { ... } } class DbWorker : BaseWorker { public void Work() { Repository.AddCleanData(base.CleanData(UI.GetDirtyData())); } } Where the base class gets the interface, and by virtue of this all inheritors of the base class are of that interface as well. This bugs me but I can't come up with concrete reasons why, outside of "the base class cannot stand on its own as an implementation of the interface". What are the pros & cons of his method vs. mine, and why should one be used over another?

    Read the article

  • Do there exist programming languages where a variable can truly know its own name?

    - by Job
    In PHP and Python one can iterate over the local variables and, if there is only once choice where the value matches, you could say that you know what the variable's name is, but this does not always work. Machine code does not have variable names. C compiles to assembly and does not have any native reflection capabilities, so it would not know it's name. (Edit: per Anton's answer the pre-processor can know the variable's name). Do there exist programming languages where a variable would know it's name? It gets tricky if you do something like b = a and b does not become a copy of a but a reference to the same place. EDIT: Why in the world would you want this? I can think of one example: error checking that can survive automatic refactoring. Consider this C# snippet: private void CheckEnumStr(string paramName, string paramValue) { if (paramName != "pony" && paramName != "horse") { string exceptionMessage = String.Format( "Unexpected value '{0}' of the parameter named '{1}'.", paramValue, paramName); throw new ArgumentException(exceptionMessage); } } ... CheckEnumStr("a", a); // Var 'a' does not know its name - this will not survive naive auto-refactoring There are other libraries provided by Microsoft and others that allow to check for errors (sorry the names have escaped me). I have seen one library which with the help of closures/lambdas can accomplish error checking that can survive refactoring, but it does not feel idiomatic. This would be one reason why I might want a language where a variable knows its name.

    Read the article

  • Why is the remove function not working for hashmaps? [migrated]

    - by John Marston
    I am working on a simple project that obtains data from an input file, gets what it needs and prints it to a file. I am basically getting word frequency so each key is a string and the value is its frequency in the document. The problem however, is that I need to print out these values to a file in descending order of frequency. After making my hashmap, this is the part of my program that sorts it and writes it to a file. //Hashmap I create Map<String, Integer> map = new ConcurrentHashMap<String, Integer>(); //function to sort hashmap while (map.isEmpty() == false){ for (Entry<String, Integer> entry: map.entrySet()){ if (entry.getValue() > valueMax){ max = entry.getKey(); System.out.println("max: " + max); valueMax = entry.getValue(); System.out.println("value: " + valueMax); } } map.remove(max); out.write(max + "\t" + valueMax + "\n"); System.out.println(max + "\t" + valueMax); } When I run this i get: t 9 t 9 t 9 t 9 t 9 .... so it appears the remove function is not working as it keeps getting the same value. I'm thinking i have an issue with a scope rule or I just don't understand hashmaps very well. If anyone knows of a better way to sort a hashmap and print it, I would welcome a suggestion. thanks

    Read the article

  • [LINQ] Master&ndash;Detail Same Record (I)

    - by JTorrecilla
    PROBLEM Firstly, I am working on a project based on LINQ, EF, and C# with VS2010. The following Table shows what I have and what I want to show. Header C1 C2 C3 1 P1 01/01/2011 2 P2 01/02/2011 Details 1 1 D1 2 1 D2 3 1 D3 4 2 D1 5 2 D4 Expected Results 1 P1 01/01/2011 D1, D2, D3 2 P2 01/02/2011 D1,D4   IDEAS At the begin I got 3 possible ways: - Doing inside the DB:  It could be achieved from DB with a CURSOR in a Stored Procedure. - Doing from .NET with LOOPS. - Doing with LINQ (I love it!!) FIRST APROX Example with a simple CLASS with a LIST: With and Employee Class that acts as Header Table: 1: public class Employee 2: { 3: public Employee () { } 4: public Int32 ID { get; set; } 5: public String FirstName{ get; set; } 6: public String LastName{ get; set; } 7: public List<string> Numbers{ get; set; } // Acts as Details Table 8: } We can show all numbers contained by Employee: 1: List<Employee > listado = new List<Employee >(); 2: //Fill Listado 3: var query= from Employee em in listado 4: let Nums= string.Join(";", em.Numbers) 5: select new { 6: em.Name, 7: Nums 8: }; The “LET” operator allows us to host the results of “Join” of the Numbers List of the Employee Class. A little example. ASAP I will post the second part to achieve the same with Entity Framework. Best Regards

    Read the article

  • How to call a WCF service using ksoap2 on android?

    - by Qing
    Hi all, Here is my code import org.ksoap2.*; import org.ksoap2.serialization.*; import org.ksoap2.transport.*; import android.app.Activity; import android.os.Bundle; import android.widget.TextView; public class ksop2test extends Activity { /** Called when the activity is first created. */ private static final String METHOD_NAME = "SayHello"; // private static final String METHOD_NAME = "HelloWorld"; private static final String NAMESPACE = "http://tempuri.org"; // private static final String NAMESPACE = "http://tempuri.org"; private static final String URL = "http://192.168.0.2:8080/HelloWCF/Service1.svc"; // private static final String URL = "http://192.168.0.2:8080/webservice1/Service1.asmx"; final String SOAP_ACTION = "http://tempuri.org/IService1/SayHello"; // final String SOAP_ACTION = "http://tempuri.org/HelloWorld"; TextView tv; StringBuilder sb; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); tv = new TextView(this); sb = new StringBuilder(); call(); tv.setText(sb.toString()); setContentView(tv); } public void call() { try { SoapObject request = new SoapObject(NAMESPACE, METHOD_NAME); request.addProperty("name", "Qing"); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope( SoapEnvelope.VER11); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(URL); androidHttpTransport.call(SOAP_ACTION, envelope); sb.append(envelope.toString() + "\n");//cannot get the xml request send SoapPrimitive result = (SoapPrimitive)envelope.getResponse(); //to get the data String resultData = result.toString(); // 0 is the first object of data sb.append(resultData + "\n"); } catch (Exception e) { sb.append("Error:\n" + e.getMessage() + "\n"); } } } I can successfully access .asmx service, but when I try to call a wcf service the virtual machine said : Error: expected:END_TAG{http://schemas.xmlsoap.org/soap/envelope/}Body(position:END_TAG@1:712 in java.io.InputStreamReader@43ba6798 How to print what the request send? Here is the wcf wsdl: <wsdl:definitions name="Service1" targetNamespace="http://tempuri.org/"> - <wsdl:types> - <xsd:schema targetNamespace="http://tempuri.org/Imports"> <xsd:import schemaLocation="http://para-bj.para.local:8080/HelloWCF/Service1.svc?xsd=xsd0" namespace="http://tempuri.org/"/> <xsd:import schemaLocation="http://para-bj.para.local:8080/HelloWCF/Service1.svc?xsd=xsd1" namespace="http://schemas.microsoft.com/2003/10/Serialization/"/> </xsd:schema> </wsdl:types> - <wsdl:message name="IService1_SayHello_InputMessage"> <wsdl:part name="parameters" element="tns:SayHello"/> </wsdl:message> - <wsdl:message name="IService1_SayHello_OutputMessage"> <wsdl:part name="parameters" element="tns:SayHelloResponse"/> </wsdl:message> - <wsdl:portType name="IService1"> - <wsdl:operation name="SayHello"> <wsdl:input wsaw:Action="http://tempuri.org/IService1/SayHello" message="tns:IService1_SayHello_InputMessage"/> <wsdl:output wsaw:Action="http://tempuri.org/IService1/SayHelloResponse" message="tns:IService1_SayHello_OutputMessage"/> </wsdl:operation> </wsdl:portType> - <wsdl:binding name="BasicHttpBinding_IService1" type="tns:IService1"> <soap:binding transport="http://schemas.xmlsoap.org/soap/http"/> - <wsdl:operation name="SayHello"> <soap:operation soapAction="http://tempuri.org/IService1/SayHello" style="document"/> - <wsdl:input> <soap:body use="literal"/> </wsdl:input> - <wsdl:output> <soap:body use="literal"/> </wsdl:output> </wsdl:operation> </wsdl:binding> - <wsdl:service name="Service1"> - <wsdl:port name="BasicHttpBinding_IService1" binding="tns:BasicHttpBinding_IService1"> <soap:address location="http://para-bj.para.local:8080/HelloWCF/Service1.svc"/> </wsdl:port> </wsdl:service> </wsdl:definitions> It uses in tag and the asmx uses in tag what's the difference? Thanks. -Qing

    Read the article

  • Code Contracts with Interfaces: "Method Invocation skipped. Compiler will generate method invocation

    - by Jörg Battermann
    Good evening, I just started playing with Microsoft.Contracts (latest version) and plugging it on top of a sample interface and right now it looks like this: namespace iRMA2.Core.Interfaces { using System; using System.Collections.Generic; using System.ComponentModel.Composition; using System.Diagnostics.Contracts; /// <summary> /// Base Interface declarations for iRMA2 Extensions /// </summary> [InheritedExport] [ContractClass(typeof(IiRMA2ExtensionContract))] public interface IiRMA2Extension { /// <summary> /// Gets the name. /// </summary> /// <value>The name of the Extension.</value> string Name { get; } /// <summary> /// Gets the description. /// </summary> /// <value>The description.</value> string Description { get; } /// <summary> /// Gets the author of the extension. Please provide complete information to get in touch with author(s) and the corresponding department /// </summary> /// <value>The author of the extensions.</value> string Author { get; } /// <summary> /// Gets the major version. /// </summary> /// <value>The major version of the extension.</value> int MajorVersion { get; } /// <summary> /// Gets the minor version. /// </summary> /// <value>The minor version.</value> int MinorVersion { get; } /// <summary> /// Gets the build number. /// </summary> /// <value>The build number.</value> int BuildNumber { get; } /// <summary> /// Gets the revision. /// </summary> /// <value>The revision.</value> int Revision { get; } /// <summary> /// Gets the depends on. /// </summary> /// <value>The dependencies to other <c>IiRMA2Extension</c> this one has.</value> IList<IiRMA2Extension> DependsOn { get; } } /// <summary> /// Contract class for <c>IiRMA2Extension</c> /// </summary> [ContractClassFor(typeof(IiRMA2Extension))] internal sealed class IiRMA2ExtensionContract : IiRMA2Extension { #region Implementation of IiRMA2Extension /// <summary> /// Gets or sets the name. /// </summary> /// <value>The name of the Extension.</value> public string Name { get { Contract.Ensures(!String.IsNullOrEmpty(Contract.Result<string>())); return default(string); } set { Contract.Requires(value != null); } } /// <summary> /// Gets the description. /// </summary> /// <value>The description.</value> public string Description { get { throw new NotImplementedException(); } } /// <summary> /// Gets the author of the extension. Please provide complete information to get in touch with author(s) and the corresponding department /// </summary> /// <value>The author of the extensions.</value> public string Author { get { throw new NotImplementedException(); } } /// <summary> /// Gets the major version. /// </summary> /// <value>The major version of the extension.</value> public int MajorVersion { get { throw new NotImplementedException(); } } /// <summary> /// Gets the minor version. /// </summary> /// <value>The minor version.</value> public int MinorVersion { get { throw new NotImplementedException(); } } /// <summary> /// Gets the build number. /// </summary> /// <value>The build number.</value> public int BuildNumber { get { throw new NotImplementedException(); } } /// <summary> /// Gets the revision. /// </summary> /// <value>The revision.</value> public int Revision { get { throw new NotImplementedException(); } } /// <summary> /// Gets the Extensions this one depends on. /// </summary> /// <value>The dependencies to other <c>IiRMA2Extension</c> this one has.</value> public IList<IiRMA2Extension> DependsOn { get { Contract.Ensures(Contract.Result<IList<IiRMA2Extension>>() != null); return default(IList<IiRMA2Extension>); } } #endregion } } Now why are the two Contract.Ensures(...) 'blured' out visually with the tooltip saying "Method Invocation skipped. Compiler will generate method invocation because the method is conditional or it is partial method without implementation" and in fact the CodeContracts output does not count/show them... What am I missing & doing wrong here? -J

