Search Results

Search found 41379 results on 1656 pages for 'command line'.

Page 538/1656 | < Previous Page | 534 535 536 537 538 539 540 541 542 543 544 545  | Next Page >

• Proccess of carrying out a BER Test

  - by data

  I am subscribed to an ISP supplying a 3meg ADSL line. Lately (for the last 4 weeks) speeds have dropped from the usual average downstream speed of ~250kbps to just 0.14Mbps (according to speedtest.net) and employees are complaining about lack of access to the server. I have been calling customer support and logging calls for the last 3 weeks, but they have been unable to determine the source of the problem other carrying out a few bitstream tests and checking the DHCP renewal times. I am going to call back and suggest carrying out a BER test. What type of equipment is needed to carry out this test? I have access to a wide range of Cisco networking equipment. Other: We dont need a leased line as there are less than ten employees.

  Read the article

• How to access Virtual machine using powershell script

  - by Sheetal

  I want to access the virtual machine using powershell script. For that I used below script, Enter-PSSession -computername sheetal-VDD -credential compose04.com\abc.xyz1 where, sheetal-VDD is hostname of virtual machine compose04.com is the domain name of virtual machine and abc.xyz1 is the username of virtual machine After entering above command , it asks for password. When the password is entered I get below error, Enter-PSSession : Connecting to remote server failed with the following error message : WinRM cannot process the reques t. The following error occured while using Kerberos authentication: There are currently no logon servers available to s ervice the logon request. Possible causes are: -The user name or password specified are invalid. -Kerberos is used when no authentication method and no user name are specified. -Kerberos accepts domain user names, but not local user names. -The Service Principal Name (SPN) for the remote computer name and port does not exist. -The client and remote computers are in different domains and there is no trust between the two domains. After checking for the above issues, try the following: -Check the Event Viewer for events related to authentication. -Change the authentication method; add the destination computer to the WinRM TrustedHosts configuration setting or us e HTTPS transport. Note that computers in the TrustedHosts list might not be authenticated. -For more information about WinRM configuration, run the following command: winrm help config. For more information, see the about_Remote_Troubleshooting Help topic. At line:1 char:16 + Enter-PSSession <<<< -computername sheetal-VDD -credential compose04.com\Sheetal.Varpe + CategoryInfo : InvalidArgument: (sheetal-VDD:String) [Enter-PSSession], PSRemotingTransportException + FullyQualifiedErrorId : CreateRemoteRunspaceFailed Can someone help me out in this?

  Read the article

• Is there a way to do a sector level copy/clone from one hard drive to another?

  - by irrational John

  Without going into distracting details, I'm attempting to duplicate the contents of the 500GB drive in my MacBook to another 500GB drive. But this is turning out to be an unexpected hassle because the drive contains both the OS X partition and an NTFS partition with Win 7 via Apple's Boot Camp. With the exception of Clonezilla, the tools I have looked at so far all have some limitation. The Mac tools don't want to deal with the NTFS partition. The Windows tools are totally clueless about either the HFS+ partition and/or the hybrid MBR/GPT Boot Camp partitioning. Clonezilla looked like it would do what I want but apparently I can't figure out how to use it. After doing what I thought was a sector to sector copy I found that only the NTFS partition had been migrated. The others were apparently empty. (And frankly, I'm not positive Clonezilla migrated the partition table correctly either). Note: It takes over 2 hours using SATA to read/write all sectors with these drives. So I'm not up for using trial & error to narrow in on the right combination of Clonezilla options to use. I'm beginning to think that maybe the answer is to boot Linux (probably Ubuntu) and then use some ancient BSD command. Trouble is I don't know what command (or parameters to use) in order to do a sector level copy from one drive to another. As far as I know the drives have the same number of sectors so this should be trivial. Sigh.

