Search Results

Search found 14260 results on 571 pages for 'regex group'.

Page 542/571 | < Previous Page | 538 539 540 541 542 543 544 545 546 547 548 549  | Next Page >

  • uninitialized constant Active Scaffold rails 2.3.5

    - by Kiva
    Hi guy, I update my rails application 2.0.2 to 2.3.5. I use active scaffold for the administration part. I change nothing in my code but a problem is coming with the update. I have a controller 'admin/user_controller' to manage users. Here is the code of the controller: class Admin::UserController < ApplicationController layout 'admin' active_scaffold :user do |config| config.columns.exclude :content, :historique_content, :user_has_objet, :user_has_arme, :user_has_entrainement, :user_has_mission, :mp, :pvp, :user_salt, :tchat, :notoriete_by_pvp, :invitation config.list.columns = [:user_login, :user_niveau, :user_mail, :user_bloc, :user_valide, :group_id] #:user_description, :race, :group, :user_lastvisited, :user_nextaction, :user_combats_gagner, :user_combats_perdu, :user_combats_nul, :user_password, :user_salt, :user_combats, :user_experience, :user_mana, :user_vie config.create.link.page = true config.update.link.page = true config.create.columns.add :password, :password_confirmation config.update.columns.add :password, :password_confirmation config.create.columns.exclude :user_password, :user_salt config.update.columns.exclude :user_password, :user_salt config.list.sorting = {:user_login => 'ASC'} config.subform.columns = [] end end This code hasn't change with the update, but when I go in this page, I got this error: uninitialized constant Users /Users/Kiva/.gem/ruby/1.8/gems/activesupport-2.3.5/lib/active_support/dependencies.rb:443:in `load_missing_constant' /Users/Kiva/.gem/ruby/1.8/gems/activesupport-2.3.5/lib/active_support/dependencies.rb:80:in `const_missing' /Users/Kiva/.gem/ruby/1.8/gems/activesupport-2.3.5/lib/active_support/dependencies.rb:92:in `const_missing' /Users/Kiva/.gem/ruby/1.8/gems/activesupport-2.3.5/lib/active_support/inflector.rb:361:in `constantize' /Users/Kiva/.gem/ruby/1.8/gems/activesupport-2.3.5/lib/active_support/inflector.rb:360:in `each' /Users/Kiva/.gem/ruby/1.8/gems/activesupport-2.3.5/lib/active_support/inflector.rb:360:in `constantize' /Users/Kiva/.gem/ruby/1.8/gems/activesupport-2.3.5/lib/active_support/core_ext/string/inflections.rb:162:in `constantize' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/extensions/reverse_associations.rb:28:in `reverse_matches_for' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/extensions/reverse_associations.rb:24:in `each' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/extensions/reverse_associations.rb:24:in `reverse_matches_for' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/extensions/reverse_associations.rb:11:in `reverse' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/active_scaffold/data_structures/column.rb:117:in `autolink?' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/active_scaffold.rb:107:in `links_for_associations' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/active_scaffold/data_structures/columns.rb:62:in `each' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/active_scaffold/data_structures/columns.rb:62:in `each' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/active_scaffold.rb:106:in `links_for_associations' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/active_scaffold.rb:59:in `active_scaffold' /Users/Kiva/Documents/Projet-rpg/jeu/app/controllers/admin/user_controller.rb:11 I search since 2 days but I don't find the problem, can you help me please.

    Read the article

  • XSLT: Display unique rows of filtered XML recordset

    - by Chris G.
    I've got a recordset that I'm filtering on a particular field (i.e. Manager ="Frannklin"). Now I'd like to group the results of that filtered recordset based on another field (Client). I can't seem to get Muenchian grouping to work right. Any thoughts? TIA! CG My filter looks like this: <xsl:key name="k1" match="Row" use="@Manager"/> <xsl:param name="dvt_filterval">Frannklin</xsl:param> <xsl:variable name="Rows" select="/dsQueryResponse/Rows/Row" /> <xsl:variable name="FilteredRowsAttr" select="$Rows[normalize-space(@*[name()=$FieldNameNoAtSign])=$dvt_filterval ]" /> Templates <xsl:apply-templates select="$FilteredRowsAttr[generate-id() = generate-id(key('k1',@Manager))]" mode="g1000a"> </xsl:apply-templates> <xsl:template match="Row" mode="g1000a"> Client: <xsl:value-of select="@Client"/> </xsl:template> Results I'm getting Client: Beta Client: Beta Client: Beta Client: Gamma Client: Delta Results I want Client: Beta Client: Gamma Client: Delta Sample recordset <dsQueryResponse> <Rows> <Row Manager="Smith" Client="Alpha " Project_x0020_Name="Annapolis" PM_x0023_="00123" /> <Row Manager="Ford" Client="Alpha " Project_x0020_Name="Brown" PM_x0023_="00124" /> <Row Manager="Cronkite" Client="Beta " Project_x0020_Name="Gannon" PM_x0023_="00129" /> <Row Manager="Clinton, Bill" Client="Beta " Project_x0020_Name="Harvard" PM_x0023_="00130" /> <Row Manager="Frannklin" Client="Beta " Project_x0020_Name="Irving" PM_x0023_="00131" /> <Row Manager="Frannklin" Client="Beta " Project_x0020_Name="Jakarta" PM_x0023_="00132" /> <Row Manager="Frannklin" Client="Beta " Project_x0020_Name="Vassar" PM_x0023_="00135" /> <Row Manager="Jefferson" Client="Gamma " Project_x0020_Name="Stamford" PM_x0023_="00141" /> <Row Manager="Cronkite" Client="Gamma " Project_x0020_Name="Tufts" PM_x0023_="00142" /> <Row Manager="Frannklin" Client="Gamma " Project_x0020_Name="UCLA" PM_x0023_="00143" /> <Row Manager="Jefferson" Client="Gamma " Project_x0020_Name="Villanova" PM_x0023_="00144" /> <Row Manager="Carter" Client="Delta " Project_x0020_Name="Drexel" PM_x0023_="00150" /> <Row Manager="Clinton" Client="Delta " Project_x0020_Name="Iona" PM_x0023_="00151" /> <Row Manager="Frannklin" Client="Delta " Project_x0020_Name="Temple" PM_x0023_="00152" /> <Row Manager="Ford" Client="Epsilon " Project_x0020_Name="UNC" PM_x0023_="00157" /> <Row Manager="Clinton" Client="Epsilon " Project_x0020_Name="Berkley" PM_x0023_="00158" /> </Rows> </dsQueryResponse>

    Read the article

  • Using multiple aggregate functions in an algebraic expression in (ANSI) SQL statement

    - by morpheous
    I have the following aggregate functions (AGG FUNCs): foo(), foobar(), fredstats(), barneystats(). I want to know if I can use multiple AGG FUNCs in an algebraic expression. This may seem a strange/simplistic question for seasoned SQL developers - however, the but the reason I ask is that so far, all AGG FUNCs examples I have seen are of the simplistic variety e.g. max(salary) < 100, rather than using the AGG FUNCs in an expression which involves using multiple AGG FUNCs in an expression (like agg_func1() agg_func2()). The information below should help clarify further. Given tables with the following schemas: CREATE TABLE item (id int, length float, weight float); CREATE TABLE item_info (item_id, name varchar(32)); # Is it legal (ANSI) SQL to write queries of this format ? SELECT id, name, foo, foobar, fredstats FROM A, B (SELECT id, foo(123) as foo, foobar('red') as foobar, fredstats('weight') as fredstats FROM item GROUP BY id HAVING [ALGEBRAIC EXPRESSION] ORDER BY id AS A), item_info AS B WHERE item.id = B.id Where: ALGEBRAIC EXPRESSION is the type of expression that can be used in a WHERE clause - for example: ((foo(x) < foobar(y)) AND foobar(y) IN (1,2,3)) OR (fredstats(x) <> 0)) I am using PostgreSQL as the db, but I would prefer to use ANSI SQL wherever possible. Assuming it is legal to include AGG FUNCS in the way I have done above, I'd like to know: Is there a more efficient way to write the above query ? Is there any way I can speed up the query in terms of a judicious choice of indexes on the tables item and item_info ? Is there a performance hit of using AGG FUNCs in an algebraic expression like I am (i.e. an expression involving the output of aggregate functions rather than constants? Can the expression also include 'scaled' AGG FUNC? (for example: 2*foo(123) < -3*foobar(456) ) - will scaling (i.e. multiplying an AGG FUNC by a number have an effect on performance?) How can I write the query above using INNER JOINS instead?

