Search Results

Search found 43847 results on 1754 pages for 'command line arguments'.

Page 535/1754 | < Previous Page | 531 532 533 534 535 536 537 538 539 540 541 542  | Next Page >

  • How to set a key binding to make Emacs as transparent/opaque as I want?

    - by Vivi
    I want to have a command in Emacs to make it as opaque/transparent as I want (refer to the fabulous question that pointed out that transparency is possible in Emacs, and the EmacsWiki page linked there which has the code I am using below). The EmacsWiki code sets "C-c t" to toggle the previously set transparency on and off: ;;(set-frame-parameter (selected-frame) 'alpha '(<active> [<inactive>])) (set-frame-parameter (selected-frame) 'alpha '(85 50)) (add-to-list 'default-frame-alist '(alpha 85 50)) enter code here(eval-when-compile (require 'cl)) (defun toggle-transparency () (interactive) (if (/= (cadr (find 'alpha (frame-parameters nil) :key #'car)) 100) (set-frame-parameter nil 'alpha '(100 100)) (set-frame-parameter nil 'alpha '(85 60)))) (global-set-key (kbd "C-c t") 'toggle-transparency) What I would like to do is to be able to choose the % transparency when I am in Emacs. If possible, I would like a command where I type for example "C-c t N" (where N is the % opaqueness) for the active frame, and then "M-c t N" for the inactive window. If that can't be done like that, then maybe a command where if I type "C-c t" it asks me for the number which gives the opaqueness of the active window (and the same for the inactive window using "M-c t"). Thanks in advance for your time :) Below are just some comments that are not important to answer the question if you are not interested: I really want this because when I told my supervisor I was learning Emacs he said TexShop is much better and that I am using software from the 80's. I told him about the wonders of Emacs and he said TexShop has all of it and more. I matched everything he showed me except for the transparency (though he couldn't match the preview inside Emacs from preview-latex). I found the transparency thing by chance, and now I want to show him Emacs rules! I imagine this will be a piece of cake for some of you, and even though I could get it done if I spent enough time trying to learn lisp or reading around, I am not a programmer and I have only been using Emacs and a mac for a week. I am lost already as it is! So thanks in advance for your time and help - I will learn lisp eventually!

    Read the article

  • Google App Engine - Help with running python shell comands from aptanna studio

    - by spidee
    Hi I'm somewhat of a newbie to python and I'm using app engine and aptanna studio - I need to run some python shell commands so that i can complete the tasks in this Tutorial on how to set up 118 and django. I have got this all working but i don't understand how i run the python commands to compile the dictionarys such as $ PYTHONPATH=/path/to/googleappengine/python/lib/django/ /path/to/googleappengine/python/lib/django/django/bin/make-messages.py -a To be honest - why am i saying that! I dont know where in aptanna studio i run this command -then worse I don't quite understand what exactly i type based on the above command line. My path to google app engine is D:\Program Files\Google\google_appengine\ Can anyone help shed some light on how i do this from aptanna / the root of my project?? Im following this Tutorial: http://makeyjl.blogspot.com/2009/02/using-djangos-i18n-in-google-app-engine.html

    Read the article

  • MySQLdb not INSERTING, _mysql does fine.

    - by Mad_Casual
    Okay, I log onto the MySQL command-line client as root. I then open or otherwise run a python app using the MySQLdb module as root. When I check the results using python (IDLE), everything looks fine. When I use the MySQL command-line client, no INSERT has occurred. If I change things around to _mysql instead of MySQLdb, everything works fine. I'd appreciate any clarification(s). "Works" until IDLE/Virtual machine is reset: <pre><code>import MySQLdb db = MySQLdb.connect(user='root', passwd='*******',db='test') cursor = db.cursor() cursor.execute("""INSERT INTO test VALUES ('somevalue');""",)</code></end> Works: <pre><code>import _mysql db = _mysql.connect(user='root', passwd='*******',db='test') db.query("INSERT INTO test VALUES ('somevalue');")</code></end> System info: Intel x86 WinXP Python 2.5 MySQL 5.1.41 MySQL-Python 1.2.2