  Read the article

• How to configure Notepad++ (Scintilla) to write below EOF after EOL [on hold]

  - by Piotr Piaseczny

  Is it possible to configure scintilla to "brake" EOL/EOF while writing ? Now, if I want to begin writing in a column after EOL, I use ALT+left mouse button and start typing after click. No idea how to begin writing below EOF. Pressing Enter key many times is the only method now. Other explanation: If You open a new document, doesnt matter what kind of (php/txt etc) all You have is just one line. If You want to write in line 5 - must press Enter 5 times. Every other editor I know (IDE in Builder C++/MultiEdit) "ignore" eof and you can write anywhere in document. Because of php/html I've found notepad++ as a best editor but I'd like to "brake" limitations of (probably) scintilla

  Read the article

• HPET missing from available clocksources on CentOS

  - by squareone

  I am having trouble using HPET on my physical machine. It is not available, even though I have enabled it in my bios, forced it in grub, and triple checked my kernel to include HPET in its compilation. Motherboard: Supermicro X9DRW Processor: 2x Intel(R) Xeon(R) CPU E5-2640 SAS Controller: LSI Logic / Symbios Logic SAS2004 PCI-Express Fusion-MPT SAS-2 [Spitfire] (rev 03) Distro: CentOS 6.3 Kernel: 3.4.21-rt32 #2 SMP PREEMPT RT x86_64 GNU/Linux Grub: hpet=force clocksource=hpet .config file: CONFIG_HPET_TIMER=y CONFIG_HPET_EMULATE_RTC=y CONFIG_HPET=y dmesg | grep hpet: Command line: ro root=/dev/mapper/vg_xxxx-lv_root rd_NO_LUKS rd_LVM_LV=vg_xxxx/lv_root KEYBOARDTYPE=pc KEYTABLE=us rd_NO_MD SYSFONT=latarcyrheb-sun16 crashkernel=auto rd_LVM_LV=vg_xxxx/lv_swap rd_NO_DM LANG=en_US.UTF-8 rhgb quiet panic=5 hpet=force clocksource=hpet Kernel command line: ro root=/dev/mapper/vg_xxxx-lv_root rd_NO_LUKS rd_LVM_LV=vg_xxxx/lv_root KEYBOARDTYPE=pc KEYTABLE=us rd_NO_MD SYSFONT=latarcyrheb-sun16 crashkernel=auto rd_LVM_LV=vg_xxxx/lv_swap rd_NO_DM LANG=en_US.UTF-8 rhgb quiet panic=5 hpet=force clocksource=hpet cat /sys/devices/system/clocksource/clocksource0/current_clocksource: tsc cat /sys/devices/system/clocksource/clocksource0/available_clocksource: tsc jiffies What is even more confusing, is that I have about a dozen other machines that utilize the same kernel .config, and can use HPET fine. I fear it is a hardware issue, but would appreciate any advice or help with getting HPET available. Thanks in advance!

  Read the article

• Ubuntu Launcher Items Don't Have Correct Environment Vars under NX

  - by ivarley

  I've got an environment variable issue I'm having trouble resolving. I'm running Ubuntu (Karmic, 9.10) and coming in via NX (NoMachine) on a Mac. I've added several environment variables in my .bashrc file, e.g.: export JAVA_HOME=$HOME/dev/tools/Linux/jdk/jdk1.6.0_16/ Sitting at the machine, this environment variable is available on the command line, as well as for apps I launch from the Main Menu. Coming in over NX, however, the environment variable shows up correctly on the command line, but NOT when I launch things via the launcher. As an example, I created a simple shell script called testpath in my home folder: #!/bin/sh echo $PATH && sleep 5 quit I gave it execute privileges: chmod +x testpath And then I created a launcher item in my Main Menu that simply runs: ./testpath When I'm sitting at the computer, this launcher runs and shows all the stuff I put into the $PATH variable in my .bashrc file (e.g. $JAVA_HOME, etc). But when I come in over NX, it shows a totally different value for the $PATH variable, despite the fact that if I launch a terminal window (still in NX), and type export $PATH, it shows up correctly. I assume this has to do with which files are getting loaded by the windowing system over NX, and that it's some other file. But I have no idea how to fix it. For the record, I also have a .profile file with the following in it: # if running bash if [ -n "$BASH_VERSION" ]; then # include .bashrc if it exists if [ -f "$HOME/.bashrc" ]; then . "$HOME/.bashrc" fi fi

  Read the article

• Know any file compare utility for chunks of text?