    Read the article

  • What Can I Do To One Of My Team Number (Good Friend As Well) Who Lost His Passion.

    - by skyflyer
    It seems this question is not program related, but there are lot of similar questions. So please bear with me! By the way, I am programmer and my team is also charging a software project. And SO is the only place which solved me lot of thorny troubles!THANK YOU GUYS! I joined my company with him years ago. At that time he was quite passionate on his job which is a front-end development. He gave us lot of useful suggestions concerning his work like design. And I believed he was a smart guy. I believe he still is smart too by the way. One years later, however, he seemed lost his passion and fooling around every day, did not care about his work any more and produced poorwork. Even worse he literally stopped learning new skills and honing his work related skills. For me it is horrible, we got to keep abreast with new technology development, otherwise we will be throw out. Since we were just coworkers, I did not care about it too much except mentioned my thoughts several times. But last month, we resembled a new group and assigned very important project. And I am the team leader, sadly! My boss gave me lot of support and expectation as well. I did a pretty good job before and I am very optimism to our future. But as a team, if my team does not work hard, we will be doomed to failure no matter how hard I work and push. In order to revitalize his passion, I tried couple of ways like talking to him about my concern and my boss's angry. I offered his new task which is quite new to him. I even persuaded my boss to give him new incentive package. But all of them knocked wall. His reaction was just he did not care. Even worse he did not want to talk about his situation. I want to be hard on him, but since we are friends and coworkers, I really can not see it will work. Even it works, I can not so quickly change my self from friend and coworker into manager. As a novice in management, I am really overwhelmed! I do not want get him fired, we are friends and I do not see him fired as my team number. What can I do? Thank you guys!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • how to get latest entry from a table for an item and do arithmatic operation on it?

    - by I Like PHP
    i have below tables tbl_rcv_items st_id | item_id |stock_opening_qnty |stock_received_qnty |stock_rcvd_date 14 1 0 70 2010-05-18 15 16 0 100 2010-05-06 16 10 0 59 2010-05-20 17 14 0 34 2010-05-20 20 1 70 5 2010-05-12 tbl_issu_items issue_id refer_issue_id item_id item_qntt item_updated 51 1 1 5 2010-05-18 19:34:29 52 1 16 6 2010-05-18 19:34:29 53 1 10 7 2010-05-18 19:34:29 54 1 14 8 2010-05-18 19:34:29 75 7 1 12 2010-05-18 19:40:52 76 7 16 1 2010-05-18 19:40:52 77 7 10 1 2010-05-18 19:40:52 78 7 14 1 2010-05-18 19:40:52 79 8 1 3 2010-05-19 11:28:50 80 8 16 5 2010-05-19 11:28:50 81 8 10 6 2010-05-19 11:28:50 82 8 14 7 2010-05-19 11:28:51 87 10 1 2 2010-05-19 12:51:03 88 10 16 0 2010-05-19 12:51:03 89 10 10 0 2010-05-19 12:51:03 90 10 14 0 2010-05-19 12:51:03 91 14 1 1 2010-05-19 18:43:58 92 14 14 3 2010-05-19 18:43:58 tbl_item_detail item_id item_name 1 shirt 2 belt 10 ball pen 14 vim powder 16 pant NOW if i want total available quantity for each item till today using both table total available quantity for an item =stock_opening_qnty+stock_received_qnty(LATEST ENTRY FROM (tbl_rcv_item) for that item id according to stock_rcvd_date) - SUM(item_qntt) for eg: if i want to know the available quantity for item_id=1 till today(25-05-2010) then it shoud be 70+5(latest entry for item_id till 25/5/2010)-23( issued till 25/5/2010)=52 i write below query , SELECT tri.item_id, tid.item_name, (tri.stock_opening_qnty + tri.stock_received_qnty) AS totalRcvQntt, SUM( tii.item_qntt ) AS totalIsudQntt FROM tbl_rcv_items tri JOIN tbl_issu_items tii ON tii.item_id = tri.item_id JOIN tbl_item_detail tid ON tid.item_id=tri.item_id WHERE tri.stock_rcvd_date <= CURDATE() GROUP BY (tri.item_id) which results Array ( [0] => Array ( [item_id] => 1 [item_name] => shirt [totalRcvQntt] => 70 [totalIsudQntt] => 46 ) [1] => Array ( [item_id] => 10 [item_name] => ball pen [totalRcvQntt] => 59 [totalIsudQntt] => 16 ) [2] => Array ( [item_id] => 14 [item_name] => vim powder [totalRcvQntt] => 34 [totalIsudQntt] => 20 ) [3] => Array ( [item_id] => 16 [item_name] => pant [totalRcvQntt] => 100 [totalIsudQntt] => 17 ) ) in above result total isuse quantity for shirt(item_id=1) shoube be 23 whereas results reflects 46 bcoz there are two row regrading item_id=1 in tbl_rcv_items, i only need the latest one(means which stock_rcvd_date is less than tommorow) please tell me where i doing mistake?? or rewrite the best query. thanks a lot!

    Read the article

  • Can't find method in the activity

    - by Synesso
    I'm starting with Scala + Android. I'm trying to wire a button action to a button without the activity implementing View.OnClickListener. The button click fails at runtime because the method cannot be found. The document I'm working through says that I need only declare a public void method taking a View on the action, and use that method name in the layout. What have I done wrong? MainActivity.scala package net.badgerhunt.hwa import android.app.Activity import android.os.Bundle import android.widget.Button import android.view.View import java.util.Date class MainActivity extends Activity { override def onCreate(savedInstanceState: Bundle) = { super.onCreate(savedInstanceState) setContentView(R.layout.main) } def calculate(button: View): Unit = println("calculating with %s ...".format(button)) } res/layout/main.xml <?xml version="1.0" encoding="utf-8"?> <Button xmlns:android="http://schemas.android.com/apk/res/android" android:id="@+id/button" android:text="" android:onClick="calculate" android:layout_width="fill_parent" android:layout_height="fill_parent"/> the failure onclick D/AndroidRuntime( 362): Shutting down VM W/dalvikvm( 362): threadid=3: thread exiting with uncaught exception (group=0x4001b188) E/AndroidRuntime( 362): Uncaught handler: thread main exiting due to uncaught exception E/AndroidRuntime( 362): java.lang.IllegalStateException: Could not find a method calculate(View) in the activity E/AndroidRuntime( 362): at android.view.View$1.onClick(View.java:2020) E/AndroidRuntime( 362): at android.view.View.performClick(View.java:2364) E/AndroidRuntime( 362): at android.view.View.onTouchEvent(View.java:4179) E/AndroidRuntime( 362): at android.widget.TextView.onTouchEvent(TextView.java:6540) E/AndroidRuntime( 362): at android.view.View.dispatchTouchEvent(View.java:3709) E/AndroidRuntime( 362): at android.view.ViewGroup.dispatchTouchEvent(ViewGroup.java:884) E/AndroidRuntime( 362): at android.view.ViewGroup.dispatchTouchEvent(ViewGroup.java:884) E/AndroidRuntime( 362): at android.view.ViewGroup.dispatchTouchEvent(ViewGroup.java:884) E/AndroidRuntime( 362): at com.android.internal.policy.impl.PhoneWindow$DecorView.superDispatchTouchEvent(PhoneWindow.java:1659) E/AndroidRuntime( 362): at com.android.internal.policy.impl.PhoneWindow.superDispatchTouchEvent(PhoneWindow.java:1107) E/AndroidRuntime( 362): at android.app.Activity.dispatchTouchEvent(Activity.java:2061) E/AndroidRuntime( 362): at com.android.internal.policy.impl.PhoneWindow$DecorView.dispatchTouchEvent(PhoneWindow.java:1643) E/AndroidRuntime( 362): at android.view.ViewRoot.handleMessage(ViewRoot.java:1691) E/AndroidRuntime( 362): at android.os.Handler.dispatchMessage(Handler.java:99) E/AndroidRuntime( 362): at android.os.Looper.loop(Looper.java:123) E/AndroidRuntime( 362): at android.app.ActivityThread.main(ActivityThread.java:4363) E/AndroidRuntime( 362): at java.lang.reflect.Method.invokeNative(Native Method) E/AndroidRuntime( 362): at java.lang.reflect.Method.invoke(Method.java:521) E/AndroidRuntime( 362): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) E/AndroidRuntime( 362): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) E/AndroidRuntime( 362): at dalvik.system.NativeStart.main(Native Method) E/AndroidRuntime( 362): Caused by: java.lang.NoSuchMethodException: calculate E/AndroidRuntime( 362): at java.lang.ClassCache.findMethodByName(ClassCache.java:308) E/AndroidRuntime( 362): at java.lang.Class.getMethod(Class.java:1014) E/AndroidRuntime( 362): at android.view.View$1.onClick(View.java:2017) E/AndroidRuntime( 362): ... 20 more