    Read the article

  • can we use both custom button and inbuilt button in datagridview

    - by Srikanth Mattihalli
    HI all, I am using Datagridview in asp.net. I have used custom buttons of up and down in the datagridview along with edit,delete and paging options. I am handling the up down buttons by raising events in rowcommand and the code is as below string command = e.CommandName; Response.Write(e.CommandArgument.ToString()); int index = Convert.ToInt32(e.CommandArgument.ToString()); int count = GridView1.Rows.Count; int keyValue = Convert.ToInt32(GridView1.Rows[index].Cells1.Text); string value = GridView1.Rows[index].Cells[4].Text; SqlConnection conn = new SqlConnection(SqlDataSource1.ConnectionString); SqlCommand cmd = new SqlCommand(); if (command == "up") { if (index > 0) { index = index - 1; int keyValue1 = Convert.ToInt32(GridView1.Rows[index].Cells[1].Text); string value1 = GridView1.Rows[index].Cells[4].Text; cmd.Connection = conn; cmd.CommandText = "UPDATE [category] SET [order_id] = '" + value + "' WHERE [category_id]=" + keyValue1 + ";UPDATE [category] SET [order_id] = '" + value1 + "' WHERE [category_id]=" + keyValue + ";"; conn.Open(); cmd.ExecuteNonQuery(); conn.Close(); } } else if (command == "down") { if (index < count - 1) { index = index + 1; int keyValue1 = Convert.ToInt32(GridView1.Rows[index].Cells[1].Text); string value1 = GridView1.Rows[index].Cells[4].Text; cmd.Connection = conn; cmd.CommandText = "UPDATE [category] SET [order_id] = '" + value + "' WHERE [category_id]=" + keyValue1 + ";UPDATE [category] SET [order_id] = '" + value1 + "' WHERE [category_id]=" + keyValue + ";"; conn.Open(); cmd.ExecuteNonQuery(); conn.Close(); } } Response.Redirect("Default.aspx"); Designer file " DeleteCommand="DELETE FROM [category] WHERE [category_id] = @category_id" InsertCommand="INSERT INTO [category] ([categoryname], [navigation_url], [order_id]) VALUES (@categoryname, @navigation_url, @order_id)" SelectCommand="SELECT * FROM [category] order by order_id" UpdateCommand="UPDATE [category] SET [categoryname] = @categoryname, [navigation_url] = @navigation_url, [order_id] = @order_id WHERE [category_id] = @category_id" After this my edit,delete and paging is not working bcoz of event conflicts. Can anyone plz help me on this, so that i will be able to use both custom buttons(up and down) and edit,delete and paging features.

    Read the article

  • Why is the modal dialog in MFC actually internally modeless?

    - by pythiyam
    This question arose in my miind after reading this article: http://www.codeproject.com/Articles/3911/The-singular-non-modality-of-MFC-modal-dialogs. He mentions that the modal dialog in MFC is not strictly modal, but implemented as a modeless dialog(internally) with bells and whistles to make it behave as a modal one. Specifically, he says: The MFC command routing mechanism uses a combination of message maps and virtual functions to achieve what it does and a true modal dialog will totally wreck this mechanism because then the modal message loop is controlled outside the scope of the MFC command routing machinery Could anyone elucidate this statement? An example of what would have gone wrong if they had tried to implement a truly modal dialog would greatly clear things up.

    Read the article

  • Cleanest way to run/debug python programs in windows

    - by YGA
    Python for Windows by default comes with IDLE, which is the barest-bones IDE I've ever encountered. For editing files, I'll stick to emacs, thank you very much. However, I want to run programs in some other shell than the crappy windows command prompt, which can't be widened to more than 80 characters. IDLE lets me run programs in it if I open the file, then hit F5 (to go Run- Run Module). I would rather like to just "run" the command, rather than going through the rigmarole of closing the emacs file, loading the IDLE file, etc. A scan of google and the IDLE docs doesn't seem to give much help about using IDLE's shell but not it's IDE. Any advice from the stack overflow guys? Ideally I'd either like advice on running programs using IDLE's shell advice on other ways to run python programs in windows outside of IDLE or "cmd". Thanks, /YGA

    Read the article

  • python os.execvp() trying to display mysql tables gives 1049 error - Unknown database error.