    Read the article

  • Having trouble binding a ksoap object to an ArrayList in Android

    - by Maskau
    I'm working on an app that calls a web service, then the webservice returns an array list. My problem is I am having trouble getting the data into the ArrayList and then displaying in a ListView. Any ideas what I am doing wrong? I know for a fact the web service returns an ArrayList. Everything seems to be working fine, just no data in the ListView or the ArrayList.....Thanks in advance! EDIT: So I added more code to the catch block of run() and now it's returning "org.ksoap2.serialization.SoapObject".....no more no less....and I am even more confused now... package com.maskau; import java.util.ArrayList; import org.ksoap2.SoapEnvelope; import org.ksoap2.serialization.PropertyInfo; import org.ksoap2.serialization.SoapObject; import org.ksoap2.serialization.SoapSerializationEnvelope; import org.ksoap2.transport.AndroidHttpTransport; import android.app.*; import android.os.*; import android.widget.ArrayAdapter; import android.widget.Button; import android.widget.EditText; import android.widget.ListView; import android.widget.TextView; import android.view.View; import android.view.View.OnClickListener; public class Home extends Activity implements Runnable{ /** Called when the activity is first created. */ public static final String SOAP_ACTION = "http://bb.mcrcog.com/GetArtist"; public static final String METHOD_NAME = "GetArtist"; public static final String NAMESPACE = "http://bb.mcrcog.com"; public static final String URL = "http://bb.mcrcog.com/karaoke/service.asmx"; String wt; public static ProgressDialog pd; TextView text1; ListView lv; static EditText myEditText; static Button but; private ArrayList<String> Artist_Result = new ArrayList<String>(); @Override public void onCreate(Bundle icicle) { super.onCreate(icicle); setContentView(R.layout.main); myEditText = (EditText)findViewById(R.id.myEditText); text1 = (TextView)findViewById(R.id.text1); lv = (ListView)findViewById(R.id.lv); but = (Button)findViewById(R.id.but); but.setOnClickListener(new OnClickListener() { @Override public void onClick(View v) { wt = ("Searching for " + myEditText.getText().toString()); text1.setText(""); pd = ProgressDialog.show(Home.this, "Working...", wt , true, false); Thread thread = new Thread(Home.this); thread.start(); } } ); } public void run() { try { SoapObject request = new SoapObject(NAMESPACE, METHOD_NAME); PropertyInfo pi = new PropertyInfo(); pi.setName("ArtistQuery"); pi.setValue(Home.myEditText.getText().toString()); request.addProperty(pi); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER11); envelope.dotNet = true; envelope.setOutputSoapObject(request); AndroidHttpTransport at = new AndroidHttpTransport(URL); at.call(SOAP_ACTION, envelope); java.util.Vector<Object> rs = (java.util.Vector<Object>)envelope.getResponse(); if (rs != null) { for (Object cs : rs) { Artist_Result.add(cs.toString()); } } } catch (Exception e) { // Added this line, throws "org.ksoap2.serialization.SoapObject" when run Artist_Result.add(e.getMessage()); } handler.sendEmptyMessage(0); } private Handler handler = new Handler() { @Override public void handleMessage(Message msg) { ArrayAdapter<String> aa; aa = new ArrayAdapter<String>(Home.this, android.R.layout.simple_list_item_1, Artist_Result); lv.setAdapter(aa); try { if (Artist_Result.isEmpty()) { text1.setText("No Results"); } else { text1.setText("Complete"); myEditText.setText("Search Artist"); } } catch(Exception e) { text1.setText(e.getMessage()); } aa.notifyDataSetChanged(); pd.dismiss(); } }; }

    Read the article

  • From AutoComplete textbox to database search and display?

    - by svebee
    Hello everyone, I have a small problem so I would be grateful if anyone could help me in any way. Thank you ;) I have this little "application", and I want when someone type in a AutoComplete textbox for example "New" it automatically displays "New York" as a option and that (AutoComplete function) works fine. But I want when user type in full location (or AutoComplete do it for him) - that text (location) input is forwarded to a database search which then searches through database and "collects" all rows with user-typed location. For example if user typed in "New York", database search would find all rows with "New York" in it. When it finds one/more row(s) it would display them below. In images... I have this when user is typing... http://www.imagesforme.com/show.php/1093305_SNAG0000.jpg I have this when user choose a AutoComplete location (h)ttp://www.imagesforme.com/show.php/1093306_SNAG0001.jpg (remove () on the beggining) But I wanna this when user choose a AutoComplete location (h)ttp://www.imagesforme.com/show.php/1093307_CopyofSNAG0001.jpg (remove () on the beggining) Complete Code package com.svebee.prijevoz; import android.app.Activity; import android.database.Cursor; import android.database.sqlite.SQLiteDatabase; import android.os.Bundle; import android.util.Log; import android.widget.ArrayAdapter; import android.widget.AutoCompleteTextView; import android.widget.TextView; public class ZelimDoci extends Activity { TextView lista; static final String[] STANICE = new String[] { "New York", "Chicago", "Dallas", "Los Angeles" }; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.zelimdoci); AutoCompleteTextView textView = (AutoCompleteTextView) findViewById(R.id.autocomplete_country); ArrayAdapter<String> adapter = new ArrayAdapter<String>(this, R.layout.list_item, STANICE); textView.setAdapter(adapter); lista = (TextView)findViewById(R.id.lista); SQLiteDatabase myDB= null; String TableName = "Database"; String Data=""; /* Create a Database. */ try { myDB = this.openOrCreateDatabase("Database", MODE_PRIVATE, null); /* Create a Table in the Database. */ myDB.execSQL("CREATE TABLE IF NOT EXISTS " + TableName + " (Field1 INT(3) UNIQUE, Field2 INT(3) UNIQUE, Field3 VARCHAR UNIQUE, Field4 VARCHAR UNIQUE);"); Cursor a = myDB.rawQuery("SELECT * FROM Database where Field1 == 1", null); a.moveToFirst(); if (a == null) { /* Insert data to a Table*/ myDB.execSQL("INSERT INTO " + TableName + " (Field1, Field2, Field3, Field4)" + " VALUES (1, 119, 'New York', 'Dallas');"); myDB.execSQL("INSERT INTO " + TableName + " (Field1, Field2, Field3, Field4)" + " VALUES (9, 587, 'California', 'New York');"); } myDB.execSQL("INSERT INTO " + TableName + " (Field1, Field2, Field3, Field4)" + " VALUES (87, 57, 'Canada', 'London');"); } /*retrieve data from database */ Cursor c = myDB.rawQuery("SELECT * FROM " + TableName , null); int Column1 = c.getColumnIndex("Field1"); int Column2 = c.getColumnIndex("Field2"); int Column3 = c.getColumnIndex("Field3"); int Column4 = c.getColumnIndex("Field4"); // Check if our result was valid. c.moveToFirst(); if (c != null) { // Loop through all Results do { String LocationA = c.getString(Column3); String LocationB = c.getString(Column4); int Id = c.getInt(Column1); int Linija = c.getInt(Column2); Data =Data +Id+" | "+Linija+" | "+LocationA+"-"+LocationB+"\n"; }while(c.moveToNext()); } lista.setText(String.valueOf(Data)); } catch(Exception e) { Log.e("Error", "Error", e); } finally { if (myDB != null) myDB.close(); } } } .xml file <?xml version="1.0" encoding="utf-8"?> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="vertical" android:layout_width="fill_parent" android:layout_height="fill_parent" > <TextView android:layout_width="fill_parent" android:layout_height="wrap_content" android:textSize="20sp" android:gravity="center_horizontal" android:padding="10sp" android:text="Test AutoComplete"/> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="horizontal" android:layout_width="fill_parent" android:layout_height="wrap_content" android:padding="5dp"> <TextView android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="AutoComplete" /> <AutoCompleteTextView android:id="@+id/autocomplete_country" android:layout_width="fill_parent" android:layout_height="wrap_content" android:layout_marginLeft="5dp"/> </LinearLayout> </LinearLayout>

    Read the article

  • Loading FireMonkey style resourses with RTTI

    - by HeMet
    I am trying to write class that inherits from FMX TStyledControl. When style is updated it loads style resource objects to cache. I created project group for package with custom controls and test FMX HD project as it describes in Delphi help. After installing package and placing TsgSlideHost on the test form I run test app. It’s work well, but when I close it and try to rebuild package RAD Studio says “Error in rtl160.bpl” or “invalid pointer operation”. It seems what problem in LoadToCacheIfNeeded procedure from TsgStyledControl, but I’m not understand why. Is there any restriction on using RTTI with FMX styles or anything? TsgStyledControl sources: unit SlideGUI.TsgStyledControl; interface uses System.SysUtils, System.Classes, System.Types, FMX.Types, FMX.Layouts, FMX.Objects, FMX.Effects, System.UITypes, FMX.Ani, System.Rtti, System.TypInfo; type TCachedAttribute = class(TCustomAttribute) private fStyleName: string; public constructor Create(const aStyleName: string); property StyleName: string read fStyleName; end; TsgStyledControl = class(TStyledControl) private procedure CacheStyleObjects; procedure LoadToCacheIfNeeded(aField: TRttiField); protected function FindStyleResourceAs<T: class>(const AStyleLookup: string): T; function GetStyleName: string; virtual; abstract; function GetStyleObject: TControl; override; public procedure ApplyStyle; override; published { Published declarations } end; implementation { TsgStyledControl } procedure TsgStyledControl.ApplyStyle; begin inherited; CacheStyleObjects; end; procedure TsgStyledControl.CacheStyleObjects; var ctx: TRttiContext; typ: TRttiType; fld: TRttiField; begin ctx := TRttiContext.Create; try typ := ctx.GetType(Self.ClassType); for fld in typ.GetFields do LoadFromCacheIfNeeded(fld); finally ctx.Free end; end; function TsgStyledControl.FindStyleResourceAs<T>(const AStyleLookup: string): T; var fmxObj: TFmxObject; begin fmxObj := FindStyleResource(AStyleLookup); if Assigned(fmxObj) and (fmxObj is T) then Result := fmxObj as T else Result := nil; end; function TsgStyledControl.GetStyleObject: TControl; var S: TResourceStream; begin if (FStyleLookup = '') then begin if FindRCData(HInstance, GetStyleName) then begin S := TResourceStream.Create(HInstance, GetStyleName, RT_RCDATA); try Result := TControl(CreateObjectFromStream(nil, S)); Exit; finally S.Free; end; end; end; Result := inherited GetStyleObject; end; procedure TsgStyledControl.LoadToCacheIfNeeded(aField: TRttiField); var attr: TCustomAttribute; styleName: string; styleObj: TFmxObject; val: TValue; begin for attr in aField.GetAttributes do begin if attr is TCachedAttribute then begin styleName := TCachedAttribute(attr).StyleName; if styleName <> '' then begin styleObj := FindStyleResource(styleName); val := TValue.From<TFmxObject>(styleObj); aField.SetValue(Self, val); end; end; end; end; { TCachedAttribute } constructor TCachedAttribute.Create(const aStyleName: string); begin fStyleName := aStyleName; end; end. Using of TsgStyledControl: type TsgSlideHost = class(TsgStyledControl) private [TCached('SlideHost')] fSlideHost: TLayout; [TCached('SideMenu')] fSideMenuLyt: TLayout; [TCached('SlideContainer')] fSlideContainer: TLayout; fSideMenu: IsgSideMenu; procedure ReapplyProps; procedure SetSideMenu(const Value: IsgSideMenu); protected function GetStyleName: string; override; function GetStyleObject: TControl; override; procedure UpdateSideMenuLyt; public constructor Create(AOwner: TComponent); override; procedure ApplyStyle; override; published property SideMenu: IsgSideMenu read fSideMenu write SetSideMenu; end;