    Read the article

  • Report Builder Error (Input string was not in a correct format) when filtering data

    - by JVZ
    Issue: the user is getting an error “The requested list could not be retrieved because the query is not valid or a connection could not be made to the data source.” while trying to filter a reporting using Report Builder 2.0. When you expand the details the message is “Input string was not in a correct format” I verified that when the user clicks to see the filter values the query is being sent to the underlying database (by using profiler). When I build the same report [I'm a server admin] I have no issues and see all the filtered values, which leads me to believe this is a permissions issue. I believe I granted all the correct permissions, see below: Report Server Setup [Project Name] Data Sources Models […other folders] We are using SQL Server 2005. The user belongs to a poweruser domain group which has the following permissions: Home Report Builder View Folders Browser Home/[Project Name] Browser Report Builder View Folders [Data Sources] Browser Content Developer [Models] [Inherit roles from Parent folder] << should be same as [Project Name] folder Report server log is showing the following: w3wp!library!5!04/21/2010-08:47:27:: Call to GetPermissionsAction(/). w3wp!library!a!04/21/2010-08:47:27:: Call to GetPropertiesAction(/, PathBased). w3wp!library!5!04/21/2010-08:47:27:: Call to GetSystemPermissionsAction(). w3wp!library!a!04/21/2010-08:47:27:: Call to ListChildrenAction(/, False). w3wp!library!a!04/21/2010-08:47:27:: Call to GetSystemPropertiesAction(). w3wp!library!a!04/21/2010-08:47:27:: Call to GetSystemPropertiesAction(). w3wp!library!9!04/21/2010-08:47:40:: Call to ListModelPerspectivesAction(). w3wp!library!9!04/21/2010-08:48:22:: Call to GetUserModelAction(//Models/, ). w3wp!library!5!04/21/2010-08:48:45:: Call to GetItemTypeAction(/). w3wp!library!9!04/21/2010-08:48:46:: Call to GetItemTypeAction(/). w3wp!library!5!04/21/2010-08:48:53:: Call to GetItemTypeAction(/). w3wp!library!a!04/21/2010-08:49:21:: Call to ListModelPerspectivesAction(). w3wp!library!b!04/21/2010-08:53:40:: Call to GetUserModelAction(//Models/, ). w3wp!library!5!04/21/2010-08:54:48:: i INFO: Call to RenderFirst( '' ) w3wp!webserver!5!04/21/2010-08:54:48:: i INFO: Processed report. Report='/', Stream='' w3wp!library!9!04/21/2010-08:56:42:: Call to GetItemTypeAction(/). w3wp!library!9!04/21/2010-08:56:42:: Call to GetItemTypeAction(/). w3wp!library!a!04/21/2010-08:56:50:: Call to GetItemTypeAction(/). Any ideas on how to resolve/troubleshoot this issue?