    - by Hemanth Murthy
    I have a question related to mysql and python. This command works on the shell, but not when I use os.execvp() $./mysql -D test -e "show tables" +----------------+ | Tables_in_test | +----------------+ | sample | +----------------+ The corresponding piece of code in python would be def execute(): args = [] args.extend(sys.argv[1:]) args.extend([MYSQL, '-D test -e "show tables"']) print args os.execvp(args[0], args) child_pid = os.fork() if child_pid == 0: os.execvp(args[0], args) else: os.wait() The output of this is: [./mysql', '-D test -e "show tables"'] ERROR 1049 (42000): Unknown database ' test -e "show tables"' I am not sure if this is a problem with the python syntax or not. Also, the same command works with os.system() call. os.system(MYSQL + ' -D test -e "show tables"') Please let me know how to get this working. Thanks, Hemanth

    Read the article

  • Set Icon in Button LWUIT Java ME

    - by Muhamad Burhanudin
    Please help me, to set icon button : /* * To change this template, choose Tools | Templates * and open the template in the editor. */ package tajwed; import javax.microedition.midlet.*; import com.sun.lwuit.*; import com.sun.lwuit.animations.*; import com.sun.lwuit.events.*; import com.sun.lwuit.layouts.BoxLayout; import com.sun.lwuit.plaf.*; import java.io.IOException; import java.util.Hashtable; /** * @author Muhamad BUrhanudin */ public class tajwedMidlet extends MIDlet implements ActionListener{ Form mHomeForm; Form mAwayForm; Form mMenuTajwid; Command mExitCommand; Button btMenu; Button btNunSukun, btMimSukun, btNunTasjid; Button btLamtarif, btIdgham, btMaad, btRaa; Button btHelp; Button btExit; Command mBackCommand; public void startApp() { Display.init(this); installTheme(); createUI(); mHomeForm.show(); } public void pauseApp() { } public void destroyApp(boolean unconditional) { } public void actionPerformed(ActionEvent ae) { mAwayForm.setTransitionInAnimator( Transition3D.createCube(400, false)); mMenuTajwid.setTransitionInAnimator( Transition3D.createCube(400, false)); mMenuTajwid.setTransitionOutAnimator( Transition3D.createCube(400, true)); mAwayForm.setTransitionOutAnimator( Transition3D.createCube(400, true)); if ((ae.getSource()==btMenu)|| (ae.getSource()==btHelp)) { //mAwayForm.show(); if(ae.getSource()== btMenu) { mMenuTajwid.show(); } } else if (ae.getSource() == mBackCommand) { mHomeForm.show(); } else if ((ae.getCommand() == mExitCommand) || (ae.getSource()== btExit)) notifyDestroyed(); } private void installTheme() { UIManager uim = UIManager.getInstance(); Hashtable ht = new Hashtable(); ht.put("sel#" + Style.BG_COLOR, "ffffff"); ht.put(Style.BG_COLOR, "d5fff9"); ht.put(Style.FG_COLOR, "000000"); uim.setThemeProps(ht); } private void createUI() { // Set up screen for transitions. mAwayForm = new Form("Away"); mAwayForm.addComponent(new Label("Choose Back to return to the home screen.")); mMenuTajwid = new Form("MENU DASAR TAJWID"); // mMenuTajwid mMenuTajwid.setLayout(new BoxLayout(BoxLayout.Y_AXIS)); btNunSukun = new Button("Hukum Nun Sukun & Tanwin"); btNunSukun.addActionListener(this); mMenuTajwid.addComponent(btNunSukun); btMimSukun = new Button("Hukum Mim Sukun"); btMimSukun.addActionListener(this); mMenuTajwid.addComponent(btMimSukun); btNunTasjid = new Button("Hukum Nun Tasydid & Min Tasydid"); btNunTasjid.addActionListener(this); mMenuTajwid.addComponent(btNunTasjid); btLamtarif = new Button("Hukum Laam Ta'rief"); btLamtarif.addActionListener(this); mMenuTajwid.addComponent(btLamtarif); btIdgham = new Button("Idgham"); btIdgham.addActionListener(this); mMenuTajwid.addComponent(btIdgham); btMaad = new Button("Maad"); btMaad.addActionListener(this); mMenuTajwid.addComponent(btMaad); btRaa = new Button("Raa'"); btRaa.addActionListener(this); mMenuTajwid.addComponent(btRaa); mBackCommand = new Command("Back"); mMenuTajwid.addCommand(mBackCommand); mMenuTajwid.addCommandListener(this); // Use setCommandListener() with LWUIT 1.3 or earlier. // Set up main screen. mHomeForm = new Form("Java Mobile Learning"); mHomeForm.setLayout(new BoxLayout(BoxLayout.Y_AXIS)); btMenu = new Button("TAJWID LEARNING"); btMenu.addActionListener(this); mHomeForm.addComponent(btMenu); try { btHelp = new Button("HELP",Image.createImage("/help.ico")); btHelp.addActionListener(this); mHomeForm.addComponent(btHelp); } catch(IOException e) { } btExit = new Button("EXIT"); btExit.addActionListener(this); mHomeForm.addComponent(btExit); mExitCommand = new Command("Keluar"); mHomeForm.addCommand(mExitCommand); mHomeForm.addCommandListener(this); // Use setCommandListener() with LWUIT 1.3 or earlier. } }