    Read the article

  • EF Code First to SQL Azure

    - by Predrag Pejic
    I am using EF Code First to create a database on local .\SQLEXPRESS. Among others. I have these 2 classes: public class Shop { public int ShopID { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a name!")] [MaxLength(25, ErrorMessage = "Name must be 25 characters or less")] public string Name { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter an address!")] [MaxLength(30, ErrorMessage = "Address must be 30 characters or less")] public string Address { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a valid city name!")] [MaxLength(30, ErrorMessage = "City name must be 30 characters or less")] public string City { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a phone number!")] [MaxLength(14, ErrorMessage = "Phone number must be 14 characters or less")] public string Phone { get; set; } [MaxLength(100, ErrorMessage = "Description must be 50 characters or less")] public string Description { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a WorkTime!")] public DateTime WorkTimeBegin { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a WorkTime!")] public DateTime WorkTimeEnd { get; set; } public DateTime? SaturdayWorkTimeBegin { get; set; } public DateTime? SaturdayWorkTimeEnd { get; set; } public DateTime? SundayWorkTimeBegin { get; set; } public DateTime? SundayWorkTimeEnd { get; set; } public int ShoppingPlaceID { get; set; } public virtual ShoppingPlace ShoppingPlace { get; set; } public virtual ICollection<Category> Categories { get; set; } } public class ShoppingPlace { [Key] public int ShopingplaceID { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a name!")] [MaxLength(25, ErrorMessage = "Name must be 25 characters or less")] public string Name { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter an address!")] [MaxLength(50, ErrorMessage = "Address must be 50 characters or less")] public string Address { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a city name!")] [MaxLength(30, ErrorMessage = "City must be 30 characters or less")] public string City { get; set; } [Required(AllowEmptyStrings = false, ErrorMessage = "You must enter a valid phone number!")] [MaxLength(14, ErrorMessage = "Phone number must be 14 characters or less")] public string Phone { get; set; } public int ShoppingCenterID { get; set; } public virtual ShoppingCenter ShoppingCenter { get; set; } public virtual ICollection<Shop> Shops { get; set; } } and a method in DbContext: modelBuilder.Entity<Item>() .HasRequired(p => p.Category) .WithMany(a => a.Items) .HasForeignKey(a => a.CategoryID) .WillCascadeOnDelete(false); modelBuilder.Entity<Category>() .HasRequired(a => a.Shop) .WithMany(a => a.Categories) .HasForeignKey(a => a.ShopID) .WillCascadeOnDelete(false); modelBuilder.Entity<Shop>() .HasOptional(a => a.ShoppingPlace) .WithMany(a => a.Shops) .HasForeignKey(a => a.ShoppingPlaceID) .WillCascadeOnDelete(false); modelBuilder.Entity<ShoppingPlace>() .HasOptional(a => a.ShoppingCenter) .WithMany(a => a.ShoppingPlaces) .HasForeignKey(a => a.ShoppingCenterID) .WillCascadeOnDelete(false); Why I can't create Shop without creating and populating ShopingPlace. How to achieve that? EDIT: Tried with: modelBuilder.Entity<Shop>() .HasOptional(a => a.ShoppingPlace) .WithOptionalPrincipal(); modelBuilder.Entity<ShoppingPlace>() .HasOptional(a => a.ShoppingCenter) .WithOptionalPrincipal(); and it passed, but what is the difference? And why in SQL Server i am allowed to see ShoppingPlaceID and ShoppingPlace_ShopingPlaceID when in the case of Item and Category i see only one?

    Read the article

  • running multi threads in Java

    - by owca
    My task is to simulate activity of couple of persons. Each of them has few activities to perform in some random time: fast (0-5s), medium(5-10s), slow(10-20s) and very slow(20-30s). Each person performs its task independently in the same time. At the beginning of new task I should print it's random time, start the task and then after time passes show next task's time and start it. I've written run() function that counts time, but now it looks like threads are done one after another and not in the same time or maybe they're just printed in this way. public class People{ public static void main(String[] args){ Task tasksA[]={new Task("washing","fast"), new Task("reading","slow"), new Task("shopping","medium")}; Task tasksM[]={new Task("sleeping zzzzzzzzzz","very slow"), new Task("learning","slow"), new Task(" :** ","slow"), new Task("passing an exam","slow") }; Task tasksJ[]={new Task("listening music","medium"), new Task("doing nothing","slow"), new Task("walking","medium") }; BusyPerson friends[]={ new BusyPerson("Alice",tasksA), new BusyPerson("Mark",tasksM), new BusyPerson("John",tasksJ)}; System.out.println("STARTING....................."); for(BusyPerson f: friends) (new Thread(f)).start(); System.out.println("DONE........................."); } } class Task { private String task; private int time; private Task[]tasks; public Task(String t, String s){ task = t; Speed speed = new Speed(); time = speed.getSpeed(s); } public Task(Task[]tab){ Task[]table=new Task[tab.length]; for(int i=0; i < tab.length; i++){ table[i] = tab[i]; } this.tasks = table; } } class Speed { private static String[]hows = {"fast","medium","slow","very slow"}; private static int[]maxs = {5000, 10000, 20000, 30000}; public Speed(){ } public static int getSpeed( String speedString){ String s = speedString; int up_limit=0; int down_limit=0; int time=0; //get limits of time for(int i=0; i<hows.length; i++){ if(s.equals(hows[i])){ up_limit = maxs[i]; if(i>0){ down_limit = maxs[i-1]; } else{ down_limit = 0; } } } //get random time within the limits Random rand = new Random(); time = rand.nextInt(up_limit) + down_limit; return time; } } class BusyPerson implements Runnable { private String name; private Task[] person_tasks; private BusyPerson[]persons; public BusyPerson(String s, Task[]t){ name = s; person_tasks = t; } public BusyPerson(BusyPerson[]tab){ BusyPerson[]table=new BusyPerson[tab.length]; for(int i=0; i < tab.length; i++){ table[i] = tab[i]; } this.persons = table; } public void run() { int time = 0; double t1=0; for(Task t: person_tasks){ t1 = (double)t.time/1000; System.out.println(name+" is... "+t.task+" "+t.speed+ " ("+t1+" sec)"); while (time == t.time) { try { Thread.sleep(10); } catch(InterruptedException exc) { System.out.println("End of thread."); return; } time = time + 100; } } } } And my output : STARTING..................... DONE......................... Mark is... sleeping zzzzzzzzzz very slow (36.715 sec) Mark is... learning slow (10.117 sec) Mark is... :** slow (29.543 sec) Mark is... passing an exam slow (23.429 sec) Alice is... washing fast (1.209 sec) Alice is... reading slow (23.21 sec) Alice is... shopping medium (11.237 sec) John is... listening music medium (8.263 sec) John is... doing nothing slow (13.576 sec) John is... walking medium (11.322 sec) Whilst it should be like this : STARTING..................... DONE......................... John is... listening music medium (7.05 sec) Alice is... washing fast (3.268 sec) Mark is... sleeping zzzzzzzzzz very slow (23.71 sec) Alice is... reading slow (15.516 sec) John is... doing nothing slow (13.692 sec) Alice is... shopping medium (8.371 sec) Mark is... learning slow (13.904 sec) John is... walking medium (5.172 sec) Mark is... :** slow (12.322 sec) Mark is... passing an exam very slow (27.1 sec)