    Read the article

  • php split array into smaller even arrays

    - by SoulieBaby
    I have a function that is supposed to split my array into smaller, evenly distributed arrays, however it seems to be duplicating my data along the way. If anyone can help me out that'd be great. Here's the original array: Array ( [0] => stdClass Object ( [bid] => 42 [name] => Ray White Mordialloc [imageurl] => sp_raywhite.gif [clickurl] => http://www.raywhite.com/ ) [1] => stdClass Object ( [bid] => 48 [name] => Beachside Osteo [imageurl] => sp_beachside.gif [clickurl] => http://www.beachsideosteo.com.au/ ) [2] => stdClass Object ( [bid] => 53 [name] => Carmotive [imageurl] => sp_carmotive.jpg [clickurl] => http://www.carmotive.com.au/ ) [3] => stdClass Object ( [bid] => 51 [name] => Richmond and Bennison [imageurl] => sp_richmond.jpg [clickurl] => http://www.richbenn.com.au/ ) [4] => stdClass Object ( [bid] => 50 [name] => Letec [imageurl] => sp_letec.jpg [clickurl] => www.letec.biz ) [5] => stdClass Object ( [bid] => 39 [name] => Main Street Mordialloc [imageurl] => main street cafe.jpg [clickurl] => ) [6] => stdClass Object ( [bid] => 40 [name] => Ripponlea Mitsubishi [imageurl] => sp_mitsubishi.gif [clickurl] => ) [7] => stdClass Object ( [bid] => 34 [name] => Adrianos Pizza & Pasta [imageurl] => sp_adrian.gif [clickurl] => ) [8] => stdClass Object ( [bid] => 59 [name] => Pure Sport [imageurl] => sp_psport.jpg [clickurl] => http://www.puresport.com.au/ ) [9] => stdClass Object ( [bid] => 33 [name] => Two Brothers [imageurl] => sp_2brothers.gif [clickurl] => http://www.2brothers.com.au/ ) [10] => stdClass Object ( [bid] => 52 [name] => Mordialloc Travel and Cruise [imageurl] => sp_morditravel.jpg [clickurl] => http://www.yellowpages.com.au/vic/mordialloc/mordialloc-travel-cruise-13492525-listing.html ) [11] => stdClass Object ( [bid] => 57 [name] => Southern Suburbs Physiotherapy Centre [imageurl] => sp_sspc.jpg [clickurl] => http://www.sspc.com.au ) [12] => stdClass Object ( [bid] => 54 [name] => PPM Builders [imageurl] => sp_ppm.jpg [clickurl] => http://www.hotfrog.com.au/Companies/P-P-M-Builders ) [13] => stdClass Object ( [bid] => 36 [name] => Big River [imageurl] => sp_bigriver.gif [clickurl] => ) [14] => stdClass Object ( [bid] => 35 [name] => Bendigo Bank Parkdale / Mentone East [imageurl] => sp_bendigo.gif [clickurl] => http://www.bendigobank.com.au ) [15] => stdClass Object ( [bid] => 56 [name] => Logical Services [imageurl] => sp_logical.jpg [clickurl] => ) [16] => stdClass Object ( [bid] => 58 [name] => Dicount Lollie Shop [imageurl] => new dls logo.jpg [clickurl] => ) [17] => stdClass Object ( [bid] => 46 [name] => Patterson Securities [imageurl] => cmyk patersons_withtag.jpg [clickurl] => ) [18] => stdClass Object ( [bid] => 44 [name] => Mordialloc Personal Trainers [imageurl] => sp_mordipt.gif [clickurl] => # ) [19] => stdClass Object ( [bid] => 37 [name] => Mordialloc Cellar Door [imageurl] => sp_cellardoor.gif [clickurl] => ) [20] => stdClass Object ( [bid] => 41 [name] => Print House Graphics [imageurl] => sp_printhouse.gif [clickurl] => ) [21] => stdClass Object ( [bid] => 55 [name] => 360South [imageurl] => sp_360.jpg [clickurl] => ) [22] => stdClass Object ( [bid] => 43 [name] => Systema [imageurl] => sp_systema.gif [clickurl] => ) [23] => stdClass Object ( [bid] => 38 [name] => Lowe Financial Group [imageurl] => sp_lowe.gif [clickurl] => http://lowefinancial.com/ ) [24] => stdClass Object ( [bid] => 49 [name] => Kim Reed Conveyancing [imageurl] => sp_kimreed.jpg [clickurl] => ) [25] => stdClass Object ( [bid] => 45 [name] => Mordialloc Sporting Club [imageurl] => msc logo.jpg [clickurl] => ) ) Here's the php function which is meant to split the array: function split_array($array, $slices) { $perGroup = floor(count($array) / $slices); $Remainder = count($array) % $slices ; $slicesArray = array(); $i = 0; while( $i < $slices ) { $slicesArray[$i] = array_slice($array, $i * $perGroup, $perGroup); $i++; } if ( $i == $slices ) { if ($Remainder > 0 && $Remainder < $slices) { $z = $i * $perGroup +1; $x = 0; while ($x < $Remainder) { $slicesRemainderArray = array_slice($array, $z, $Remainder+$x); $remainderItems = array_merge($slicesArray[$x],$slicesRemainderArray); $slicesArray[$x] = $remainderItems; $x++; $z++; } } }; return $slicesArray; } Here's the result of the split (it somehow duplicates items from the original array into the smaller arrays): Array ( [0] => Array ( [0] => stdClass Object ( [bid] => 57 [name] => Southern Suburbs Physiotherapy Centre [imageurl] => sp_sspc.jpg [clickurl] => http://www.sspc.com.au ) [1] => stdClass Object ( [bid] => 35 [name] => Bendigo Bank Parkdale / Mentone East [imageurl] => sp_bendigo.gif [clickurl] => http://www.bendigobank.com.au ) [2] => stdClass Object ( [bid] => 38 [name] => Lowe Financial Group [imageurl] => sp_lowe.gif [clickurl] => http://lowefinancial.com/ ) [3] => stdClass Object ( [bid] => 39 [name] => Main Street Mordialloc [imageurl] => main street cafe.jpg [clickurl] => ) [4] => stdClass Object ( [bid] => 48 [name] => Beachside Osteo [imageurl] => sp_beachside.gif [clickurl] => http://www.beachsideosteo.com.au/ ) [5] => stdClass Object ( [bid] => 33 [name] => Two Brothers [imageurl] => sp_2brothers.gif [clickurl] => http://www.2brothers.com.au/ ) [6] => stdClass Object ( [bid] => 40 [name] => Ripponlea Mitsubishi [imageurl] => sp_mitsubishi.gif [clickurl] => ) ) [1] => Array ( [0] => stdClass Object ( [bid] => 44 [name] => Mordialloc Personal Trainers [imageurl] => sp_mordipt.gif [clickurl] => # ) [1] => stdClass Object ( [bid] => 41 [name] => Print House Graphics [imageurl] => sp_printhouse.gif [clickurl] => ) [2] => stdClass Object ( [bid] => 39 [name] => Main Street Mordialloc [imageurl] => main street cafe.jpg [clickurl] => ) [3] => stdClass Object ( [bid] => 48 [name] => Beachside Osteo [imageurl] => sp_beachside.gif [clickurl] => http://www.beachsideosteo.com.au/ ) [4] => stdClass Object ( [bid] => 33 [name] => Two Brothers [imageurl] => sp_2brothers.gif [clickurl] => http://www.2brothers.com.au/ ) [5] => stdClass Object ( [bid] => 40 [name] => Ripponlea Mitsubishi [imageurl] => sp_mitsubishi.gif [clickurl] => ) ) [2] => Array ( [0] => stdClass Object ( [bid] => 56 [name] => Logical Services [imageurl] => sp_logical.jpg [clickurl] => ) [1] => stdClass Object ( [bid] => 43 [name] => Systema [imageurl] => sp_systema.gif [clickurl] => ) [2] => stdClass Object ( [bid] => 48 [name] => Beachside Osteo [imageurl] => sp_beachside.gif [clickurl] => http://www.beachsideosteo.com.au/ ) [3] => stdClass Object ( [bid] => 33 [name] => Two Brothers [imageurl] => sp_2brothers.gif [clickurl] => http://www.2brothers.com.au/ ) [4] => stdClass Object ( [bid] => 40 [name] => Ripponlea Mitsubishi [imageurl] => sp_mitsubishi.gif [clickurl] => ) ) [3] => Array ( [0] => stdClass Object ( [bid] => 53 [name] => Carmotive [imageurl] => sp_carmotive.jpg [clickurl] => http://www.carmotive.com.au/ ) [1] => stdClass Object ( [bid] => 45 [name] => Mordialloc Sporting Club [imageurl] => msc logo.jpg [clickurl] => ) [2] => stdClass Object ( [bid] => 33 [name] => Two Brothers [imageurl] => sp_2brothers.gif [clickurl] => http://www.2brothers.com.au/ ) [3] => stdClass Object ( [bid] => 40 [name] => Ripponlea Mitsubishi [imageurl] => sp_mitsubishi.gif [clickurl] => ) ) [4] => Array ( [0] => stdClass Object ( [bid] => 59 [name] => Pure Sport [imageurl] => sp_psport.jpg [clickurl] => http://www.puresport.com.au/ ) [1] => stdClass Object ( [bid] => 54 [name] => PPM Builders [imageurl] => sp_ppm.jpg [clickurl] => http://www.hotfrog.com.au/Companies/P-P-M-Builders ) [2] => stdClass Object ( [bid] => 40 [name] => Ripponlea Mitsubishi [imageurl] => sp_mitsubishi.gif [clickurl] => ) ) [5] => Array ( [0] => stdClass Object ( [bid] => 46 [name] => Patterson Securities [imageurl] => cmyk patersons_withtag.jpg [clickurl] => ) [1] => stdClass Object ( [bid] => 34 [name] => Adriano's Pizza & Pasta [imageurl] => sp_adrian.gif [clickurl] => # ) ) [6] => Array ( [0] => stdClass Object ( [bid] => 55 [name] => 360South [imageurl] => sp_360.jpg [clickurl] => ) [1] => stdClass Object ( [bid] => 37 [name] => Mordialloc Cellar Door [imageurl] => sp_cellardoor.gif [clickurl] => ) ) [7] => Array ( [0] => stdClass Object ( [bid] => 49 [name] => Kim Reed Conveyancing [imageurl] => sp_kimreed.jpg [clickurl] => ) [1] => stdClass Object ( [bid] => 58 [name] => Dicount Lollie Shop [imageurl] => new dls logo.jpg [clickurl] => ) ) [8] => Array ( [0] => stdClass Object ( [bid] => 51 [name] => Richmond and Bennison [imageurl] => sp_richmond.jpg [clickurl] => http://www.richbenn.com.au/ ) [1] => stdClass Object ( [bid] => 52 [name] => Mordialloc Travel and Cruise [imageurl] => sp_morditravel.jpg [clickurl] => http://www.yellowpages.com.au/vic/mordialloc/mordialloc-travel-cruise-13492525-listing.html ) ) [9] => Array ( [0] => stdClass Object ( [bid] => 50 [name] => Letec [imageurl] => sp_letec.jpg [clickurl] => www.letec.biz ) [1] => stdClass Object ( [bid] => 36 [name] => Big River [imageurl] => sp_bigriver.gif [clickurl] => ) ) ) ^^ As you can see there are duplicates from the original array in the newly created smaller arrays. I thought I could remove the duplicates using a multi-dimensional remove duplicate function but that didn't work. I'm guessing my problem is in the array_split function. Any suggestions? :)

    Read the article

  • Optimize date query for large child tables: GiST or GIN?