  - by Belun

  Is there any file-compare utility-software that can help me compare chunks of text from two text files ? As in, I want to know what chunks of text that are in one file can be found again in the second file. What I need to do is more like a 'compare and search' operation, not just a compare line by line. I need this for finding common errors in application logs. Eg., I have a Java application and logs from two different days. I want to find out which stack-traces (that are actually chunks of text inside a text file) are common to both days.

  Read the article

• if I define `my_domain`, postfix does not expand mail aliases

  - by Norky

  I have postfix v2.6.6 running on CentOS 6.3, hostname priest.ocsl.local (private, internal domain) with a number of aliases supportpeople: [email protected], [email protected], [email protected] requests: "|/opt/rt4/bin/rt-mailgate --queue 'general' --action correspond --url http://localhost/", supportpeople help: "|/opt/rt4/bin/rt-mailgate --queue 'help' --action correspond --url http://localhost/", supportpeople If I leave postfix with its default configuration, then the aliases are resolved correctly/as I expect, so that incoming mail to, say, [email protected] will be piped through the rt-mailgate mailgate command and also be delivered (via the mail server for ocsl.co.uk (a publicly resolvable domain)) to [email protected], user2, etc. The problem comes when I define mydomain = ocsl.co.uk in /etc/postfix/main.cf (with the intention that outgoing mail come from, for example, [email protected]). When I do this, postfix continues to run the piped command correctly, however it no longer expands the nested aliases as I expect: instead of trying to deliver to [email protected], user2 etc, it tries to send to [email protected], which does not exist on the upstream mail server and generates NDRs. postconf -n for the non-working configuration follows (the working configuration differs only by the "mydomain" line. alias_database = hash:/etc/aliases alias_maps = hash:/etc/aliases command_directory = /usr/sbin config_directory = /etc/postfix daemon_directory = /usr/libexec/postfix data_directory = /var/lib/postfix debug_peer_level = 2 html_directory = no inet_interfaces = all inet_protocols = all mail_owner = postfix mailq_path = /usr/bin/mailq.postfix manpage_directory = /usr/share/man mydestination = $myhostname, localhost.$mydomain, localhost mydomain = ocsl.co.uk newaliases_path = /usr/bin/newaliases.postfix queue_directory = /var/spool/postfix readme_directory = /usr/share/doc/postfix-2.6.6/README_FILES sample_directory = /usr/share/doc/postfix-2.6.6/samples sendmail_path = /usr/sbin/sendmail.postfix setgid_group = postdrop unknown_local_recipient_reject_code = 550 We did have things working as we expected/wanted previously on an older system running Sendmail.

  Read the article

• How to read iptables -L output?

  - by skrebbel

  I'm rather new to iptables, and I'm trying to understand its output. I tried to RTFM, but to no avail when it comes to little details like these. When iptables -vnL gives me a line such as: Chain INPUT (policy DROP 2199 packets, 304K bytes) I understand the first part: on incoming data, if the list below this line does not provide any exceptions, then the default policy is to DROP incoming packets. But what does the 2199 packets, 304K bytes part mean? Is that all the packets that were dropped? Is there any way to find out which packets that were, and where they came from? Thanks!

  Read the article

• Pressing 'Enter' doesn't really work in Firefox

  - by inkedmn

  When I'm typing just about anywhere in Firefox on OSX and press enter, it simply doesn't do anything. This includes typing in a textarea element (which should take the cursor to the next line), in a search form (which should submit the form). I'm typing this very question in Firefox right now and I'm unable to advance the cursor to the beginning of the next line. I have no clue what I did to make this happen, but it's kinda driving me insane. This is Firefox 3.6.3 under Mac OS X 10.6. Thanks!