    Read the article

  • XSLT 1.0 help with recursion logic

    - by DashaLuna
    Hello guys, I'm having troubles with the logic and would apprecite any help/tips. I have <Deposits> elements and <Receipts> elements. However there isn't any identification what receipt was paid toward what deposit. I am trying to update the <Deposits> elements with the following attributes: @DueAmont - the amount that is still due to pay @Status - whether it's paid, outstanding (partly paid) or due @ReceiptDate - the latest receipt's date that was paid towards this deposit Every deposit could be paid with one or more receipts. It also could happen, that 1 receipt could cover one or more deposits. For example. If there are 3 deposits: 500 100 450 That are paid with the following receipts: 200 100 250 I want to get the following info: Deposit 1 is fully paid (status=paid, dueAmount=0, receiptNum=3. Deposit 2 is partly paid (status=outstanding, dueAmount=50, receiptNum=3. Deposit 3 is not paid (status=due, dueAmount=450, receiptNum=NAN. I've added comments in the code explaining what I'm trying to do. I am staring at this code for the 3rd day now non stop - can't see what I'm doing wrong. Please could anyone help me with it? :) Thanks! Set up: $deposits - All the available deposits $receiptsAsc - All the available receipts sorted by their @ActionDate Code: <!-- Accumulate all the deposits with @Status, @DueAmount and @ReceiptDate attributes Provide all deposits, receipts and start with 1st receipt --> <xsl:variable name="depositsClassified"> <xsl:call-template name="classifyDeposits"> <xsl:with-param name="depositsAll" select="$deposits"/> <xsl:with-param name="receiptsAll" select="$receiptsAsc"/> <xsl:with-param name="receiptCount" select="'1'"/> </xsl:call-template> </xsl:variable> <!-- Recursive function to associate deposits' total amounts with overall receipts paid to determine whether a deposit is due, outstanding or paid. Also determine what's the due amount and latest receipt towards the deposit for each deposit --> <xsl:template name="classifyDeposits"> <xsl:param name="depositsAll"/> <xsl:param name="receiptsAll"/> <xsl:param name="receiptCount"/> <!-- If there are deposits to proceed --> <xsl:if test="$depositsAll"> <!-- Get the 1st deposit --> <xsl:variable name="deposit" select="$depositsAll[1]"/> <!-- Calculate the sum of all receipts up to and including currenly considered --> <xsl:variable name="receiptSum"> <xsl:choose> <xsl:when test="$receiptsAll"> <xsl:value-of select="sum($receiptsAll[position() &lt;= $receiptCount]/@ReceiptAmount)"/> </xsl:when> <xsl:otherwise>0</xsl:otherwise> </xsl:choose> </xsl:variable> <!-- Difference between deposit amount and sum of the receipts calculated above --> <xsl:variable name="diff" select="$deposit/@DepositTotalAmount - $receiptSum"/> <xsl:choose> <!-- Deposit isn't paid fully and there are more receipts/payments exist. So consider the same deposit, but take next receipt into calculation as well --> <xsl:when test="($diff &gt; 0) and ($receiptCount &lt; count($receiptsAll))"> <xsl:call-template name="classifyDeposits"> <xsl:with-param name="depositsAll" select="$depositsAll"/> <xsl:with-param name="receiptsAll" select="$receiptsAll"/> <xsl:with-param name="receiptCount" select="$receiptCount + 1"/> </xsl:call-template> </xsl:when> <!-- Deposit is paid or we ran out of receipts --> <xsl:otherwise> <!-- process the deposit. Determine its status and then update corresponding attributes --> <xsl:apply-templates select="$deposit" mode="defineDeposit"> <xsl:with-param name="diff" select="$diff"/> <xsl:with-param name="receiptNum" select="$receiptCount"/> </xsl:apply-templates> <!-- Recursively call the template with the rest of deposits excluding the first. Before hand update the @ReceiptsAmount. For the receipts before current it is now 0, for the current is what left in the $diff, and simply copy over receipts after current one. --> <xsl:variable name="receiptsUpdatedRTF"> <xsl:for-each select="$receiptsAll"> <xsl:choose> <!-- these receipts was fully accounted for the current deposit. Make them 0 --> <xsl:when test="position() &lt; $receiptCount"> <xsl:copy> <xsl:copy-of select="./@*"/> <xsl:attribute name="ReceiptAmount">0</xsl:attribute> </xsl:copy> </xsl:when> <!-- this receipt was partly/fully(in case $diff=0) accounted for the current deposit. Make it whatever is in $diff --> <xsl:when test="position() = $receiptCount"> <xsl:copy> <xsl:copy-of select="./@*"/> <xsl:attribute name="ReceiptAmount"> <xsl:value-of select="format-number($diff, '#.00;#.00')"/> </xsl:attribute> </xsl:copy> </xsl:when> <!-- these receipts weren't yet considered - copy them over --> <xsl:otherwise> <xsl:copy-of select="."/> </xsl:otherwise> </xsl:choose> </xsl:for-each> </xsl:variable> <xsl:variable name="receiptsUpdated" select="msxsl:node-set($receiptsUpdatedRTF)/Receipts"/> <!-- Recursive call for the next deposit. Starting counting receipts from the current one. --> <xsl:call-template name="classifyDeposits"> <xsl:with-param name="depositsAll" select="$deposits[position() != 1]"/> <xsl:with-param name="receiptsAll" select="$receiptsUpdated"/> <xsl:with-param name="receiptCount" select="$receiptCount"/> </xsl:call-template> </xsl:otherwise> </xsl:choose> </xsl:if> </xsl:template> <!-- Determine deposit's status and due amount --> <xsl:template match="MultiDeposits" mode="defineDeposit"> <xsl:param name="diff"/> <xsl:param name="receiptNum"/> <xsl:choose> <xsl:when test="$diff &lt;= 0"> <xsl:apply-templates select="." mode="addAttrs"> <xsl:with-param name="status" select="'paid'"/> <xsl:with-param name="dueAmount" select="'0'"/> <xsl:with-param name="receiptNum" select="$receiptNum"/> </xsl:apply-templates> </xsl:when> <xsl:when test="$diff = ./@DepositTotalAmount"> <xsl:apply-templates select="." mode="addAttrs"> <xsl:with-param name="status" select="'due'"/> <xsl:with-param name="dueAmount" select="$diff"/> </xsl:apply-templates> </xsl:when> <xsl:when test="$diff &lt; ./@DepositTotalAmount"> <xsl:apply-templates select="." mode="addAttrs"> <xsl:with-param name="status" select="'outstanding'"/> <xsl:with-param name="dueAmount" select="$diff"/> <xsl:with-param name="receiptNum" select="$receiptNum"/> </xsl:apply-templates> </xsl:when> <xsl:otherwise/> </xsl:choose> </xsl:template> <!-- Add new attributes (@Status, @DueAmount and @ReceiptDate) to the deposit element --> <xsl:template match="MultiDeposits" mode="addAttrs"> <xsl:param name="status"/> <xsl:param name="dueAmount"/> <xsl:param name="receiptNum" select="''"/> <xsl:copy> <xsl:copy-of select="./@*"/> <xsl:attribute name="Status"><xsl:value-of select="$status"/></xsl:attribute> <xsl:attribute name="DueAmount"><xsl:value-of select="$dueAmount"/></xsl:attribute> <xsl:if test="$receiptNum != ''"> <xsl:attribute name="ReceiptDate"> <xsl:value-of select="$receiptsAsc[position() = $receiptNum]/@ActionDate"/> </xsl:attribute> </xsl:if> <xsl:copy-of select="./*"/> </xsl:copy> </xsl:template>

    Read the article

  • How to include multiple XML files in a single XML file for deserialization by XmlSerializer in .NET

    - by harrydev
    Hi, is it possible to use the XmlSerializer in .NET to load an XML file which includes other XML files? And how? This, in order to share XML state easily in two "parent" XML files, e.g. AB and BC in below. Example: using System; using System.IO; using System.Xml.Serialization; namespace XmlSerializerMultipleFilesTest { [Serializable] public class A { public int Value { get; set; } } [Serializable] public class B { public double Value { get; set; } } [Serializable] public class C { public string Value { get; set; } } [Serializable] public class AB { public A A { get; set; } public B B { get; set; } } [Serializable] public class BC { public B B { get; set; } public C C { get; set; } } class Program { public static void Serialize<T>(T data, string filePath) { using (var writer = new StreamWriter(filePath)) { var xmlSerializer = new XmlSerializer(typeof(T)); xmlSerializer.Serialize(writer, data); } } public static T Deserialize<T>(string filePath) { using (var reader = new StreamReader(filePath)) { var xmlSerializer = new XmlSerializer(typeof(T)); return (T)xmlSerializer.Deserialize(reader); } } static void Main(string[] args) { const string fileNameA = @"A.xml"; const string fileNameB = @"B.xml"; const string fileNameC = @"C.xml"; const string fileNameAB = @"AB.xml"; const string fileNameBC = @"BC.xml"; var a = new A(){ Value = 42 }; var b = new B(){ Value = Math.PI }; var c = new C(){ Value = "Something rotten" }; Serialize(a, fileNameA); Serialize(b, fileNameB); Serialize(c, fileNameC); // How can AB and BC be deserialized from single // files which include two of the A, B or C files. // Using ideally something like: var ab = Deserialize<AB>(fileNameAB); var bc = Deserialize<BC>(fileNameBC); // That is, so that A, B, C xml file // contents are shared across these two } } } Thus, the A, B, C files contain the following: A.xml: <?xml version="1.0" encoding="utf-8"?> <A xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Value>42</Value> </A> B.xml: <?xml version="1.0" encoding="utf-8"?> <B xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Value>3.1415926535897931</Value> </B> C.xml: <?xml version="1.0" encoding="utf-8"?> <C xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Value>Something rotten</Value> </C> And then the "parent" XML files would contain a XML include file of some sort (I have not been able to find anything like this), such as: AB.xml: <?xml version="1.0" encoding="utf-8"?> <AB xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <A include="A.xml"/> <B include="B.xml"/> </AB> BC.xml: <?xml version="1.0" encoding="utf-8"?> <BC xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <B include="B.xml"/> <C include="C.xml"/> </BC> Of course, I guess this can be solved by implementing IXmlSerializer for AB and BC, but I was hoping there was an easier solution or a generic solution with which classes themselves only need the [Serializable] attribute and nothing else. That is, the split into multiple files is XML only and handled by XmlSerializer itself or a custom generic serializer on top of this. I know this should be somewhat possible with app.config (as in http://stackoverflow.com/questions/480538/use-xml-includes-or-config-references-in-app-config-to-include-other-config-files), but I would prefer a solution based on XmlSerializer. Thanks.

    Read the article

  • Convert PDF to Image Batch

    - by tro
    I am working on a solution where I can convert pdf files to images. I am using the following example from codeproject: http://www.codeproject.com/Articles/317700/Convert-a-PDF-into-a-series-of-images-using-Csharp?msg=4134859#xx4134859xx now I tried with the following code to generate from more then 1000 pdf files new images: using Cyotek.GhostScript; using Cyotek.GhostScript.PdfConversion; using System; using System.Collections.Generic; using System.Drawing; using System.IO; using System.Linq; using System.Text; using System.Threading.Tasks; namespace RefClass_PDF2Image { class Program { static void Main(string[] args) { string outputPath = Properties.Settings.Default.outputPath; string pdfPath = Properties.Settings.Default.pdfPath; if (!Directory.Exists(outputPath)) { Console.WriteLine("Der angegebene Pfad " + outputPath + " für den Export wurde nicht gefunden. Bitte ändern Sie den Pfad (outputPath) in der App.Config Datei."); return; } else { Console.WriteLine("Output Pfad: " + outputPath + " gefunden."); } if (!Directory.Exists(pdfPath)) { Console.WriteLine("Der angegebene Pfad " + pdfPath + " zu den PDF Zeichnungen wurde nicht gefunden. Bitte ändern Sie den Pfad (pdfPath) in der App.Config Datei."); return; } else { Console.WriteLine("PDF Pfad: " + pdfPath + " gefunden."); } Pdf2ImageSettings settings = GetPDFSettings(); DateTime start = DateTime.Now; TimeSpan span; Console.WriteLine(""); Console.WriteLine("Extraktion der PDF Zeichnungen wird gestartet: " + start.ToShortTimeString()); Console.WriteLine(""); DirectoryInfo diretoryInfo = new DirectoryInfo(pdfPath); DirectoryInfo[] directories = diretoryInfo.GetDirectories(); Console.WriteLine(""); Console.WriteLine("Es wurden " + directories.Length + " verschiedende Verzeichnisse gefunden."); Console.WriteLine(""); List<string> filenamesPDF = Directory.GetFiles(pdfPath, "*.pdf*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); List<string> filenamesOutput = Directory.GetFiles(outputPath, "*.*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); Console.WriteLine(""); Console.WriteLine("Es wurden " + filenamesPDF.Count + " verschiedende PDF Zeichnungen gefunden."); Console.WriteLine(""); List<string> newFileNames = new List<string>(); int cutLength = pdfPath.Length; for (int i = 0; i < filenamesPDF.Count; i++) { string temp = filenamesPDF[i].Remove(0, cutLength); temp = outputPath + temp; temp = temp.Replace("pdf", "jpg"); newFileNames.Add(temp); } for (int i = 0; i < filenamesPDF.Count; i++) { FileInfo fi = new FileInfo(newFileNames[i]); if (!fi.Exists) { if (!Directory.Exists(fi.DirectoryName)) { Directory.CreateDirectory(fi.DirectoryName); } Bitmap firstPage = new Pdf2Image(filenamesPDF[i], settings).GetImage(); firstPage.Save(newFileNames[i], System.Drawing.Imaging.ImageFormat.Jpeg); firstPage.Dispose(); } //if (i % 20 == 0) //{ // GC.Collect(); // GC.WaitForPendingFinalizers(); //} } Console.ReadLine(); } private static Pdf2ImageSettings GetPDFSettings() { Pdf2ImageSettings settings; settings = new Pdf2ImageSettings(); settings.AntiAliasMode = AntiAliasMode.Medium; settings.Dpi = 150; settings.GridFitMode = GridFitMode.Topological; settings.ImageFormat = ImageFormat.Png24; settings.TrimMode = PdfTrimMode.CropBox; return settings; } } } unfortunately, I always get in the Pdf2Image.cs an out of memory exception. here the code: public Bitmap GetImage(int pageNumber) { Bitmap result; string workFile; //if (pageNumber < 1 || pageNumber > this.PageCount) // throw new ArgumentException("Page number is out of bounds", "pageNumber"); if (pageNumber < 1) throw new ArgumentException("Page number is out of bounds", "pageNumber"); workFile = Path.GetTempFileName(); try { this.ConvertPdfPageToImage(workFile, pageNumber); using (FileStream stream = new FileStream(workFile, FileMode.Open, FileAccess.Read)) { result = new Bitmap(stream); // --->>> here is the out of memory exception stream.Close(); stream.Dispose(); } } finally { File.Delete(workFile); } return result; } how can I fix that to avoid this exception? thanks for any help, tro