    - by Dave Jarvis
    Problem 72 child tables, each having a year index and a station index, are defined as follows: CREATE TABLE climate.measurement_12_013 ( -- Inherited from table climate.measurement_12_013: id bigint NOT NULL DEFAULT nextval('climate.measurement_id_seq'::regclass), -- Inherited from table climate.measurement_12_013: station_id integer NOT NULL, -- Inherited from table climate.measurement_12_013: taken date NOT NULL, -- Inherited from table climate.measurement_12_013: amount numeric(8,2) NOT NULL, -- Inherited from table climate.measurement_12_013: category_id smallint NOT NULL, -- Inherited from table climate.measurement_12_013: flag character varying(1) NOT NULL DEFAULT ' '::character varying, CONSTRAINT measurement_12_013_category_id_check CHECK (category_id = 7), CONSTRAINT measurement_12_013_taken_check CHECK (date_part('month'::text, taken)::integer = 12) ) INHERITS (climate.measurement) CREATE INDEX measurement_12_013_s_idx ON climate.measurement_12_013 USING btree (station_id); CREATE INDEX measurement_12_013_y_idx ON climate.measurement_12_013 USING btree (date_part('year'::text, taken)); (Foreign key constraints to be added later.) The following query runs abysmally slow due to a full table scan: SELECT count(1) AS measurements, avg(m.amount) AS amount FROM climate.measurement m WHERE m.station_id IN ( SELECT s.id FROM climate.station s, climate.city c WHERE -- For one city ... -- c.id = 5182 AND -- Where stations are within an elevation range ... -- s.elevation BETWEEN 0 AND 3000 AND 6371.009 * SQRT( POW(RADIANS(c.latitude_decimal - s.latitude_decimal), 2) + (COS(RADIANS(c.latitude_decimal + s.latitude_decimal) / 2) * POW(RADIANS(c.longitude_decimal - s.longitude_decimal), 2)) ) <= 50 ) AND -- -- Begin extracting the data from the database. -- -- The data before 1900 is shaky; insufficient after 2009. -- extract( YEAR FROM m.taken ) BETWEEN 1900 AND 2009 AND -- Whittled down by category ... -- m.category_id = 1 AND m.taken BETWEEN -- Start date. (extract( YEAR FROM m.taken )||'-01-01')::date AND -- End date. Calculated by checking to see if the end date wraps -- into the next year. If it does, then add 1 to the current year. -- (cast(extract( YEAR FROM m.taken ) + greatest( -1 * sign( (extract( YEAR FROM m.taken )||'-12-31')::date - (extract( YEAR FROM m.taken )||'-01-01')::date ), 0 ) AS text)||'-12-31')::date GROUP BY extract( YEAR FROM m.taken ) The sluggishness comes from this part of the query: m.taken BETWEEN /* Start date. */ (extract( YEAR FROM m.taken )||'-01-01')::date AND /* End date. Calculated by checking to see if the end date wraps into the next year. If it does, then add 1 to the current year. */ (cast(extract( YEAR FROM m.taken ) + greatest( -1 * sign( (extract( YEAR FROM m.taken )||'-12-31')::date - (extract( YEAR FROM m.taken )||'-01-01')::date ), 0 ) AS text)||'-12-31')::date The HashAggregate from the plan shows a cost of 10006220141.11, which is, I suspect, on the astronomically huge side. There is a full table scan on the measurement table (itself having neither data nor indexes) being performed. The table aggregates 237 million rows from its child tables. Question What is the proper way to index the dates to avoid full table scans? Options I have considered: GIN GiST Rewrite the WHERE clause Separate year_taken, month_taken, and day_taken columns to the tables What are your thoughts? Thank you!

    Read the article

  • Django Multi-Table Inheritance VS Specifying Explicit OneToOne Relationship in Models

    - by chefsmart
    Hope all this makes sense :) I'll clarify via comments if necessary. Also, I am experimenting using bold text in this question, and will edit it out if I (or you) find it distracting. With that out of the way... Using django.contrib.auth gives us User and Group, among other useful things that I can't do without (like basic messaging). In my app I have several different types of users. A user can be of only one type. That would easily be handled by groups, with a little extra care. However, these different users are related to each other in hierarchies / relationships. Let's take a look at these users: - Principals - "top level" users Administrators - each administrator reports to a Principal Coordinators - each coordinator reports to an Administrator Apart from these there are other user types that are not directly related, but may get related later on. For example, "Company" is another type of user, and can have various "Products", and products may be supervised by a "Coordinator". "Buyer" is another kind of user that may buy products. Now all these users have various other attributes, some of which are common to all types of users and some of which are distinct only to one user type. For example, all types of users have to have an address. On the other hand, only the Principal user belongs to a "BranchOffice". Another point, which was stated above, is that a User can only ever be of one type. The app also needs to keep track of who created and/or modified Principals, Administrators, Coordinators, Companies, Products etc. (So that's two more links to the User model.) In this scenario, is it a good idea to use Django's multi-table inheritance as follows: - from django.contrib.auth.models import User class Principal(User): # # # branchoffice = models.ForeignKey(BranchOffice) landline = models.CharField(blank=True, max_length=20) mobile = models.CharField(blank=True, max_length=20) created_by = models.ForeignKey(User, editable=False, blank=True, related_name="principalcreator") modified_by = models.ForeignKey(User, editable=False, blank=True, related_name="principalmodifier") # # # Or should I go about doing it like this: - class Principal(models.Model): # # # user = models.OneToOneField(User, blank=True) branchoffice = models.ForeignKey(BranchOffice) landline = models.CharField(blank=True, max_length=20) mobile = models.CharField(blank=True, max_length=20) created_by = models.ForeignKey(User, editable=False, blank=True, related_name="principalcreator") modified_by = models.ForeignKey(User, editable=False, blank=True, related_name="principalmodifier") # # # Please keep in mind that there are other user types that are related via foreign keys, for example: - class Administrator(models.Model): # # # principal = models.ForeignKey(Principal, help_text="The supervising principal for this Administrator") user = models.OneToOneField(User, blank=True) province = models.ForeignKey( Province) landline = models.CharField(blank=True, max_length=20) mobile = models.CharField(blank=True, max_length=20) created_by = models.ForeignKey(User, editable=False, blank=True, related_name="administratorcreator") modified_by = models.ForeignKey(User, editable=False, blank=True, related_name="administratormodifier") I am aware that Django does use a one-to-one relationship for multi-table inheritance behind the scenes. I am just not qualified enough to decide which is a more sound approach.

    Read the article

  • Ignore order of elements using xs:extension

    - by Peter Lang
    How can I design my xsd to ignore the sequence of elements? <root> <a/> <b/> </root> <root> <b/> <a/> </root> I need to use extension for code generation reasons, so I tried the following using all: <?xml version="1.0" encoding="UTF-8"?> <xs:schema targetNamespace="http://www.example.com/test" xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns:t="http://www.example.com/test" > <xs:complexType name="BaseType"> <xs:all> <xs:element name="a" type="xs:string" /> </xs:all> </xs:complexType> <xs:complexType name="ExtendedType"> <xs:complexContent> <xs:extension base="t:BaseType"> <xs:all> <!-- ERROR --> <xs:element name="b" type="xs:string" /> </xs:all> </xs:extension> </xs:complexContent> </xs:complexType> <xs:element name="root" type="t:ExtendedType"></xs:element> </xs:schema> This xsd is not valid though, the following error is reported at <!-- ERROR -->: cos-all-limited.1.2: An all model group must appear in a particle with {min occurs} = {max occurs} = 1, and that particle must be part of a pair which constitutes the {content type} of a complex type definition. Documentation of cos-all-limited.1.2 says: 1.2 the {term} property of a particle with {max occurs}=1 which is part of a pair which constitutes the {content type} of a complex type definition. I don't really understand this (neither xsd nor English native speaker :) ). Am I doing the wrong thing, am I doing the right thing wrong, or is there no way to achieve this? Thanks!

    Read the article

  • c#: Design advice. Using DataTable or List<MyObject> for a generic rule checker

    - by Andrew White
    Hi, I have about 100,000 lines of generic data. Columns/Properties of this data are user definable and are of the usual data types (string, int, double, date). There will be about 50 columns/properties. I have 2 needs: To be able to calculate new columns/properties using an expression e.g. Column3 = Column1 * Column2. Ultimately I would like to be able to use external data using a callback, e.g. Column3 = Column1 * GetTemperature The expression is relatively simple, maths operations, sum, count & IF are the only necessary functions. To be able to filter/group the data and perform aggregations e.g. Sum(Data.Column1) Where(Data.Column2 == "blah") As far as I can see I have two options: 1. Using a DataTable. = Point 1 above is achieved by using DataColumn.Expression = Point 2 above is acheived by using DataTable.DefaultView.RowFilter & C# code 2. Using a List of generic Objects each with a Dictionary< string, object to store the values. = Point 1 could be achieved by something like NCalc = Point 2 is achieved using LINQ DataTable: Pros: DataColumn.Expression is inbuilt Cons: RowFilter & coding c# is not as "nice" as LINQ, DataColumn.Expression does not support callbacks(?) = workaround could be to get & replace external value when creating the calculated column GenericList: Pros: LINQ syntax, NCalc supports callbacks Cons: Implementing NCalc/generic calc engine Based on the above I would think a GenericList approach would win, but something I have not factored in is the performance which for some reason I think would be better with a datatable. Does anyone have a gut feeling / experience with LINQ vs. DataTable performance? How about NCalc? As I said there are about 100,000 rows of data, with 50 columns, of which maybe 20 are calculated. In total about 50 rules will be run against the data, so in total there will be 5 million row/object scans. Would really appreciate any insights. Thx. ps. Of course using a database + SQL & Views etc. would be the easiest solution, but for various reasons can't be implemented.

