Search Results

Search found 14253 results on 571 pages for 'css parsing'.

Page 549/571 | < Previous Page | 545 546 547 548 549 550 551 552 553 554 555 556  | Next Page >

  • jquery ajax post callback - manipulation stops after the "third" call

    - by shanyu
    EDIT: The problem is not related to Boxy, I've run into the same issue when I've used JQuery 's load method. EDIT 2: When I take out link.remove() from inside the ajax callback and place it before ajax load, the problem is no more. Are there restrictions for manipulating elements inside an ajax callback function. I am using JQuery with Boxy plugin. When the 'Flag' link on the page is clicked, a Boxy modal pops-up and loads a form via ajax. When the user submits the form, the link (<a> tag) is removed and a new one is created from the ajax response. This mechanism works for, well, 3 times! After the 3rd, the callback function just does not remove/replace/append (tested several variations of manipulation) the element. The only hint I have is that after the 3rd call, the parent of the link becomes non-selectable. However I can't make anything of this. Sorry if this is a very trivial issue, I have no experience in client-side programming. The relevant html is below: <div class="flag-link"> <img class="flag-img" style="width: 16px; visibility: hidden;" src="/static/images/flag.png" alt=""/> <a class="unflagged" href="/i/flag/showform/9/1/?next=/users/1/ozgurisil">Flag</a> </div> Here is the relevant js code: $(document).ready(function() { $('div.flag-link a.unflagged').live('click', function(e){ doFlag(e); return false; }); ... }); function doFlag(e) { var link = $(e.target); var url = link.attr('href'); Boxy.load(url, {title:'Inappropriate Content', unloadOnHide:true, cache:false, behaviours: function(r) { $("#flag-form").live("submit", function(){ var post_url = $("#flag-form").attr('action'); boxy = Boxy.get(this); boxy.hideAndUnload(); $.post(post_url, $("#flag-form").serialize(), function(data){ par = link.parent(); par.append(data); alert (par.attr('class')); //BECOMES UNDEFINED AT THE 3RD CALL!! par.children('img.flag-img').css('visibility', 'visible'); link.remove(); }); return false; }); }}); }

    Read the article

  • jQuery, get datas in AJAX (done) then, display them as star (error)

    - by Tristan
    Hello, In my website, there are 2 steps : I get values from another domain with AJAX, it's numbers 100% working Then, i want to display those numbers in stars with this plugin (http://stackoverflow.com/questions/1987524/turn-a-number-into-star-rating-display-using-jquery-and-css) The error : the stars plugin does not work for the value i recieve from my ajax request, but it's working for my values for my domain which are not JS manipulated you can see a demo here http://www.esl.eu/fr/test/test_atome/?killcache=true PS: the data in ajax are provided in JSON-P so i wrote a parser which look like this: jQuery.ajax({ type: "get", dataType: "jsonp", url: "http://www.foo.com/", data: {demandeur: "monkey" }, cache: true, success: function(data, textStatus, XMLHttpRequest){ var obj = null, length = data.length; for (var i = 0; i < length; i++) { widget = "<p>AVERAGES<p>"; widget += "<p><span class='stars'>"; widget += data[i].services; widget += "</span></p>"; widget += "<p><span class='stars'>"; widget += data[i].qualite; widget += "</span></p>"; jQuery('#gotserv').html(widget); } } }); }); Then i have the star plugin after this function : $.fn.stars = function() { $(this).each(function() { // Get the value var val = parseFloat($(this).html()); // Make sure that the value is in 0 - 5 range val = val 5 ? 5 : (val < 0 ? 0 : val); // Calculate physical size var size = 16 * val; // Create stars holder var stars = $(''); // Adjust yellow stars' width stars.find('span').width(size); // Replace the numerical value with stars $(this).replaceWith(stars); }); I hope you understand, i don't know if i'm clear Thank you

    Read the article

  • How can I structure my MustacheJS template to add dynamic classes based on the values from a JSON file?