    Read the article

  • ODEE Green Field (Windows) Part 4 - Documaker

    - by AndyL-Oracle
    Welcome back! We're about nearing completion of our installation of Oracle Documaker Enterprise Edition ("ODEE") in a green field. In my previous post, I covered the installation of SOA Suite for WebLogic. Before that, I covered the installation of WebLogic, and Oracle 11g database - all of which constitute the prerequisites for installing ODEE. Naturally, if your environment already has a WebLogic server and Oracle database, then you can skip all those components and go straight for the heart of the installation of ODEE. The ODEE installation is comprised of two procedures, the first covers the installation, which is running the installer and answering some questions. This will lay down the files necessary to install into the tiers (e.g. database schemas, WebLogic domains, etcetera). The second procedure is to deploy the configuration files into the various components (e.g. deploy the database schemas, WebLogic domains, SOA composites, etcetera). I will segment my posts accordingly! Let's get started, shall we? Unpack the installation files into a temporary directory location. This should extract a zip file. Extract that zip file into the temporary directory location. Navigate to and execute the installer in Disk1/setup.exe. You may have to allow the program to run if User Account Control is enabled. Once the dialog below is displayed, click Next. Select your ODEE Home - inside this directory is where all the files will be deployed. For ease of support, I recommend using the default, however you can put this wherever you want. Click Next. Select the database type, database connection type – note that the database name should match the value used for the connection type (e.g. if using SID, then the name should be IDMAKER; if using ServiceName, the name should be “idmaker.us.oracle.com”). Verify whether or not you want to enable advanced compression. Note: if you are not licensed for Oracle 11g Advanced Compression option do not use this option! Terrible, terrible calamities will befall you if you do! Click Next. Enter the Documaker Admin user name (default "dmkr_admin" is recommended for support purposes) and set the password. Update the System name and ID (must be unique) if you want/need to - since this is a green field install you should be able to use the default System ID. The only time you'd change this is if you were, for some reason, installing a new ODEE system into an existing schema that already had a system. Click Next. Enter the Assembly Line user name (default "dmkr_asline" is recommended) and set the password. Update the Assembly Line name and ID (must be unique) if you want/need to - it's quite possible that at some point you will create another assembly line, in which case you have several methods of doing so. One is to re-run the installer, and in this case you would pick a different assembly line ID and name. Click Next. Note: you can set the DB folder if needed (typically you don’t – see ODEE Installation Guide for specifics. Select the appropriate Application Server type - in this case, our green field install is going to use WebLogic - set the username to weblogic (this is required) and specify your chosen password. This credential will be used to access the application server console/control panel. Keep in mind that there are specific criteria on password choices that are required by WebLogic, but are not enforced by the installer (e.g. must contain a number, must be of a certain length, etcetera). Choose a strong password. Set the connection information for the JMS server. Note that for the 12.3.x version, the installer creates a separate JVM (WebLogic managed server) that hosts the JMS server, whereas prior editions place the JMS server on the AdminServer.  You may also specify a separate URL to the JMS server in case you intend to move the JMS resources to a separate/different server (e.g. back to AdminServer). You'll need to provide a login principal and credentials - for simplicity I usually make this the same as the WebLogic domain user, however this is not a secure practice! Make your JMS principal different from the WebLogic principal and choose a strong password, then click Next. Specify the Hot Folder(s) (comma-delimited if more than one) - this is the directory/directories that is/are monitored by ODEE for jobs to process. Click Next. If you will be setting up an SMTP server for ODEE to send emails, you may configure the connection details here. The details required are simple: hostname, port, user/password, and the sender's address (e.g. emails will appear to be sent by the address shown here so if the recipient clicks "reply", this is where it will go). Click Next. If you will be using Oracle WebCenter:Content (formerly known as Oracle UCM) you can enable this option and set the endpoints/credentials here. If you aren't sure, select False - you can always go back and enable this later. I'm almost 76% certain there will be a post sometime in the future that details how to configure ODEE + WCC:C! Click Next. If you will be using Oracle UMS for sending MMS/text messages, you can enable and set the endpoints/credentials here. As with UCM, if you're not sure, don't enable it - you can always set it later. Click Next. On this screen you can change the endpoints for the Documaker Web Service (DWS), and the endpoints for approval processing in Documaker Interactive. The deployment process for ODEE will create 3 managed WebLogic servers for hosting various Documaker components (JMS, Interactive, DWS, Dashboard, Documaker Administrator, etcetera) and it will set the ports used for each of these services. In this screen you can change these values if you know how you want to deploy these managed servers - but for now we'll just accept the defaults. Click Next. Verify the installation details and click Install. You can save the installation into a response file if you need to (which might be useful if you want to rerun this installation in an unattended fashion). Allow the installation to progress... Click Next. You can save the response file if needed (e.g. in case you forgot to save it earlier!) Click Finish. That's it, you're done with the initial installation. Have a look around the ODEE_HOME that you just installed (remember we selected c:\oracle\odee_1?) and look at the files that are laid down. Don't change anything just yet! Stay tuned for the next segment where we complete and verify the installation. 