    Read the article

  • Expression Too Complex In Access 2007

    - by Jazzepi
    When I try to run this query in Access through the ODBC interface into a MySQL database I get an "Expression too complex in query expression" error. The essential thing I'm trying to do is translate abbreviated names of languages into their full body English counterparts. I was curious if there was some way to "trick" access into thinking the expression is smaller with sub queries, or if someone else had a better idea of how to solve this problem. I thought about making a temporary table and doing a join on it, but that's not supported in Access SQL. Just as an FYI, the query worked fine until I added the big long IFF chain. I tested the query on a smaller IFF chain for three languages, and that wasn't an issue, so the problem definitely stems from the huge IFF chain (It's 26 deep). Also, I might be able to drop some of the options (like combining the different forms of Chinese or Portuguese) As a test, I was able to get the SQL query to work after paring it down to 14 IFF() statements, but that's a far cry from the 26 languages I'd like to represent. SELECT TOP 5 Count( * ) AS [Number of visits by language], IIf(login.lang="ar","Arabic",IIf(login.lang="bg","Bulgarian",IIf(login.lang="zh_CN","Chinese (Simplified Han)",IIf(login.lang="zh_TW","Chinese (Traditional Han)",IIf(login.lang="cs","Czech",IIf(login.lang="da","Danish",IIf(login.lang="de","German",IIf(login.lang="en_US","United States English",IIf(login.lang="en_GB","British English",IIf(login.lang="es","Spanish",IIf(login.lang="fr","French",IIf(login.lang="el","Greek",IIf(login.lang="it","Italian",IIf(login.lang="ko","Korean",IIf(login.lang="hu","Hungarian",IIf(login.lang="nl","Dutch",IIf(login.lang="pl","Polish",IIf(login.lang="pt_PT","European Portuguese",IIf(login.lang="pt_BR","Brazilian Portuguese",IIf(login.lang="ru","Russian",IIf(login.lang="sk","Slovak",IIf(login.lang="sl","Slovenian","IIf(login.lang="fi","Finnish",IIf(login.lang="sv","Swedish",IIf(login.lang="tr","Turkish","Unknown")))))))))))))))))))))))))) AS [Language] FROM login, reservations, reservation_users, schedules WHERE (reservations.start_date Between DATEDIFF('s','1970-01-01 00:00:00',[Starting Date in the Following Format YYYY/MM/DD]) And DATEDIFF('s','1970-01-01 00:00:00',[Ending Date in the Following Format YYYY/MM/DD])) And reservations.is_blackout=0 And reservation_users.memberid=login.memberid And reservation_users.resid=reservations.resid And reservation_users.invited=0 And reservations.scheduleid=schedules.scheduleid And scheduletitle=[Schedule Title] GROUP BY login.lang ORDER BY Count( * ) DESC; @ Michael Todd I completely agree. The list of languages should have been a table in the database and the login.lang should have been a FK into that table. Unfortunately this isn't how the database was written, and it's not really mine to modify. The languages are placed into the login.lang field by the PHP running on top of the database.

    Read the article

  • Need help iteratating over an array, retrieve two possibilites, no repeats, for Poker AI

    - by elguapo-85
    Can't really think of a good way to word this question, nor a good title, and maybe the answer is so ridiculously simple that I am missing it. I am working on a poker AI, and I want to calculate the number of hands that exist which are better then mine, I understand how to that, but want I can't figure out is the best way to iterate over a group of cards. So I am at the flop, I know what my two cards are and there are 3 cards on the board. So there are 47 unknown cards and I want to iterate over all possible combination of those 47 cards assuming that two are passed out, so you can't have two cards of the same rank and suit, and you if you have previously calculated a set you don't want to do it over again, because I will being wasting time, and this will be called many times. If you don't understand want I am asking please tell me and I will clarify more. So I can set something up like this, if that element equals one, it means it is not in my hand and not on the board, 4 for each suit, and 13 for each rank. setOfCards[4][13] If I do a simple set of for loops like this: (pseudocode) //remove cards I know are in play from setOfCards by setting values to zero for(int i = 0; i < 4; i++) for(int j = 0; j < 13; j++) for(int k = 0; k < 4; k++) for(int l = 0; l < 4; l++) //skip if values equal zero card1 = setOfCards[i][j] card2 = setOfCards[k][l] //now compare card1, card2 and set of board cards So this is actually going to repeat many values, for example: card1 = AceOfHearts, card2 = KingOfHearts is the same as card1 = KingOfHearts, card2 = AceOfHearts. It will also alter my calculations. How should I go about avoiding this? Also is there a name for this technique? Thank you.

    Read the article

  • transforming binary data using ssis and sql server 2008

    - by Rick
    Hello All - I have a task to import/transform and extract zipped binary files that contain both text data as well as embeded binary data. Within the data is data that is relational in nature and needs to be processed into a defined database structure. Currently I have a C# single threaded app that essentially grabs all the files from the directory (currently there is 13K files of varying sizes) and extracts the data on a single thread line by line inserts to the database. As you could imagine this is a very slow process and unacceptable. There are several different parsing routines used depending on the header record in the file. There are potentially upto a million rows per file when all the data is extracted to the row level of detail. Follow on task is to parse those rows into their appropriate tables based on is content. i.e. the textual content has to be parsed further into "buckets" of like data in the database. That about sums up the big picture. Now for the problem task list. How do i iterate through a packet of data using SSIS? In the app the file is decompressed and then is parsed using streams data type and byte arrays and is routed to the required parsing routine based on the header data of each packet. There is bit swapping involved as well. Should i wrap up the app code into a script task(s) and let it do the custom processing? The data is seperated by year and the sql server tables is partitioned by year as well. I need to be able to "catch" bad file data as well and process by hand most likely. Should i simply load the zipped file to sql as a blob and parse the file with T-SQL? Would that be multi threaded if done that way? Not sure how to do the parsing in tsql that is involved here. Which do you think would be faster? Potentially the data that is currently processed via files could come to us via a socket. Can SSIS collect that data in real time? How would i go about setting that up? Processing these new files from the directorys will become a daily task. I can manage the data once i get it to sql server. Getting it there in a timely fashion seems to be the long pole in the tent for me. I would appreciate any comments or suggestions from the group. Rick

    Read the article

  • ASP.net looping through table

    - by c11ada
    hey all, i was wondering if any one could help me out, i have a table which looks something like the following <table id="Table1" border="0"> <tr> <td><b>1.</b> Question 1</td> </tr><tr> <td style="border-width:5px;border-style:solid;"></td> </tr><tr> <td align="left" style="width:1000px;"><input id="Radio1" type="radio" name="Group1" value="Radio1" /><label for="Radio1">Answer1</label></td> </tr><tr> <td align="left" style="width:1000px;"><input id="Radio1" type="radio" name="Group1" value="Radio1" /><label for="Radio1">Answer2</label></td> </tr><tr> <td align="left" style="width:1000px;"><input id="Radio1" type="radio" name="Group1" value="Radio1" /><label for="Radio1">Answer3</label></td> </tr><tr> <td align="left" style="width:1000px;"><input id="Radio1" type="radio" name="Group1" value="Radio1" /><label for="Radio1">Answer4</label></td> </tr><tr> <td style="height:30px;"></td> </tr><tr> <td><b>2.</b> Question 2</td> </tr><tr> <td style="border-width:5px;border-style:solid;"></td> </tr><tr> <td align="left" style="width:1000px;"><input id="Radio2" type="radio" name="Group2" value="Radio2" /><label for="Radio2">yes</label></td> </tr><tr> <td align="left" style="width:1000px;"><input id="Radio2" type="radio" name="Group2" value="Radio2" /><label for="Radio2">no</label></td> </tr><tr> <td style="height:30px;"></td> </tr> </table> how do i go about looping through each group of radio buttons and getting the text of the selected radio button ?? thanks a lot !!

    Read the article

  • How come my South migrations doesn't work for Django?