    Read the article

  • How to add Category in DotClear blog with HttpWebRequest or MetaWeblog API

    - by Pitming
    I'm trying to create/modify dotclear blogs. For most of the options, i use XmlRpc API (DotClear.MetaWeblog). But didn't find any way to handle categories. So I start to look at the Http packet and try to do "the same as the browser". Here si the method I use to "Http POST" protected HttpStatusCode HttpPost(Uri url_, string data_, bool allowAutoRedirect_) { HttpWebRequest Request; HttpWebResponse Response = null; Stream ResponseStream = null; Request = (System.Net.HttpWebRequest)HttpWebRequest.Create(url_); Request.UserAgent = "Mozilla/5.0 (Windows; U; Windows NT 5.1; fr; rv:1.9.1.5) Gecko/20091102 Firefox/3.5.5 (.NET CLR 3.5.30729)"; Request.Accept = "text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8"; Request.AllowAutoRedirect = allowAutoRedirect_; // Add the network credentials to the request. Request.Credentials = new NetworkCredential(Username, Password); string authInfo = Username + ":" + Password; authInfo = Convert.ToBase64String(Encoding.Default.GetBytes(authInfo)); Request.Headers["Authorization"] = "Basic " + authInfo; Request.Method = "POST"; Request.CookieContainer = Cookies; if(ConnectionCookie!=null) Request.CookieContainer.Add(url_, ConnectionCookie); if (dcAdminCookie != null) Request.CookieContainer.Add(url_, dcAdminCookie); Request.PreAuthenticate = true; ASCIIEncoding encoding = new ASCIIEncoding(); string postData = data_; byte[] data = encoding.GetBytes(postData); //Encoding.UTF8.GetBytes(data_); //encoding.GetBytes(postData); Request.ContentLength = data.Length; Request.ContentType = "application/x-www-form-urlencoded"; Stream newStream = Request.GetRequestStream(); // Send the data. newStream.Write(data, 0, data.Length); newStream.Close(); try { // get the response from the server. Response = (HttpWebResponse)Request.GetResponse(); if (!allowAutoRedirect_) { foreach (Cookie c in Response.Cookies) { if (c.Name == "dcxd") ConnectionCookie = c; if (c.Name == "dc_admin") dcAdminCookie = c; } Cookies.Add(Response.Cookies); } // Get the response stream. ResponseStream = Response.GetResponseStream(); // Pipes the stream to a higher level stream reader with the required encoding format. StreamReader readStream = new StreamReader(ResponseStream, Encoding.UTF8); string result = readStream.ReadToEnd(); if (Request.RequestUri == Response.ResponseUri) { _log.InfoFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } else { _log.WarnFormat("RequestUri:{0}\r\nResponseUri:{1}\r\nstatus code:{2} Status descr:{3}", Request.RequestUri, Response.ResponseUri, Response.StatusCode, Response.StatusDescription); } } catch (WebException wex) { Response = wex.Response as HttpWebResponse; if (Response != null) { _log.ErrorFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } Request.Abort(); } finally { if (Response != null) { // Releases the resources of the response. Response.Close(); } } if(Response !=null) return Response.StatusCode; return HttpStatusCode.Ambiguous; } So the first thing to do is to Authenticate as admin. Here is the code: protected bool HttpAuthenticate() { Uri u = new Uri(this.Url); Uri url = new Uri(string.Format("{0}/admin/auth.php", u.GetLeftPart(UriPartial.Authority))); string data = string.Format("user_id={0}&user_pwd={1}&user_remember=1", Username, Password); var ret = HttpPost(url,data,false); return (ret == HttpStatusCode.OK || ret==HttpStatusCode.Found); } 3.Now that I'm authenticate, i need to get a xd_chek info (that i can find on the page so basically it's a GET on /admin/category.php + Regex("dotclear[.]nonce = '(.*)'")) 4.so I'm authenticate and have the xd_check info. The last thing to do seems to post the next category. But of course it does not work at all... here is the code: string postData = string.Format("cat_title={0}&new_cat_parent={1}&xd_check={2}", category_, 0, xdCheck); HttpPost(url, postData, true); If anyone can help me and explain were is it wrong ? thanks in advance.

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • creating a Menu from SQLite values in Java

    - by shanahobo86
    I am trying to create a ListMenu using data from an SQLite database to define the name of each MenuItem. So in a class called menu.java I have defined the array String classes [] = {}; which should hold each menu item name. In a DBAdapter class I created a function so the user can insert info to a table (This all works fine btw). public long insertContact(String name, String code, String location, String comments, int days, int start, int end, String type) { ContentValues initialValues = new ContentValues(); initialValues.put(KEY_NAME, name); initialValues.put(KEY_CODE, code); initialValues.put(KEY_LOCATION, location); initialValues.put(KEY_COMMENTS, comments); initialValues.put(KEY_DAYS, days); initialValues.put(KEY_START, start); initialValues.put(KEY_END, end); initialValues.put(KEY_TYPE, type); return db.insert(DATABASE_TABLE, null, initialValues); } It would be the Strings inserted into KEY_NAME that I need to populate that String array with. Does anyone know if this is possible? Thanks so much for the help guys. If I implement that function by Sam/Mango the program crashes, am I using it incorrectly or is the error due to the unknown size of the array? DBAdapter db = new DBAdapter(this); String classes [] = db.getClasses(); edit: I should mention that if I manually define the array: String classes [] = {"test1", "test2", "test3", etc}; It works fine. The error is a NullPointerException Here's the logcat (sorry about the formatting). I hadn't initialized with db = helper.getReadableDatabase(); in the getClasses() function but unfortunately it didn't fix the problem. 11-11 22:53:39.117: D/dalvikvm(17856): Late-enabling CheckJNI 11-11 22:53:39.297: D/TextLayoutCache(17856): Using debug level: 0 - Debug Enabled: 0 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libGLES_android.so 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libEGL_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv1_CM_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv2_adreno200.so 11-11 22:53:39.387: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:39.407: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c66d000 size:36593664 offset:32825344 fd:65 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: D/OpenGLRenderer(17856): Enabling debug mode 0 11-11 22:53:39.477: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5ecd3000 size:40361984 offset:36593664 fd:68 11-11 22:53:40.507: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61451000 size:7254016 offset:3485696 fd:71 11-11 22:53:41.077: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:41.077: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c4c000 size:7725056 offset:7254016 fd:74 11-11 22:53:41.097: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x623aa000 size:8196096 offset:7725056 fd:80 11-11 22:53:41.937: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x62b7b000 size:8667136 offset:8196096 fd:83 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61c4c000 size:7725056 offset:7254016 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x623aa000 size:8196096 offset:7725056 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x62b7b000 size:8667136 offset:8196096 11-11 22:53:42.167: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:42.177: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c5d000 size:17084416 offset:13316096 fd:74 11-11 22:53:42.317: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x63853000 size:20852736 offset:17084416 fd:80 11-11 22:53:42.357: D/OpenGLRenderer(17856): Flushing caches (mode 0) 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5c66d000 size:36593664 offset:32825344 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5ecd3000 size:40361984 offset:36593664 11-11 22:53:42.367: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61451000 size:7254016 offset:3485696 11-11 22:53:42.757: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c56d000 size:24621056 offset:20852736 fd:65 11-11 22:53:44.247: D/AndroidRuntime(17856): Shutting down VM 11-11 22:53:44.247: W/dalvikvm(17856): threadid=1: thread exiting with uncaught exception (group=0x40ac3210) 11-11 22:53:44.257: E/AndroidRuntime(17856): FATAL EXCEPTION: main 11-11 22:53:44.257: E/AndroidRuntime(17856): java.lang.RuntimeException: Unable to instantiate activity ComponentInfo{niall.shannon.timetable/niall.shannon.timetable.menu}: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1891) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1992) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.access$600(ActivityThread.java:127) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1158) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Handler.dispatchMessage(Handler.java:99) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Looper.loop(Looper.java:137) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.main(ActivityThread.java:4441) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invokeNative(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invoke(Method.java:511) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:823) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:590) 11-11 22:53:44.257: E/AndroidRuntime(17856): at dalvik.system.NativeStart.main(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): Caused by: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.content.ContextWrapper.openOrCreateDatabase(ContextWrapper.java:221) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.database.sqlite.SQLiteOpenHelper.getWritableDatabase(SQLiteOpenHelper.java:157) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.DBAdapter.getClasses(DBAdapter.java:151) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.menu.<init>(menu.java:15) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstanceImpl(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstance(Class.java:1319) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.Instrumentation.newActivity(Instrumentation.java:1023) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1882) 11-11 22:53:44.257: E/AndroidRuntime(17856): ... 11 more 11-11 22:53:46.527: I/Process(17856): Sending signal. PID: 17856 SIG: 9