  Read the article

• Quick introduction to Linux needed

  - by 0xDEAD BEEF

  Hi guys! I have to get into Linux ASAP and realy mean ASAP. I have installed Cygwin but as allways - things dont go as easy as one would like. First problem i enconter was - i choose KDE package, but there is no sign of KDE files anywhere in cygwin folder. How do i run KDE windows. Currently startx fires, but all looks ugly! My desire is to download and run Qt Creator. Seems that there is no cygwin package, but downloading source and compiling is good to go. Only that i have forgoten every linux command i ever knew! :D Please - what are default commands u use on linux? What does exec do? what ./ stands for? What is directory strucutre and why there is such mess in bin folder? Thanks god - i have windows over cygwin, so downloading files is not a problem, but again -how do i unpack them in linux style and how to i build? simply issue "make" command from folder, where i extracted files? Please help!

  Read the article

• How to know who accessed a file or if a file has 'access' monitor in linux

  - by J L

  I'm a noob and have some questions about viewing who accessed a file. I found there are ways to see if a file was accessed (not modified/changed) through audit subsystem and inotify. However, from what I have read online, according to here: http://www.cyberciti.biz/tips/linux-audit-files-to-see-who-made-changes-to-a-file.html it says to 'watch/monitor' file, I have to set a watch by using command like: # auditctl -w /etc/passwd -p war -k password-file So if I create a new file or directory, do I have to use audit/inotify command to 'set' watch first to 'watch' who accessed the new file? Also is there a way to know if a directory is being 'watched' through audit subsystem or inotify? How/where can I check the log of a file? edit: from further googling, I found this page saying: http://www.kernel.org/doc/man-pages/online/pages/man7/inotify.7.html The inotify API provides no information about the user or process that triggered the inotify event. So I guess this means that I cant figure out which user accessed a file? Only audit subsystem can be used to figure out who accessed a file?

  Read the article

• How to failover to local account on a cisco switch/router if radius server fails?

  - by 3d1l

  I have the following configuration on a switch that I testing for RADIUS authentication: aaa new-model aaa authenticaton login default group radius local aaa authentication enable default group radius enable aaa authorization exec default group radius local enable secret 5 XXXXXXXXX ! username admin secret 5 XXXXXXXXX ! ip radius source-interface FastEthernet0/1 radius-server host XXX.XXX.XXX.XXX auth-port 1812 acct-port 1813 key XXXXXXXXX radius-server retransmit 3 ! line con 0 line vty 5 15 Radius authentication is working just fine but if the server is not available I can not log into the router with the ADMIN account. What's wrong there? Thanks!

  Read the article

• How to copy a floppy boot disk?

  - by Sammy

  I have a floppy boot disk and I would like to copy it to preserve it, as a backup. If I have two floppy drives, A and B, how can I copy the disk? Assuming one has two floppy drives Can I simply insert the floppy disk in one of the drives and then an empty floppy disk in the other and issue a simple command like this one. A:\>copy . b: Will this only copy the contents of the current directory and none of the files in subdirectories? Do I have to explicitly specify the option to copy everything? Also, what about the boot information? That won't get copied, right? If one has only one floppy drive... How do you copy a floppy disk if you only have one floppy drive? Do you in fact have to copy its contents to the local hard drive C and then copy that to an empty floppy disk using the same floppy drive? A:\>copy . c:\floppydisk A:\> A:\>c: C:\> C:\>copy floppydisk a: C:\> I'm guessing I will need some type of disk image tool to really copy everything on a bootable floppy disk. Something like the dd command on Linux perhaps? Am I right?

  Read the article

• What Logs / Process Stats to monitor on a Ubuntu FTP server?