    - by TIMEX
    First, I create my database. create database mydb; I add "south" to installed Apps. Then, I go to this tutorial: http://south.aeracode.org/docs/tutorial/part1.html The tutorial tells me to do this: $ py manage.py schemamigration wall --initial >>> Created 0001_initial.py. You can now apply this migration with: ./manage.py migrate wall Great, now I migrate. $ py manage.py migrate wall But it gives me this error... django.db.utils.DatabaseError: (1146, "Table 'fable.south_migrationhistory' doesn't exist") So I use Google (which never works. hence my 870 questions asked on Stackoverflow), and I get this page: http://groups.google.com/group/south-users/browse_thread/thread/d4c83f821dd2ca1c Alright, so I follow that instructions >> Drop database mydb; >> Create database mydb; $ rm -rf ./wall/migrations $ py manage.py syncdb But when I run syncdb, Django creates a bunch of tables. Yes, it creates the south_migrationhistory table, but it also creates my app's tables. Synced: > django.contrib.admin > django.contrib.auth > django.contrib.contenttypes > django.contrib.sessions > django.contrib.sites > django.contrib.messages > south > fable.notification > pagination > timezones > fable.wall > mediasync > staticfiles > debug_toolbar Not synced (use migrations): - (use ./manage.py migrate to migrate these) Cool....now it tells me to migrate these. So, I do this: $ py manage.py migrate wall The app 'wall' does not appear to use migrations. Alright, so fine. I'll add wall to initial migrations. $ py manage.py schemamigration wall --initial Then I migrate: $ py manage.py migrate wall You know what? It gives me this BS: _mysql_exceptions.OperationalError: (1050, "Table 'wall_content' already exists") Sorry, this is really pissing me off. Can someone help ? thanks. How do I get South to work and sync correctly with everything?

    Read the article

  • jQuery fadeIn fadeOut pause on hover

    - by theDawckta
    I have a little jQuery snippet that will fadeIn and fadeOut a group of divs over a select interval. I now need to pause this fadeIn fadeOut on hover, then resume on mouse out. Any help is appreciated. Here is the relevant code. The following is what is located in my body <div class="gcRotate"> <div class="gcRotateContent"> <div style="border: solid 2px black; text-align: center; width: 150px;"> This is first content <img src="http://pix.motivatedphotos.com/2008/6/16/633492359109161542-Skills.jpg" alt="Dude" /> </div> </div> <div class="gcRotateContent"> <div style="border: solid 2px black; text-align: center; width: 150px"> This is second content <img src="http://www.funnycorner.net/funny-pictures/5010/cheezburger-locats.jpg" alt="Dude" /> </div> </div> <div class="gcRotateContent"> <div style="border: solid 2px black; text-align: center; width: 150px"> This is third content <img src="http://icanhascheezburger.files.wordpress.com/2007/06/business.jpg" alt="Dude" /> </div> </div> </div> <div> This shouldn't move. </div> <script type="text/javascript"> function fadeContent() { $(".gcRotate .gcRotateContent:hidden:first").fadeIn(500).delay(2000).fadeOut(500, function() { $(this).appendTo($(this).parent()); fadeContent(); }); } $(".gcRotate").height(0); $(".gcRotateContent").each( function() { if ($(".gcRotate").height() < $(this).height()) { $(".gcRotate").height($(this).height()); } } ); $(".gcRotateContent").each(function() { $(this).css("display", "none") }); fadeContent(); </script>

    Read the article

  • XML structure question

    - by Andrew Jahn
    I have a basic XML object that I'm working with. I can't figure out how to access the parts of it. EX:<br> <pre><code> < FacetsData> < Collection name="CDDLALL" type="Group"> < SubCollection name="CDDLALL" type="Row"> < Column name="DPDP_ID">D0230< /Column> < Column name="Count">9< /Column> < /SubCollection> < SubCollection name="CDDLALL" type="Row"> < Column name="DPDP_ID">D1110< /Column> < Column name="Count">9< /Column> < /SubCollection> < /Collection> < /FacetsData> (PS: I can't get this damn xml to format so people can read it) What I need to do is check each DPDP_ID and if its value is D0230 then I leave the Count alone, all else I change the Count to 1. What I have so far: node = doc.DocumentElement; nodeList = node.SelectNodes("/FacetsData/Collection/SubCollection"); for (int x = 0; x < nodeList.Count; x++) { if (nodeList[x].HasChildNodes) { for (int i = 0; i < nodeList[x].ChildNodes.Count; i++) { //This part I can't figure out how to get the name="" part of the xml //MessageBox.Show(oNodeList[x].ChildNodes[i].InnerText); get the "D0230","1" //part but not the "DPDP_ID","Count" part. } } }

    Read the article

  • Changing text depending on rounded total from database

    - by NeonBlue Bliss
    On a website I have a number of small PHP scripts to automate changes to the text of the site, depending on a figure that's calculated from a MySQL database. The site is for a fundraising group, and the text in question on the home page gives the total amount raised. The amount raised is pulled from the database and rounded to the nearest thousand. This is the PHP I use to round the figure and find the last three digits of the total: $query4 = mysql_query("SELECT SUM(amountraised) AS full_total FROM fundraisingtotal;"); $result4 = mysql_fetch_array($query4); $fulltotal = $result4["full_total"]; $num = $fulltotal + 30000; $ftotalr = round($num,-3); $roundnum = round($num); $string = $roundnum; $length = strlen($string); $characters = 3; $start = $length - $characters; $string = substr($string , $start ,$characters); $figure = $string; (£30,000 is the amount that had been raised by the previous fundraising team from when the project first started, which is why I've added 30000 to $fulltotal for the $num variable) Currently the text reads: the bookstall and other fundraising events have raised more than &pound;<? echo number_format($ftotalr); ?> I've just realised though that because the PHP is rounding to the nearest thousand, if the total's for example £39,200 and it's rounded to £40,000, to say it's more than £40,000 is incorrect, and in that case I'd need it to say 'almost £40,000' or something similar. I obviously need to replace the 'more than' with a variable. Obviously I need to test whether the last three digits of the total are nearer to 0 or 1000, so that if the total was for example £39,2000, the text would read 'just over', if it was between £39,250 and £39,400 something like 'over', between £39,400 and £39,700 something like 'well over', and between £39,700 and £39,999, 'almost.' I've managed to get the last three digits of the total as a variable, and I think I need some sort of an if/else/elseif code block (not sure if that would be the right approach, or whether to use case/break), and obviously I'm going to have to check whether the figure meets each of the criteria, but I can't figure out how to do that. Could anyone suggest what would be the best way to do this please?

    Read the article

  • LsaAddAccountRights not working for me

    - by SteveL
    Using: Delphi 2010 and the JEDI Windows API and JWSCL I am trying to assign the Logon As A Service privilege to a user using LsaAddAccountRights function but it does not work ie. after the function returns, checking in Group Policy Editor shows that the user still does not have the above mentioned privilege. I'm running the application on Windows XP. Would be glad if someone could point out what is wrong in my code: unit Unit1; interface uses Windows, Messages, SysUtils, Variants, Classes, Graphics, Controls, Forms, Dialogs, StdCtrls, JwaWindows, JwsclSid; type TForm1 = class(TForm) Button1: TButton; procedure Button1Click(Sender: TObject); private { Private declarations } public { Public declarations } end; var Form1: TForm1; implementation {$R *.dfm} function AddPrivilegeToAccount(AAccountName, APrivilege: String): DWORD; var lStatus: TNTStatus; lObjectAttributes: TLsaObjectAttributes; lPolicyHandle: TLsaHandle; lPrivilege: TLsaUnicodeString; lSid: PSID; lSidLen: DWORD; lTmpDomain: String; lTmpDomainLen: DWORD; lTmpSidNameUse: TSidNameUse; lPrivilegeWStr: String; begin ZeroMemory(@lObjectAttributes, SizeOf(lObjectAttributes)); lStatus := LsaOpenPolicy(nil, lObjectAttributes, POLICY_LOOKUP_NAMES, lPolicyHandle); if lStatus <> STATUS_SUCCESS then begin Result := LsaNtStatusToWinError(lStatus); Exit; end; try lTmpDomainLen := DNLEN; // In 'clear code' this should be get by LookupAccountName SetLength(lTmpDomain, lTmpDomainLen); lSidLen := SECURITY_MAX_SID_SIZE; GetMem(lSid, lSidLen); try if LookupAccountName(nil, PChar(AAccountName), lSid, lSidLen, PChar(lTmpDomain), lTmpDomainLen, lTmpSidNameUse) then begin lPrivilegeWStr := APrivilege; lPrivilege.Buffer := PChar(lPrivilegeWStr); lPrivilege.Length := Length(lPrivilegeWStr) * SizeOf(Char); lPrivilege.MaximumLength := lPrivilege.Length; lStatus := LsaAddAccountRights(lPolicyHandle, lSid, @lPrivilege, 1); Result := LsaNtStatusToWinError(lStatus); end else Result := GetLastError; finally FreeMem(lSid); end; finally LsaClose(lPolicyHandle); end; end; procedure TForm1.Button1Click(Sender: TObject); begin AddPrivilegeToAccount('Sam', 'SeServiceLogonRight'); end; end. Thanks in advance.