    Read the article

  • Android ksoap nested soap objects in request gives error in response

    - by Smalesy
    I'm trying to do the following soap request on Android using KSOAP. It contains a list of nested soap objects. However, I must be doing something wrong as I get an error back. The request I am trying to generate is as follows: <?xml version="1.0" encoding="utf-8"?> <soap12:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://www.w3.org/2003/05/soap-envelope"> <soap12:Body> <SetAttendanceMarks xmlns="http://hostname.net/"> <strSessionToken>string</strSessionToken> <LessonMarks> <Count>int</Count> <LessonMarks> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> </LessonMarks> </LessonMarks> </SetAttendanceMarks> </soap12:Body> </soap12:Envelope> My code is as follows: public boolean setAttendanceMarks(List<Mark> list) throws Exception { boolean result = false; String methodName = "SetAttendanceMarks"; String soapAction = getHost() + "SetAttendanceMarks"; SoapObject lessMarksN = new SoapObject(getHost(), "LessonMarks"); for (Mark m : list) { PropertyInfo smProp =new PropertyInfo(); smProp.setName("LessonMark"); smProp.setValue(m); smProp.setType(Mark.class); lessMarksN.addProperty(smProp); } PropertyInfo cProp =new PropertyInfo(); cProp.setName("Count"); cProp.setValue(list.size()); cProp.setType(Integer.class); SoapObject lessMarks = new SoapObject(getHost(), "LessonMarks"); lessMarks.addProperty(cProp); lessMarks.addSoapObject(lessMarksN); PropertyInfo sProp =new PropertyInfo(); sProp.setName("strSessionToken"); sProp.setValue(mSession); sProp.setType(String.class); SoapObject request = new SoapObject(getHost(), methodName); request.addProperty(sProp); request.addSoapObject(lessMarks); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(getURL()); androidHttpTransport.debug = true; androidHttpTransport.call(soapAction, envelope); String a = androidHttpTransport.requestDump; String b = androidHttpTransport.responseDump; SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; SoapObject res = (SoapObject) resultsRequestSOAP.getProperty(0); String resultStr = res.getPropertyAsString("Result"); if (resultStr.contentEquals("OK")) { result = true; } return result; } The error I get is as follows: <?xml version="1.0" encoding="utf-8"?><soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <soap:Body> <soap:Fault> <soap:Code> <soap:Value>soap:Sender</soap:Value> </soap:Code> <soap:Reason> <soap:Text xml:lang="en">Server was unable to read request. ---&gt; There is an error in XML document (1, 383). ---&gt; The specified type was not recognized: name='LessonMarks', namespace='http://gsdregapp.net/', at &lt;LessonMarks xmlns='http://gsdregapp.net/'&gt;.</soap:Text> </soap:Reason> <soap:Detail /> </soap:Fault> </soap:Body> </soap:Envelope> Can anybody tell me what I am doing wrong? I will be most grateful for any assistance!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • pass an ID with hyperlik but cant get this ID value from a fk in one table when i click in insert

    - by susan
    Something strange happened in my codes, actually I have a hyperlink that pass ID value in a query string to second page.in second page i have 2 sql datasource that both these sql datasources should get this id value and pass it to a filter parameter to show sth in datalist. so in another word I have a first page that has an hyperlink read ID value from a datasource and pass it to second page.its like below: <asp:HyperLink ID="HyperLink1" runat="server" NavigateUrl='<%# "~/forumpage.aspx?ID="+Eval("ID")%>'><%#Eval("title")%> </asp:HyperLink> then in second page i have one sql datasource with a query like this ...where ID=@id and get this id in query string from db.it work great . but i have problem with second sql datasource in second page it has a query sth like below:...forms.question_id=@id then in sql reference both to query string as ID that get by first page in hyperlink. but when i click in insert button show me error with fk. error:Error:The INSERT statement conflicted with the FOREIGN KEY constraint "FK_forumreply_forumquestions". The conflict occurred in database "forum", table "dbo.forumquestions", column 'ID'. The statement has been terminated. my tables (question(ID,user_id(fk),Cat_id(fk),title,bodytext) (reply(ID,userr_id(fk),questionn_id(fk),titlereply,bodytestreply); When by hand in cb i gave a number in questionn_id like 1 it show me successful but when it want read from a filter by datasource this field face with problem. plzzzz help i really need skip from this part.and cause i am new i guess I cant understand the logic way clearly. <asp:SqlDataSource ID="sdsreply" runat="server" ConnectionString="<%$ ConnectionStrings:forumConnectionString %>" SelectCommand="SELECT forumreply.ID, forumreply.userr_id, forumreply.questionn_id, forumreply.bodytextreply, forumreply.datetimereply, forumquestions.ID AS Expr1, forumusers.ID AS Expr2, forumusers.username FROM forumquestions INNER JOIN forumreply ON forumquestions.ID = forumreply.questionn_id INNER JOIN forumusers ON forumquestions.user_id = forumusers.ID AND forumreply.userr_id = forumusers.ID where forumreply.questionn_id=@questionn_id"> <SelectParameters> <asp:QueryStringParameter Name="questionn_id" QueryStringField="ID" /> </SelectParameters> </asp:SqlDataSource> it is cb for second page in insert button: { if (Session["userid"] != null) { lblreply.Text = Session["userid"].ToString(); } else { Session["userid"]=null; } if (HttpContext.Current.User.Identity.IsAuthenticated) { lblshow.Text = string.Empty; string d = HttpContext.Current.User.Identity.Name; lblshow.Text =d + "???? ??? ?????." ; foreach (DataListItem item in DataList2.Items) { Label questionn_idLabel = (Label)item.FindControl("questionn_idLabel"); Label userr_idLabel = (Label)item.FindControl("userr_idLabel"); lbltest.Text = string.Empty; lbltest.Text = questionn_idLabel.Text; lblreply.Text = string.Empty; lblreply.Text = userr_idLabel.Text; } } else { lblshow.Text = "??? ??? ??? ??? ?? ?? ?????? ???? ???? ???? ????? ??? ??? ? ??? ????? ???????."; } } { if(HttpContext.Current.User.Identity.IsAuthenticated) { if (Page.IsValid) { SqlConnection con = new SqlConnection(ConfigurationManager.ConnectionStrings["forumConnectionString"].ConnectionString); try { con.Open(); SqlCommand cmd = new SqlCommand("insert into forumreply (userr_id,questionn_id,bodytextreply,datetimereply)values(@userr_id,@questionn_id,@bodytextreply,@datetimereply)", con); cmd.Parameters.AddWithValue("userr_id",lblreply.Text); cmd.Parameters.AddWithValue("questionn_id",lbltest.Text); cmd.Parameters.AddWithValue("bodytextreply",txtbody.Text); cmd.Parameters.AddWithValue("datetimereply",DateTime.Now ); cmd.ExecuteNonQuery(); } catch (Exception exp) { Response.Write("<b>Error:</b>"); Response.Write(exp.Message); } finally { con.Close(); } lblmsg.Text = "???? ??? ?? ?????? ??? ?????.thx"; lblshow.Visible = false; //lbltxt.Text = txtbody.Text; txtbody.Text = string.Empty; } } else { lblmsg.Text = string.Empty; Session["rem"] = Request.UrlReferrer.AbsoluteUri; Response.Redirect("~/login.aspx"); } }

    Read the article

  • Multi-module maven build : different result from parent and from module

    - by Albaku
    I am migrating an application from ant build to maven 3 build. This app is composed by : A parent project specifying all the modules to build A project generating classes with jaxb and building a jar with them A project building an ejb project 3 projects building war modules 1 project building an ear Here is an extract from my parent pom : <groupId>com.test</groupId> <artifactId>P</artifactId> <packaging>pom</packaging> <version>04.01.00</version> <modules> <module>../PValidationJaxb</module> <-- jar <module>../PValidation</module> <-- ejb <module>../PImport</module> <-- war <module>../PTerminal</module> <-- war <module>../PWebService</module> <-- war <module>../PEAR</module> <-- ear </modules> I have several problems which I think have the same origin, probably a dependency management issue that I cannot figure out : The generated modules are different depending on if I build from the parent pom or a single module. Typically if I build PImport only, the generated war is similar to what I had with my ant build and if I build from the parent pom, my war took 20MB, a lot of dependencies from other modules had been added. Both wars are running well. My project PWebService has unit tests to be executed during the build. It is using mock-ejb which has cglib as dependency. Having a problem of ClassNotFound with this one, I had to exclude it and add a dependency to cglib-nodep (see last pom extract). If I then build only this module, it is working well. But if I build from the parent project, it fails because other dependencies in other modules also had an implicit dependency on cglib. I had to exclude it in every modules pom and add the dependency to cglib-nodep everywhere to make it run. Do I miss something important in my configuration ? The PValidation pom extract : It is creating a jar containing an ejb with interfaces generated by xdoclet, as well as a client jar. <parent> <groupId>com.test</groupId> <artifactId>P</artifactId> <version>04.01.00</version> </parent> <artifactId>P-validation</artifactId> <packaging>ejb</packaging> <dependencies> <dependency> <groupId>com.test</groupId> <artifactId>P-jaxb</artifactId> <version>${project.version}</version> </dependency> <dependency> <groupId>org.hibernate</groupId> <artifactId>hibernate</artifactId> <version>3.2.5.ga</version> <exclusions> <exclusion> <groupId>cglib</groupId> <artifactId>cglib</artifactId> </exclusion> </exclusions> </dependency> <dependency> <groupId>cglib</groupId> <artifactId>cglib-nodep</artifactId> <version>2.2.2</version> </dependency> ... [other libs] ... </dependencies> <build> ... <plugins> <plugin> <groupId>org.apache.maven.plugins</groupId> <artifactId>maven-ejb-plugin</artifactId> <configuration> <ejbVersion>2.0</ejbVersion> <generateClient>true</generateClient> </configuration> </plugin> <plugin> <groupId>org.codehaus.mojo</groupId> <artifactId>xdoclet-maven-plugin</artifactId> ... The PImport pom extract : It depends on both Jaxb generated jar and the ejb client jar. <parent> <groupId>com.test</groupId> <artifactId>P</artifactId> <version>04.01.00</version> </parent> <artifactId>P-import</artifactId> <packaging>war</packaging> <dependencies> <dependency> <groupId>com.test</groupId> <artifactId>P-jaxb</artifactId> <version>${project.version}</version> </dependency> <dependency> <groupId>com.test</groupId> <artifactId>P-validation</artifactId> <version>${project.version}</version> <type>ejb-client</type> </dependency> ... [other libs] ... </dependencies> The PWebService pom extract : <parent> <groupId>com.test</groupId> <artifactId>P</artifactId> <version>04.01.00</version> </parent> <artifactId>P-webservice</artifactId> <packaging>war</packaging> <properties> <jersey.version>1.14</jersey.version> </properties> <dependencies> <dependency> <groupId>com.sun.jersey</groupId> <artifactId>jersey-servlet</artifactId> <version>${jersey.version}</version> </dependency> <dependency> <groupId>com.rte.etso</groupId> <artifactId>etso-validation</artifactId> <version>${project.version}</version> <type>ejb-client</type> </dependency> ... [other libs] ... <dependency> <groupId>org.mockejb</groupId> <artifactId>mockejb</artifactId> <version>0.6-beta2</version> <scope>test</scope> <exclusions> <exclusion> <groupId>cglib</groupId> <artifactId>cglib-full</artifactId> </exclusion> </exclusions> </dependency> <dependency> <groupId>cglib</groupId> <artifactId>cglib-nodep</artifactId> <version>2.2.2</version> <scope>test</scope> </dependency> </dependencies> Many thanks

    Read the article

  • Auto not being recognised by the compiler, what would be the best replacement?