  - by Adam Salkin

  I am administering a server with Ubuntu Server which is running pureFTP. So far all is well, but I would like to know what I should be monitoring so that I can spot any potential stability and security issues. I'm not looking for sophisticated software, more an idea of what logs and process statistics are most useful for checking on the health of the system. I'm thinking that I can look at various parameters output from the "ps" command and compare to see if I have things like memory leaks. But I would like to know what experienced admins do. Also, how do I do a disk check so that when I reboot, I don't get a message saying something like "disk not checked for x days, forcing check" which delays the reboot? I assume there is command that I can run as a cron job late at night. How often should it be run? What things should I be looking at to spot intrusion attempts? The only shell access is SSH on a non-standard port through UFW firewall, and I regularly do a grep on auth.log for "Fail" or "Invalid". Is there anything else I should look at? I was logging the firewall (UFW) but I have very few open ports (FTP and SSH on a non standard port) so looking at lists of IP's that have been blocked did not seem useful. Many thanks

  Read the article

• How do I get to the bottom of network latency and bandwidth issues

  - by three_cups_of_java

  I recently moved two blocks south. That move moved me from Comcast to Broadstripe (high-speed internet cable providers). Comcast was pretty good. Broadstripe sucks. I called them on the phone, and they basically brushed me off (politely). I want to come to them with some numbers, so I can say more than just "it's really slow". I still have access to my old Comcast service, so I can run the tests using both providers. Here's what I'm seeing with my new Broadstripe service: 1) When I browse to most sites, there is a long delay (5-10 seconds) before the page starts loading in my browser 2) The speed test tell me I have 12 megs down (bullshit) 3) I have a server at my office. I just downloaded some files (using scp on the command line). It said I'm getting 3.5 KB/s I'm an experienced programmer and spend most of my days on the command line and in vim. Networking, however is not a strong point. I've played around with traceroute, but I'm not sure if that's the right tool to use. I have access to servers all over the country (I would just use Amazon EC2 to set up a test server), and I prefer to use Ubuntu for my testing. How can I come up with some hard numbers to show Broadstripe how crappy their service is?

  Read the article

• Can not connect remotely to MySQL Server on Ubuntu 10.10

  - by BobFranz

  Ok I have searched google for two days trying to get this to work. Here are the steps I have taken so far: Clean install of Ubuntu 10.10 Install mysql 5.1 as well as admin Comment out the bind address in the config file Create a new database Create a new user that is username@% to allow remote connections Grant all access to this user to the new database EXCEPT the grant option Login on the server is ok using this new user and database on the localhost Login on the server is ok using this new user and database on the server internal network ip Login from a remote computer is ok using this new user and database using the internal network ip Login is not working when logging in with this username and database using the external ip address from the server or the remote computer. I have port forwarding enabled for this port and it is viewable from outside as confirmed by canyouseeme.org I have nmap'd using the following command on the internal ip and get the below result: nmap -PN -p 3306 192.168.1.73 Starting Nmap 5.21 ( http://nmap.org ) at 2011-02-19 13:41 PST Nmap scan report for computername-System-Name (192.168.1.73) Host is up (0.00064s latency). PORT STATE SERVICE 3306/tcp open mysql Nmap done: 1 IP address (1 host up) scanned in 0.23 seconds I have nmap'd using the following command on the internal ip and get the below result(I have hidden ip for obvious reasons): nmap -PN -p 3306 xxx.xxx.xx.xxx Starting Nmap 5.21 ( http://nmap.org ) at 2011-02-19 13:42 PST Nmap scan report for HOSTNAME (xxx.xxx.xx.xxx) Host is up (0.00056s latency). PORT STATE SERVICE 3306/tcp closed mysql Nmap done: 1 IP address (1 host up) scanned in 0.21 seconds I am completely stuck here and need some help. I have tried everything under the moon and still can not connect from a remote external ip address. Any help is greatly appreciated and I need to do anything to help find the problem let me know and I will post the results here.

  Read the article

• iPhone Docked Playing Through PC, Buzzing.

  - by DrFloyd5

  Hi. I have an iPhone that I fit into an Apple dock. There is an audio cable from dock into the line in on my sound card. My headphones are plugged into the line out. I get this really quite buzz that is fairly constant, but changes as the iphone "does stuff". It's not so bad when the music is playing. But when it stops I get the buzz, so I can't really use my headphones as "noise cancellation." It doesn't help to change my volume sliders on the PC. Any ideas? Thanks in advance.