    Read the article

  • delete row from selected gridview and database

    - by user175084
    i am trying to delete a row from the gridview and database... It should be deleted if a delte linkbutton is clicked in the gridview.. I am gettin the row index as follows: protected void LinkButton1_Click(object sender, EventArgs e) { LinkButton btn = (LinkButton)sender; GridViewRow row = (GridViewRow)btn.NamingContainer; if (row != null) { LinkButton LinkButton1 = (LinkButton)sender; // Get reference to the row that hold the button GridViewRow gvr = (GridViewRow)LinkButton1.NamingContainer; // Get row index from the row int rowIndex = gvr.RowIndex; string str = rowIndex.ToString(); //string str = GridView1.DataKeys[row.RowIndex].Value.ToString(); RemoveData(str); //call the delete method } } now i want to delete it... so i am having problems with this code.. i get an error Must declare the scalar variable "@original_MachineGroupName"... any suggestions private void RemoveData(string item) { SqlConnection conn = new SqlConnection(@"Data Source=JAGMIT-PC\SQLEXPRESS; Initial Catalog=SumooHAgentDB;Integrated Security=True"); string sql = "DELETE FROM [MachineGroups] WHERE [MachineGroupID] = @original_MachineGroupID; SqlCommand cmd = new SqlCommand(sql, conn); cmd.Parameters.AddWithValue("@original_MachineGroupID", item); conn.Open(); cmd.ExecuteNonQuery(); conn.Close(); } Blockquote <asp:SqlDataSource ID="SqlDataSource1" runat="server" ConnectionString="<%$ ConnectionStrings:SumooHAgentDBConnectionString %>" SelectCommand="SELECT MachineGroups.MachineGroupID, MachineGroups.MachineGroupName, MachineGroups.MachineGroupDesc, MachineGroups.TimeAdded, MachineGroups.CanBeDeleted, COUNT(Machines.MachineName) AS Expr1, DATENAME(month, (MachineGroups.TimeAdded - 599266080000000000) / 864000000000) + SPACE(1) + DATENAME(d, (MachineGroups.TimeAdded - 599266080000000000) / 864000000000) + ', ' + DATENAME(year, (MachineGroups.TimeAdded - 599266080000000000) / 864000000000) AS Expr2 FROM MachineGroups FULL OUTER JOIN Machines ON Machines.MachineGroupID = MachineGroups.MachineGroupID GROUP BY MachineGroups.MachineGroupID, MachineGroups.MachineGroupName, MachineGroups.MachineGroupDesc, MachineGroups.TimeAdded, MachineGroups.CanBeDeleted" DeleteCommand="DELETE FROM [MachineGroups] WHERE [MachineGroupID] =@original_MachineGroupID" > <DeleteParameters> <asp:Parameter Name="@original_MachineGroupID" Type="Int16" /> <asp:Parameter Name="@original_MachineGroupName" Type="String" /> <asp:Parameter Name="@original_MachineGroupDesc" Type="String" /> <asp:Parameter Name="@original_CanBeDeleted" Type="Boolean" /> <asp:Parameter Name="@original_TimeAdded" Type="Int64" /> </DeleteParameters> </asp:SqlDataSource> I still get an error : Must declare the scalar variable "@original_MachineGroupID"

    Read the article

  • Client side validation of multiple radio buttons groups

    - by absolutely-free
    This is my code: <html> <head> <title>scoreboard</title> <script> function calculate() { var sum=0; var total=0; for (var i=0; i < document.questions.group1.length; i++){ if (document.questions.group1[i].checked){ sum = parseInt(document.questions.group1[i].value) total = parseInt(total + sum);}} for (var i=0; i < document.questions.group2.length; i++){ if (document.questions.group2[i].checked){ sum = parseInt(document.questions.group2[i].value) total = parseInt(total + sum);}} for (var i=0; i < document.questions.group3.length; i++){ if (document.questions.group3[i].checked){ sum = parseInt(document.questions.group3[i].value) total = parseInt(total + sum);}} alert(total) } </script> </head> <body> <form name="questions"> A:<br> answer a1: <input type="radio" name="group1" value="0"> answer a2: <input type="radio" name="group1" value="1"> answer a3: <input type="radio" name="group1" value="2"> answer a4: <input type="radio" name="group1" value="3"><br> B:<br> answer b1: <input type="radio" name="group2" value="0"> answer b2: <input type="radio" name="group2" value="1"> answer b3: <input type="radio" name="group2" value="2"> answer b4: <input type="radio" name="group2" value="3"><br> C:<br> answer c1: <input type="radio" name="group3" value="0"> answer c2: <input type="radio" name="group3" value="1"> answer c3: <input type="radio" name="group3" value="2"> answer c4: <input type="radio" name="group3" value="3"><br><br> <input type="button" value="total" onclick="calculate()"> </form> </body> </html> How can I replace 'group[x]' in my code by a variable, so the three for-loops are replaced by one (because in reality there are a lot more questions and answers) ?

    Read the article

  • Exception: attempt to acquire a reference on a close SQLiteClosable

    - by CommonsWare
    I posted this back in May on the [android-developers] Google Group. I never heard back and was not able to reproduce the problem until one of my students did last week. I figured I'd post it here and see if it rang any bells for anyone. In one of my code samples, I have the following method: static Cursor getAll(SQLiteDatabase db, String orderBy) { return(db.rawQuery("SELECT * FROM restaurants "+orderBy, null)); } When I run it, sporadically, I get this: 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): java.lang.IllegalStateException: attempt to acquire a reference on a close SQLiteClosable 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): at android.database.sqlite.SQLiteClosable.acquireReference(SQLiteClosable.java:31) 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): at android.database.sqlite.SQLiteProgram.<init>(SQLiteProgram.java:56) 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): at android.database.sqlite.SQLiteQuery.<init>(SQLiteQuery.java:49) 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): at android.database.sqlite.SQLiteDirectCursorDriver.query(SQLiteDirectCursorDriver.java:49) 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): at android.database.sqlite.SQLiteDatabase.rawQueryWithFactory(SQLiteDatabase.java:1118) 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): at android.database.sqlite.SQLiteDatabase.rawQuery(SQLiteDatabase.java:1092) 05-01 14:45:05.849: ERROR/AndroidRuntime(1145): at apt.tutorial.Restaurant.getAll(Restaurant.java:14) This makes no sense to me. The database is definitely open. The SQLiteClosable is the SQLiteQuery created by SQLiteQueryDriver, and I see no evidence that there is an object pool or something going on here that might explain how a "new" SQLiteClosable is already closed. The fact that it is sporadic (meaning the same UI operations sometimes trigger the exception, but not always) suggests some sort of pool, race condition, or something...but I'm not sure where. Thoughts? Thanks! UPDATE: The code in question is from the LunchList tutorials out of my Android Programming Tutorials book. It's a bit spread out and not terribly suitable for posting directly in SO. You can download the code for that book from the above link if you want to take a look at it. I do not recall exactly which edition of the tutorial the student was working on at the time, though it was in the Tutorial 12-Tutorial 16 range. I was mostly hoping to run across somebody who had tripped over this problem before and had a likely culprit. I'm fairly certain my database is open. Thanks again!

    Read the article

< Previous Page | 538 539 540 541 542 543 544 545 546 547 548 549  | Next Page >