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Textmate bundle to remove a directory and build with Jekyll

    - by m1755
    I am looking for a simple Textmate bundle that will do the following two tasks in order: Delete the entire contents (including folders) of a directory (eg. ~/Sites/my_site). Run the jekyll command in the directory of the Textmate project. I am going to associate this with a "save current file" and use it to auto build my Jekyll site into the specified directory each time I save a file inside the project. Notes If #2 isn't possible, then cd into a specified directory and run the jekyll command. Would prefer bash or ruby.

    Read the article

  • Questions about linux root file system.

    - by smwikipedia
    I read the manual page of the "mount" command, at it reads as below: All files accessible in a Unix system are arranged in one big tree, the file hierarchy, rooted at /. These files can be spread out over several devices. The mount command serves to attach the file system found on some device to the big file tree. My questions are: Where is this "big tree" located? Suppose I have 2 disks, if I mount them onto some point in the "big tree", does linux place some "special marks" in the mount point to indicate that these 2 "mount directories" are indeed seperate disks?

    Read the article

  • Minimum & Maximum Values in Crystal Reports 2008 Column

    - by GregD
    Say I have this column returned in a command for Crystal: deposit_no 123 130 125 124 126 127 128 129 and I need to have this in the report title: Includes deposits between 123 - 130 I've tried a running formula for minimum and maximum and they aren't returning the correct values no matter how I manipulate them. I've tried evaluate for every record, on change of the deposit_no field, etc. I have no grouping on this report. Edited to add: While I preferred to handle this on the CR side of things, I changed my command to include what mson wrote below. So technically, mson had the correct answer.