  Read the article

• java memory allocation under linux

  - by pstanton

  I'm running 4 java processes with the following command: java -Xmx256m -jar ... and the system has 8Gb memory under fedora 12. however it is apparently going into swap. how can that be if 4 x 256m = 1Gb ? EDIT: also, how can all 8Gb of memory be used with so little memory allocated to basically the only thing running? is it java not garbage collecting because the OS tells it it doesn't need to or what? TOP: top - 20:13:57 up 3:55, 6 users, load average: 1.99, 2.54, 2.67 Tasks: 251 total, 6 running, 245 sleeping, 0 stopped, 0 zombie Cpu(s): 50.1%us, 2.9%sy, 0.0%ni, 45.1%id, 1.1%wa, 0.0%hi, 0.8%si, 0.0%st Mem: 8252304k total, 8195552k used, 56752k free, 34356k buffers Swap: 10354680k total, 74044k used, 10280636k free, 6624148k cached PID USER PR NI VIRT RES SHR S %CPU %MEM TIME+ COMMAND 1948 xxxxxxxx 20 0 1624m 240m 4020 S 96.8 3.0 164:33.75 java 1927 xxxxxxxx 20 0 139m 31m 27m R 91.8 0.4 38:34.55 postgres 1929 xxxxxxxx 20 0 1624m 200m 3984 S 86.2 2.5 183:24.88 java 1969 xxxxxxxx 20 0 1624m 292m 3984 S 65.6 3.6 154:06.76 java 1987 xxxxxxxx 20 0 137m 29m 27m R 28.5 0.4 75:49.82 postgres 1581 root 20 0 159m 18m 4712 S 22.5 0.2 52:42.54 Xorg 2411 xxxxxxxx 20 0 309m 9748 4544 S 20.9 0.1 45:05.08 gnome-system-mo 1947 xxxxxxxx 20 0 137m 28m 27m S 13.3 0.4 44:46.04 postgres 1772 xxxxxxxx 20 0 135m 25m 25m S 4.0 0.3 1:09.14 postgres 1966 xxxxxxxx 20 0 137m 29m 27m S 3.0 0.4 64:27.09 postgres 1773 xxxxxxxx 20 0 135m 732 624 S 1.0 0.0 0:24.86 postgres 2464 xxxxxxxx 20 0 15028 1156 744 R 0.7 0.0 0:49.14 top 344 root 15 -5 0 0 0 S 0.3 0.0 0:02.26 kdmflush 1 root 20 0 4124 620 524 S 0.0 0.0 0:00.88 init 2 root 15 -5 0 0 0 S 0.0 0.0 0:00.00 kthreadd 3 root RT -5 0 0 0 S 0.0 0.0 0:00.00 migration/0 4 root 15 -5 0 0 0 S 0.0 0.0 0:00.04 ksoftirqd/0

  Read the article

• Transferring files from ftp to local system

  - by user1056221

  I want to copy a file from FTP and paste it to my local system. I want to run this through a batch file. I am trying this for a week. But I couldn't find the solution. Anyone help me please.... This is my actual work Want to copy a file named "Friday.bat" from ftp://172.16.3.132 (with username and password) So I use the below coding: @echo off @ftp -i -s:"%~f0"&GOTO:EOF open 172.16.3.132 mmftp ((((pasword entered here))))) binary get Friday.bat pause Result: ftp> @echo off ftp> @ftp -i -s:"%~f0"&GOTO:EOF Invalid command. ftp> open 172.16.3.132 Connected to 172.16.3.132. 220 Welcome to ABL FTP service. User (172.16.3.132:(none)): 331 Please specify the password. 230 Login successful. ftp> binary 200 Switching to Binary mode. ftp> get Friday.bat 200 PORT command successful. Consider using PASV. 550 Failed to open file. ftp> pause Finally, a file named Friday.bat is copied to my local system with 0 bytes, but it will not open.