    - by user1719605
    So I have wrote a program that uses auto however the compiler doesn't seem to recognize it, probably it is an earlier compiler. I was wondering for my code, with are suitable variables to fix my code so that I do not need to use the auto keyword? I'm thinking a pointer to a string? or a string iterator, though I am not sure. #include <cstdlib> #include <string> #include <iostream> #include <unistd.h> #include <algorithm> using namespace std; int main(int argc, char* argv[]) { enum MODE { WHOLE, PREFIX, SUFFIX, ANYWHERE, EMBEDDED } mode = WHOLE; bool reverse_match = false; int c; while ((c = getopt(argc, argv, ":wpsaev")) != -1) { switch (c) { case 'w': // pattern matches whole word mode = WHOLE; break; case 'p': // pattern matches prefix mode = PREFIX; break; case 'a': // pattern matches anywhere mode = ANYWHERE; break; case 's': // pattern matches suffix mode = SUFFIX; break; case 'e': // pattern matches anywhere mode = EMBEDDED; break; case 'v': // reverse sense of match reverse_match = true; break; } } argc -= optind; argv += optind; string pattern = argv[0]; string word; int matches = 0; while (cin >> word) { switch (mode) { case WHOLE: if (reverse_match) { if (pattern != word) { matches += 1; cout << word << endl; } } else if (pattern == word) { matches += 1; cout << word << endl; } break; case PREFIX: if (pattern.size() <= word.size()) { auto res = mismatch(pattern.begin(), pattern.end(), word.begin()); if (reverse_match) { if (res.first != word.end()) { matches += 1; cout << word << endl; } } else if (res.first == word.end()) { matches += 1; cout << word << endl; } } break; case ANYWHERE: if (reverse_match) { if (!word.find(pattern) != string::npos) { matches += 1; cout << word << endl; } } else if (word.find(pattern) != string::npos) { matches += 1; cout << word << endl; } break; case SUFFIX: if (pattern.size() <= word.size()) { auto res = mismatch(pattern.rbegin(), pattern.rend(), word.rbegin()); if (reverse_match) { if (res.first != word.rend()) { matches = +1; cout << word << endl; } } else if (res.first == word.rend()) { matches = +1; cout << word << endl; } } break; case EMBEDDED: if (reverse_match) { if (!pattern.find(word) != string::npos) { matches += 1; cout << word << endl;} } else if (pattern.find(word) != string::npos) { matches += 1; cout << word << endl; } break; } } return (matches == 0) ? 1 : 0; } Thanks in advance!

    Read the article

  • Our Look at the Internet Explorer 9 Platform Preview

    - by Asian Angel
    Have you been hearing all about Microsoft’s work on Internet Explorer 9 and are curious about it? If you are wanting a taste of the upcoming release then join us as we take a look at the Internet Explorer 9 Platform Preview. Note: Windows Vista and Server 2008 users may need to install a Platform Update (see link at bottom for more information). Getting Started If you are curious about the systems that the platform preview will operate on here is an excerpt from the FAQ page (link provided below). There are two important points of interest here: The platform preview does not replace your regular Internet Explorer installation The platform preview (and the final version of Internet Explorer 9) will not work on Windows XP There really is not a lot to the install process…basically all that you will have to deal with is the “EULA Window” and the “Install Finished Window”. Note: The platform preview will install to a “Program Files Folder” named “Internet Explorer Platform Preview”. Internet Explorer 9 Platform Preview in Action When you start the platform preview up for the first time you will be presented with the Internet Explorer 9 Test Drive homepage. Do not be surprised that there is not a lot to the UI at this time…but you can get a good idea of how Internet Explorer will act. Note: You will not be able to alter the “Homepage” for the platform preview. Of the four menus available there are two that will be of interest to most people…the “Page & Debug Menus”. If you go to navigate to a new webpage you will need to go through the “Page Menu” unless you have installed the Address Bar Mini-Tool (shown below). Want to see what a webpage will look like in an older version of Internet Explorer? Then choose your version in the “Debug Menu”. We did find it humorous that IE6 was excluded from the choices offered. Here is what the URL entry window looks like if you are using the “Page Menu” to navigate between websites. Here is the main page of the site here displayed in “IE9 Mode”…looking good. Here is the main page viewed in “Forced IE5 Document Mode”. There were some minor differences (colors, sidebar, etc.) in how the main page displayed in comparison to “IE9 Mode”. Being able to switch between modes makes for an interesting experience… As you can see there is not much to the “Context Menu” at the moment. Notice the slightly altered icon for the platform preview… “Add” an Address Bar of Sorts If you would like to use a “make-shift” Address Bar with the platform preview you can set up the portable file (IE9browser.exe) for the Internet Explorer 9 Test Platform Addressbar Mini-Tool. Just place it in an appropriate folder, create a shortcut for it, and it will be ready to go. Here is a close look at the left side of the Address Bar Mini-Tool. You can try to access “IE Favorites” but may have sporadic results like those we experienced during our tests. Note: The Address Bar Mini-Tool will not line up perfectly with the platform preview but still makes a nice addition. And a close look at the right side of the Address Bar Mini-Tool. In order to completely shut down the Address Bar Mini-Tool you will need to click on “Close”. Each time that you enter an address into the Address Bar Mini-Tool it will open a new window/instance of the platform preview. Note: During our tests we noticed that clicking on “Home” in the “Page Menu” opened the previously viewed website but once we closed and restarted the platform preview the test drive website was the starting/home page again. Even if the platform preview is not running the Address Bar Mini-Tool can still run as shown here. Note: You will not be able to move the Address Bar Mini-Tool from its’ locked-in position at the top of the screen. Now for some fun. With just the Address Bar Mini-Tool open you can enter an address and cause the platform preview to open. Here is our example from above now open in the platform preview…good to go. Conclusion During our tests we did experience the occasional crash but overall we were pleased with the platform preview’s performance. The platform preview handled rather well and definitely seemed much quicker than Internet Explorer 8 on our test system (a definite bonus!). If you are an early adopter then this could certainly get you in the mood for the upcoming beta releases! Links Download the Internet Explorer 9 Preview Platform Download the Internet Explorer 9 Test Platform Addressbar Mini-Tool Information about Platform Update for Windows Vista & Server 2008 View the Internet Explorer 9 Platform Preview FAQ Similar Articles Productive Geek Tips Mysticgeek Blog: A Look at Internet Explorer 8 Beta 1 on Windows XPMake Ctrl+Tab in Internet Explorer 7 Use Most Recent OrderRemove ISP Text or Corporate Branding from Internet Explorer Title BarWhy Can’t I Turn the Details/Preview Panes On or Off in Windows Vista Explorer?Prevent Firefox or Internet Explorer from Printing the URL on Every Page TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips DVDFab 6 Revo Uninstaller Pro Registry Mechanic 9 for Windows PC Tools Internet Security Suite 2010 Awesome Lyrics Finder for Winamp & Windows Media Player Download Videos from Hulu Pixels invade Manhattan Convert PDF files to ePub to read on your iPad Hide Your Confidential Files Inside Images Get Wildlife Photography Tips at BBC’s PhotoMasterClasses

    Read the article

  • JMS Step 7 - How to Write to an AQ JMS (Advanced Queueing JMS) Queue from a BPEL Process