    Read the article

  • mkdir error in bash script

    - by Don
    Hi, The following is a fragment of a bash script that I'm running under cygwin on Windows: deployDir=/cygdrive/c/Temp/deploy timestamp=`date +%Y-%m-%d_%H:%M:%S` deployDir=${deployDir}/$timestamp if [ ! -d "$deployDir" ]; then echo "making dir $deployDir" mkdir -p $deploydir fi This produces output such as: making dir /cygdrive/c/Temp/deploy/2010-04-30_11:47:58 mkdir: missing operand Try `mkdir --help' for more information. However, if I type /cygdrive/c/Temp/deploy/2010-04-30_11:47:58 on the command-line it succeeds, why does the same command not work in the script? Thanks, Don

    Read the article

  • Understanding the Unix file system and ruby installs without Sudo

    - by JZ
    I'm trying to comprehend the Unix file system on my OSX. I'm following wikipedia Filesystem Hierarchy Standard. I understand when I install ruby gems I must use the command sudo gem install but if I omit sudo, problems may occur. Where are gems installed within the file system when I omit sudo? How can I delete these gems? A Fun side question: When I enter cd ~/.gem my terminal is directed to .gem user$, When I enter cd ~/ and list folders using the ls command I can't find a .gem folder. Where is the .gem folder? How does this fit into the Filesystem?

    Read the article

  • Windbg + IDA: calculate an address in a module

    - by Benjamin
    Hi all, I'm debugging remotely a windows XP machine. One of my drivers is loaded at address 0xb2c4c000 up to 0xb2cb9680. Now when I open my driver in IDA, the offset I want to set a breakpoint on is at 00017619. How can I effectively match my IDA address into windbg? I've tried the obvious which is to sum 0xb2c4c000 + 00017619 = 0xB2C635F7 and disassemble that address using the 'u' command in windbg. But the results did not match the assembly in IDA. On the side question: is there a way to cancel a command that is running in windbg? Several times I've ran commands that took ages to process, I would like to be able to cancel them if needed. So I can keep working. Thanks for your time.

    Read the article

  • Automate paster create -t plone3_buildout

    - by roopesh
    I want to automate the process of plone3_buildout. Explanation: The default(the one I use) way of building a plone site is using paster, like so: paster create -t plone3_buildout This asks me a few questions and then create a default buildout for the site. What I want: I want to automate this process using buildout. My buildout will execute this paster command, feed in my preconfigured values to the paster. I haven't found a recipe which can do this. If someone has an idea of how to do this, please share the info. If there is a recipe which can feed values to interactive commands(with known output, like with plone3_buildout command), that would be useful too.

    Read the article

  • Using Delphi or FFMpeg to create a movie from image sequence

    - by Hein du Plessis
    Hi all My Delphi app has created a squence called frame_001.png to frame_100.png. I need that to be compiled into a movie clip. I think perhaps the easiest is to call ffmpeg from the command line, according to their documentation: For creating a video from many images: ffmpeg -f image2 -i foo-%03d.jpeg -r 12 -s WxH foo.avi The syntax foo-%03d.jpeg specifies to use a decimal number composed of three digits padded with zeroes to express the sequence number. It is the same syntax supported by the C printf function, but only formats accepting a normal integer are suitable. From: http://ffmpeg.org/ffmpeg-doc.html#SEC5 However my files are (lossless) png format, so I have to convert using imagemagick first. My command line is now: ffmpeg.exe -f image2 -i c:\temp\wentelreader\frame_%05d.jpg -r 12 foo.avi But then I get the error: [image2 @ 0x133a7d0]Could not find codec parameters (Video: mjpeg) c:\temp\wentelreader\Frame_C:\VID2EVA\Tools\Mencoder\wentel.bat5d.jpg: could not find codec parameters What am I doing wrong? Alternatively can this be done easily with Delphi?

    Read the article

  • Java Annotations - Is there any helper library to read/process annotations?