  Read the article

• Amazon EC2 - Free memory

  - by Damo

  We have an amazon ec2 small instance running and over the past few days we noticed that the memory is going down and down. On the small instance, we are running apache and tomcat6 Tomcat is started with the following JVM parameters -Xms32m -Xmx128m -XX:PermSize=128m -XX:MaxPermSize=256m We use nagios to monitor stuff like updates to apply, free disk space and memory. Everything else is behaving as expected but our memory is going down all the time. Our app receives approx half a million hits a day When I shutdown apache and tomcat, and ran free -m, we had only 594mb of memory free out out of the 1.7gb of memory. Not much else is running on the small instance and when running the top command I cannot see where the memory is going. The app we run on tomcat is a grails webapp. Could there be a possibility that there is a memory leak within our application? I read online and folks say that a small amazon instance is perfect for running apach and tomcat. I found a few posts online that showed how to setup apache and tomcat to limit the memory usage and I have already performed those steps. The memory is not being used up as quick but the memory is still decreasing over time. We have other amazone ec2 small instances running grails apps and the memory is fairly standard on those nodes. But they would not be receiving as much traffic Just to add, when I run the top command on the problem server, I cannot see where all the memory is being used Any help with this is greatly appreciated The output of free -m when run on my server is as follows total used free shared buffers cached Mem: 1657 1380 277 0 158 773 -/+ buffers/cache: 447 1209 Swap: 895 0 895 In your opinion, does this look ok? At what stage would the OS give back memory, would it wait to the memory reaches 0% or is this OS dependent?

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Log Problem and bash script

  - by GvWorker

  Hello Guys, I have 11 Debian servers running on rackspace cloud hosting. All running VHCS2 for hosting management. 1 server is used for application and 10 are used for only smtp. My question is regarding smtp servers. Each server hosted 1 domain. My problem is when my client use smtp there's a log created in this directory /var/log/ but within 24 hours drives are full and server refuse all smtp connections. Then I deleted the logs and ran following command to check the disk space. df -h but it shows hdd still full and server is still refusing the smtp connections. Then I ran following command to see the truth du --max-depth=1 -h It shows the truth. The real disk space used. Then I rebooted the server and now server working fine. But after few hours same situation happened. Then I created the following script. #!/bin/sh rm -fr /var/log/* rm -fr /var/log/apache2/*.log rm -fr /var/log/apache2/*.log.* rm -fr /var/log/apache2/users/* rm -fr /var/log/apache2/backup/* reboot It worked for days but after that logs are again filling the hdd. Now I want the following solutions. If anybody can help me. When I delete files from server hdd will free up without rebooting Log should be in specific range. Like a specific size of file where old data overwrite with new data

  Read the article

• How do I get `set show-all-if-ambiguous on` in my .inputrc to play nice with the Python interpreter?

  - by ysim

  I noticed that after I added the set show-all-if-ambiguous on line to my ~/.inputrc, whenever I pressed tab to indent a block, it would show me the bash Display all ... possibilities? (y or n) prompt, and leave me unable to indent the actual code. Is there any way to keep that line in my .inputrc but still have the tab key work as expected in the Python interpreter? This is in my VirtualBox Ubuntu 12.04 VM, if it matters. EDIT: Curiously, I now have a different issue with the Python shell that comes with Django -- when I press tab, I get Python tab completion, but only with one Tab press. I've opened a separate question here for it.

  Read the article

• Hard Reset USB in Ubuntu 10.04

  - by Cory

  I have a USB device (a modem) that is really finicky. Sometimes it works fine, but other times it refuses to connect. The only solution I have found to fix it once it gets into a bad state is to physically unplug the device and plug it back in. However, I don't always have physical access to the machine it is plugged in on, so I'm looking for a way to do this through the command line. This post suggests running: $ sudo modprobe -w -r usb_storage; sudo modprobe usb_storage However I get an "unknown option -w" output. This slightly modified command: $ sudo modprobe -r usb_storage Fails with the message FATAL: Module usb_storage is in use. If I try to kill -9 the processes marked [usb-storage] before running they refuse to die (I think because they are deeply tied to the kernel). Anyone know of a way to do this? NOTE: I cross-posted this on serverfault as I didn't know which was more appropriate. I will delete and/or link whichever one is answered first.

  Read the article

< Previous Page | 534 535 536 537 538 539 540 541 542 543 544 545  | Next Page >