    - by John-Brown.Evans
    JMS Step 7 - How to Write to an AQ JMS (Advanced Queueing JMS) Queue from a BPEL Process ol{margin:0;padding:0} .jblist{list-style-type:disc;margin:0;padding:0;padding-left:0pt;margin-left:36pt} .c4_7{vertical-align:top;width:468pt;border-style:solid;border-color:#000000;border-width:1pt;padding:5pt 5pt 5pt 5pt} .c3_7{vertical-align:top;width:234pt;border-style:solid;border-color:#000000;border-width:1pt;padding:0pt 5pt 0pt 5pt} .c6_7{vertical-align:top;width:156pt;border-style:solid;border-color:#000000;border-width:1pt;padding:5pt 5pt 5pt 5pt} .c16_7{background-color:#ffffff;padding:0pt 0pt 0pt 0pt} .c0_7{height:11pt;direction:ltr} .c9_7{color:#1155cc;text-decoration:underline} .c17_7{color:inherit;text-decoration:inherit} .c5_7{direction:ltr} .c18_7{background-color:#ffff00} .c2_7{background-color:#f3f3f3} .c14_7{height:0pt} .c8_7{text-indent:36pt} .c11_7{text-align:center} .c7_7{font-style:italic} .c1_7{font-family:"Courier New"} .c13_7{line-height:1.0} .c15_7{border-collapse:collapse} .c12_7{font-weight:bold} .c10_7{font-size:8pt} .title{padding-top:24pt;line-height:1.15;text-align:left;color:#000000;font-size:36pt;font-family:"Arial";font-weight:bold;padding-bottom:6pt} .subtitle{padding-top:18pt;line-height:1.15;text-align:left;color:#666666;font-style:italic;font-size:24pt;font-family:"Georgia";padding-bottom:4pt} li{color:#000000;font-size:10pt;font-family:"Arial"} p{color:#000000;font-size:10pt;margin:0;font-family:"Arial"} h1{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:24pt;font-family:"Arial";font-weight:normal} h2{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:18pt;font-family:"Arial";font-weight:normal} h3{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:14pt;font-family:"Arial";font-weight:normal} h4{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:12pt;font-family:"Arial";font-weight:normal} h5{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:11pt;font-family:"Arial";font-weight:normal} h6{padding-top:0pt;line-height:1.15;text-align:left;color:#888;font-size:10pt;font-family:"Arial";font-weight:normal} This post continues the series of JMS articles which demonstrate how to use JMS queues in a SOA context. The previous posts were: JMS Step 1 - How to Create a Simple JMS Queue in Weblogic Server 11g JMS Step 2 - Using the QueueSend.java Sample Program to Send a Message to a JMS Queue JMS Step 3 - Using the QueueReceive.java Sample Program to Read a Message from a JMS Queue JMS Step 4 - How to Create an 11g BPEL Process Which Writes a Message Based on an XML Schema to a JMS Queue JMS Step 5 - How to Create an 11g BPEL Process Which Reads a Message Based on an XML Schema from a JMS Queue JMS Step 6 - How to Set Up an AQ JMS (Advanced Queueing JMS) for SOA Purposes This example demonstrates how to write a simple message to an Oracle AQ via the the WebLogic AQ JMS functionality from a BPEL process and a JMS adapter. If you have not yet reviewed the previous posts, please do so first, especially the JMS Step 6 post, as this one references objects created there. 1. Recap and Prerequisites In the previous example, we created an Oracle Advanced Queue (AQ) and some related JMS objects in WebLogic Server to be able to access it via JMS. Here are the objects which were created and their names and JNDI names: Database Objects Name Type AQJMSUSER Database User MyQueueTable Advanced Queue (AQ) Table UserQueue Advanced Queue WebLogic Server Objects Object Name Type JNDI Name aqjmsuserDataSource Data Source jdbc/aqjmsuserDataSource AqJmsModule JMS System Module AqJmsForeignServer JMS Foreign Server AqJmsForeignServerConnectionFactory JMS Foreign Server Connection Factory AqJmsForeignServerConnectionFactory AqJmsForeignDestination AQ JMS Foreign Destination queue/USERQUEUE eis/aqjms/UserQueue Connection Pool eis/aqjms/UserQueue 2 . Create a BPEL Composite with a JMS Adapter Partner Link This step requires that you have a valid Application Server Connection defined in JDeveloper, pointing to the application server on which you created the JMS Queue and Connection Factory. You can create this connection in JDeveloper under the Application Server Navigator. Give it any name and be sure to test the connection before completing it. This sample will write a simple XML message to the AQ JMS queue via the JMS adapter, based on the following XSD file, which consists of a single string element: stringPayload.xsd <?xml version="1.0" encoding="windows-1252" ?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema"                xmlns="http://www.example.org"                targetNamespace="http://www.example.org"                elementFormDefault="qualified">  <xsd:element name="exampleElement" type="xsd:string">  </xsd:element> </xsd:schema> The following steps are all executed in JDeveloper. The SOA project will be created inside a JDeveloper Application. If you do not already have an application to contain the project, you can create a new one via File > New > General > Generic Application. Give the application any name, for example JMSTests and, when prompted for a project name and type, call the project   JmsAdapterWriteAqJms  and select SOA as the project technology type. If you already have an application, continue below. Create a SOA Project Create a new project and select SOA Tier > SOA Project as its type. Name it JmsAdapterWriteAqJms . When prompted for the composite type, choose Composite With BPEL Process. When prompted for the BPEL Process, name it JmsAdapterWriteAqJms too and choose Synchronous BPEL Process as the template. This will create a composite with a BPEL process and an exposed SOAP service. Double-click the BPEL process to open and begin editing it. You should see a simple BPEL process with a Receive and Reply activity. As we created a default process without an XML schema, the input and output variables are simple strings. Create an XSD File An XSD file is required later to define the message format to be passed to the JMS adapter. In this step, we create a simple XSD file, containing a string variable and add it to the project. First select the xsd item in the left-hand navigation tree to ensure that the XSD file is created under that item. Select File > New > General > XML and choose XML Schema. Call it stringPayload.xsd  and when the editor opens, select the Source view. then replace the contents with the contents of the stringPayload.xsd example above and save the file. You should see it under the XSD item in the navigation tree. Create a JMS Adapter Partner Link We will create the JMS adapter as a service at the composite level. If it is not already open, double-click the composite.xml file in the navigator to open it. From the Component Palette, drag a JMS adapter over onto the right-hand swim lane, under External References. This will start the JMS Adapter Configuration Wizard. Use the following entries: Service Name: JmsAdapterWrite Oracle Enterprise Messaging Service (OEMS): Oracle Advanced Queueing AppServer Connection: Use an existing application server connection pointing to the WebLogic server on which the connection factory created earlier is located. You can use the “+” button to create a connection directly from the wizard, if you do not already have one. Adapter Interface > Interface: Define from operation and schema (specified later) Operation Type: Produce Message Operation Name: Produce_message Produce Operation Parameters Destination Name: Wait for the list to populate. (Only foreign servers are listed here, because Oracle Advanced Queuing was selected earlier, in step 3) .         Select the foreign server destination created earlier, AqJmsForeignDestination (queue) . This will automatically populate the Destination Name field with the name of the foreign destination, queue/USERQUEUE . JNDI Name: The JNDI name to use for the JMS connection. This is the JNDI name of the connection pool created in the WebLogic Server.JDeveloper does not verify the value entered here. If you enter a wrong value, the JMS adapter won’t find the queue and you will get an error message at runtime. In our example, this is the value eis/aqjms/UserQueue Messages URL: We will use the XSD file we created earlier, stringPayload.xsd to define the message format for the JMS adapter. Press the magnifying glass icon to search for schema files. Expand Project Schema Files > stringPayload.xsd and select exampleElement : string . Press Next and Finish, which will complete the JMS Adapter configuration. Wire the BPEL Component to the JMS Adapter In this step, we link the BPEL process/component to the JMS adapter. From the composite.xml editor, drag the right-arrow icon from the BPEL process to the JMS adapter’s in-arrow.   This completes the steps at the composite level. 3. Complete the BPEL Process Design Invoke the JMS Adapter Open the BPEL component by double-clicking it in the design view of the composite.xml. This will display the BPEL process in the design view. You should see the JmsAdapterWrite partner link under one of the two swim lanes. We want it in the right-hand swim lane. If JDeveloper displays it in the left-hand lane, right-click it and choose Display > Move To Opposite Swim Lane. An Invoke activity is required in order to invoke the JMS adapter. Drag an Invoke activity between the Receive and Reply activities. Drag the right-hand arrow from the Invoke activity to the JMS adapter partner link. This will open the Invoke editor. The correct default values are entered automatically and are fine for our purposes. We only need to define the input variable to use for the JMS adapter. By pressing the green “+” symbol, a variable of the correct type can be auto-generated, for example with the name Invoke1_Produce_Message_InputVariable. Press OK after creating the variable. Assign Variables Drag an Assign activity between the Receive and Invoke activities. We will simply copy the input variable to the JMS adapter and, for completion, so the process has an output to print, again to the process’s output variable. Double-click the Assign activity and create two Copy rules: for the first, drag Variables > inputVariable > payload > client:process > client:input_string to Invoke1_Produce_Message_InputVariable > body > ns2:exampleElement for the second, drag the same input variable to outputVariable > payload > client:processResponse > client:result This will create two copy rules, similar to the following: Press OK. This completes the BPEL and Composite design. 4. Compile and Deploy the Composite Compile the process by pressing the Make or Rebuild icons or by right-clicking the project name in the navigator and selecting Make... or Rebuild... If the compilation is successful, deploy it to the SOA server connection defined earlier. (Right-click the project name in the navigator, select Deploy to Application Server, choose the application server connection, choose the partition on the server (usually default) and press Finish. You should see the message ----  Deployment finished.  ---- in the Deployment frame, if the deployment was successful. 5. Test the Composite Execute a Test Instance In a browser, log in to the Enterprise Manager 11g Fusion Middleware Control (EM) for your SOA installation. Navigate to SOA > soa-infra (soa_server1) > default (or wherever you deployed your composite) and click on  JmsAdapterWriteAqJms [1.0] , then press the Test button. Enter any string into the text input field, for example “Test message from JmsAdapterWriteAqJms” then press Test Web Service. If the instance is successful, you should see the same text you entered in the Response payload frame. Monitor the Advanced Queue The test message will be written to the advanced queue created at the top of this sample. To confirm it, log in to the database as AQJMSUSER and query the MYQUEUETABLE database table. For example, from a shell window with SQL*Plus sqlplus aqjmsuser/aqjmsuser SQL> SELECT user_data FROM myqueuetable; which will display the message contents, for example Similarly, you can use the JDeveloper Database Navigator to view the contents. Use a database connection to the AQJMSUSER and in the navigator, expand Queues Tables and select MYQUEUETABLE. Select the Data tab and scroll to the USER_DATA column to view its contents. This concludes this example. The following post will be the last one in this series. In it, we will learn how to read the message we just wrote using a BPEL process and AQ JMS. Best regards John-Brown Evans Oracle Technology Proactive Support Delivery

    Read the article

  • Using the new CSS Analyzer in JavaFX Scene Builder

    - by Jerome Cambon
    As you know, JavaFX provides from the API many properties that you can set to customize or make your components to behave as you want. For instance, for a Button, you can set its font, or its max size.Using Scene Builder, these properties can be explored and modified using the inspector. However, JavaFX also provides many other properties to have a fine grained customization of your components : the css properties. These properties are typically set from a css stylesheet. For instance, you can set a background image on a Button, change the Button corners, etc... Using Scene Builder, until now, you could set a css property using the inspector Style and Stylesheet editors. But you had to go to the JavaFX css documentation to know the css properties that can be applied to a given component. Hopefully, Scene Builder 1.1 added recently a very interesting new feature : the CSS Analyzer.It allows you to explore all the css properties available for a JavaFX component, and helps you to build your css rules. A very simple example : make a Button rounded Let’s take a very simple example:you would like to customize your Buttons to make them rounded. First, enable the CSS Analyzer, using the ‘View->Show CSS Analyzer’ menu. Grow the main window, and the CSS Analyzer to get more room: Then, drop a Button from the Library to the ContentView: the CSS Analyzer is now showing the Button css properties: As you can see, there is a ‘-fx-background-radius’ css property that allow to define the radius of the background (note that you can get the associated css documentation by clicking on the property name). You can then experiment this by setting the Button style property from the inspector: As you can see in the css doc, one can set the same radius for the 4 corners by a simple number. Once the style value is applied, the Button is now rounded, as expected.Look at the CSS Analyzer: the ‘-fx-background-radius’ property has now 2 entries: the default one, and the one we just entered from the Style property. The new value “win”: it overrides the default one, and become the actual value (to highlight this, the cell background becomes blue). Now, you will certainly prefer to apply this new style to all the Buttons of your FXML document, and have a css rule for this.To do this, save you document first, and create a css file in the same directory than the new document.Create an empty css file (e.g. test.css), and attach it the the root AnchorPane, by first selecting the AnchorPane, then using the Stylesheets editor from the inspector: Add the corresponding css rule to your new test.css file, from your preferred editor (Netbeans for me ;-) and save it. .button { -fx-background-radius: 10px;} Now, select your Button and have a look at the CSS Analyzer. As you can see, the Button is inheriting the css rule (since the Button is a child of the AnchorPane), and still have its inline Style. The Inline style “win”, since it has precedence on the stylesheet. The CSS Analyzer columns are displayed by precedence order.Note the small right-arrow icons, that allow to jump to the source of the value (either test.css, or the inspector in this case).Of course, unless you want to set a specific background radius for this particular Button, you can remove the inline Style from the inspector. Changing the color of a TitledPane arrow In some cases, it can be useful to be able to select the inner element you want to style directly from the Content View . Drop a TitledPane to the Content View. Then select from the CSS Analyzer the CSS cursor (the other cursor on the left allow you to come back to ‘standard’ selection), that will allow to select an inner element: height: 62px;" align="LEFT" border="0"> … and select the TitledPane arrow, that will get a yellow background: … and the Styleable Path is updated: To define a new css rule, you can first copy the Styleable path : .. then paste it in your test.css file. Then, add an entry to set the -fx-background-color to red. You should have something like: .titled-pane:expanded .title .arrow-button .arrow { -fx-background-color : red;} As soon as the test.css is saved, the change is taken into account in Scene Builder. You can also use the Styleable Path to discover all the inner elements of TitledPane, by clicking on the arrow icon: More details You can see the CSS Analyzer in action (and many other features) from the Java One BOF: BOF4279 - In-Depth Layout and Styling with the JavaFX Scene Builder presented by my colleague Jean-Francois Denise. On the right hand, click on the Media link to go to the video (streaming) of the presa. The Scene Builder support of CSS starts at 9:20 The CSS Analyzer presentation starts at 12:50

    Read the article

< Previous Page | 527 528 529 530 531 532 533 534 535 536 537 538  | Next Page >