    - by mjlee
    I start to use Java annotations heavily. One example is taking method with annotations and converting them into 'telnet'-based command-line command. I do this by parsing annotations and hook into jopt option parser. However, I do a lot of these manually. For example, Method parameter annotation processing.. Method method = ... //; Class[] parameters = method.getParamterTypes(); Annotation[][] annotations = method.getparamterAnnotations(); for( int i = 0; i < parameters.length; i++ ) { // iterate through the annotation , see if each param has specific annotation ,etc. } It is very redundant and tedious. Is there any opensource project that help processing Annotations?

    Read the article

  • Unable to install Maven: "JAVA_HOME is set to an invalid directory"

    - by hello_world_infinity
    I followed the Maven tutorial to the letter but I still can't get Maven installed. When I run the following in command prompt: E:\Documents and Settings\zach>mvn --version I get: 'mvn' is not recognized as an internal or external command, operable program or batch file. I navigated to the maven install folder and ran mvn --version and got: E:\java resources\apache-maven-2.2.0\bin>mvn --version ERROR: JAVA_HOME is set to an invalid directory. JAVA_HOME = "E:\Sun\SDK\jdk\bin" Please set the JAVA_HOME variable in your environment to match the location of your Java installation but when I run java -version I get: java version "1.6.0_14" Java(TM) SE Runtime Environment (build 1.6.0_14-b08) Java HotSpot(TM) Client VM (build 14.0-b16, mixed mode) So I do have Java installed. Anyone know what the problem is?

    Read the article

  • Elegant setup of Python logging in Django

    - by Parand
    I have yet to find a way of setting up Python logging with Django that I'm happy with. My requirements are fairly simple: Different log handlers for different events - that is, I want to be able to log to different files Easy access to loggers in my modules. The module should be able to find its logger with little effort. Should be easily applicable to command-line modules. Parts of the system are stand-alone command line or daemon processes. Logging should be easily usable with these modules. My current setup is to use a logging.conf file and setup logging in each module I log from. It doesn't feel right. Do you have a logging setup that you like? Please detail it: how do you setup the configuration (do you use logging.conf or set it up in code), where/when do you initiate the loggers, and how do you get access to them in your modules, etc.

    Read the article

  • Terminate on instance "std::runtime_error" Hiphop-Php

    - by boundless08
    I have successfully built Hiphop-Php on an ubuntu server 12.04 LTS but when I run the command: $HPHP_HOME/src/hphp/hphp test.php This error occurs: terminate called after throwing an instance of 'std::runtime_error' what(): locale::facet::_S_create_c_locale name not valid Aborted (core dumped) The same error occured during the make command but I used sudo make and it dealt with that, but using sudo on the above just removes the Aborted (core dumped). This is happening on a remote server, but I have done the exact same before testing on a VM. I even got root access, as I thought that could help, but it's done nothing. Just so you know I built with USE_HHVM=0, I need the code unreadable and the bytecode format does this, but the VM I built was as well, I'm just stumped! Thanks in advance.

    Read the article

  • include external jar when running java -jar

    - by prmatta
    From my readings, when you execute a command as follows: java -jar foo.jar Then the main classpath is ignored and the classpath is taken from the manifest file. Further, the classpath declared on the command line is also ignored. So in: java -classpath /usr/local/jar/foobar.jar -jar foo.jar /usr/local/jar/foobar.jar is ignored. Lastly, I have read that the manifest file can only only contain relative paths, within the jar file. So, how do you include absolute paths to external jars, that are present on the system, but not in the jar file being executed?

    Read the article

  • Lightweight web browser for testing

    - by Ghostrider
    I have e very specific test setup in mind. I would like to start a web-browser that understands Javascript and can use HTTP proxy, point it to a URL (ideally by specifying it in the command line along with the proxy config), wait for the page to load while listening (in the proxy) requests are generated as web-page is rendered and Javascript is executed, then kill the whole thing and restart. I don't care about how the page renders graphically at all. Which browser or tool should I use for this? Ideally it should be something self-contained that doesn't require installation (just an EXE file that runs from command line). Lynx would have been ideal but for the fact that it doesn't support JS. It should have as small memory footprint as possible.

    Read the article

< Previous Page | 531 532 533 534 535 536 537 538 539 540 541 542  | Next Page >