    - by JGallardo
    OBJECTIVE To build an app that allows the user to search for locations. CURRENT STATE At the moment the locations listed are few, so they are just all presented when landing on the "dealers" page. BACKGROUND Previously there were only about 50 showrooms carrying a product we sell, so a static HTML page was fine. And displays as But the page size grew to about 1500 lines of code after doing this. We have gotten more and need a scalable solution so that we can add many more dealers fast. In other projects, I have previously used MustacheJS and to load in values from a JSON file. I know the ideally this will be an AJAX application. Perhaps I might be better off with database here? Below is what I have in mind so far, and it "works" up to a certain point, but seems not to be anywhere near the most sustainable solution that can be efficiently scaled. HTML <a id="{{state}}"></a> <div> <h4>{{dealer}} : {{city}}, {{state}} {{l_type}}</h4> <div class="{{icon_class}}"> <ul> <li><i class="icon-map-marker"></i></li> <li><i class="icon-phone"></i></li> <li><i class="icon-print"></i></li> </ul> </div> <div class="listingInfo"> <p>{{street}} <br>{{suite}}<br> {{city}}, {{state}} {{zip}}<br> Phone: {{phone}}<br> {{toll_free}}<br> {{fax}} </p> </div> </div> <hr> JSON { "dealers" : [ { "dealer":"Benco Dental", "City":"Denver", "state":"CO", "zip":"80112", "l_type":"Showroom", "icon_class":"listingIcons_3la", "phone":"(303) 790-1421", "toll_free":null, "fax":"(303) 790-1421" }, { "dealer":"Burkhardt Dental Supply", "City":"Portland", "state":"OR", "zip":"97220", "l_type":"Showroom", "icon_class":"listingIcons", "phone":" (503) 252-9777", "toll_free":"(800) 367-3030", "fax":"(866) 408-3488" } ]} CHALLENGES The CSS class wrapping the ul will vary based on how many fields there are. In this case there are 3, so the class is "listingIcons_3la" The "toll free" number section should only show up if in fact, there is a toll free number. the fax number should only show up if there is a value for a fax number.

    Read the article

  • Problem with XML parser

    - by zp26
    Hi, I have a problem with parsing XML. I have created a program which write a file xml in the project directory. The file XML are correct. (i checked). When i try to read this XML the program crash and return 1 status. I have controlled my 2 path and they are equals. Can you help me please? Thanks so much. #import "PositionIdentifierViewController.h" #import "WriterXML.h" @implementation PositionIdentifierViewController - (void)parser:(NSXMLParser *)parser foundCharacters:(NSString *)string { NSString *stringa = [NSString stringWithFormat:@"%@",string]; textArea.text = [textArea.text stringByAppendingString:@"\n"]; textArea.text = [textArea.text stringByAppendingString:stringa]; } -(IBAction)startParsing { NSURL *xmlURL = [NSURL fileURLWithPath:path]; NSXMLParser *parser = [[NSXMLParser alloc] initWithContentsOfURL:xmlURL]; [parser setDelegate:self]; BOOL success = [parser parse]; if(success == YES){ // } [parser release]; } // Implement viewDidLoad to do additional setup after loading the view, typically from a nib. - (void)viewDidLoad { [super viewDidLoad]; NSArray *tempPaths = NSSearchPathForDirectoriesInDomains(NSDocumentDirectory, NSUserDomainMask, YES); NSString *documentsDirectoryPath = [tempPaths objectAtIndex:0]; path = [documentsDirectoryPath stringByAppendingPathComponent:@"filePosizioni.xml"]; WriterXML *newWriter; newWriter = [[WriterXML alloc]init]; [newWriter saveXML:(NSString*)@"ciao":(float)10:(float)40:(float)70]; [newWriter saveXML:(NSString*)@"pippo":(float)20:(float)50:(float)80]; [newWriter saveXML:(NSString*)@"pluto":(float)30:(float)60:(float)90]; NSLog(path); } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)dealloc { [super dealloc]; } @end #import "WriterXML.h" @implementation WriterXML -(void)saveXML:(NSString*)name:(float)x:(float)y:(float)z{ NSArray *paths = NSSearchPathForDirectoriesInDomains(NSDocumentDirectory, NSUserDomainMask, YES); NSString *documentsDirectoryPath = [paths objectAtIndex:0]; NSString *filePath = [documentsDirectoryPath stringByAppendingPathComponent:@"filePosizioni.xml"]; NSFileHandle *myHandle; NSFileManager *fileManager = [NSFileManager defaultManager]; NSString *titoloXML = [NSString stringWithFormat:@"<?xml version=1.0 encoding=UTF-8 ?>"]; NSString *inizioTag = [NSString stringWithFormat:@"\n\n\n<position>"]; NSString *tagName = [NSString stringWithFormat:@"\n <name>%@</name>", name]; NSString *tagX = [NSString stringWithFormat:@"\n <x>%f</x>", x]; NSString *tagY = [NSString stringWithFormat:@"\n <y>%f</y>", y]; NSString *tagZ = [NSString stringWithFormat:@"\n <z>%f</z>", z]; NSString *fineTag= [NSString stringWithFormat:@"\n</position>"]; NSData* dataTitoloXML = [titoloXML dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataInizioTag = [inizioTag dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataName = [tagName dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataX = [tagX dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataY = [tagY dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataZ = [tagZ dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataFineTag = [fineTag dataUsingEncoding: NSASCIIStringEncoding]; if(![fileManager fileExistsAtPath:filePath]) [fileManager createFileAtPath:filePath contents:dataTitoloXML attributes:nil]; myHandle = [NSFileHandle fileHandleForUpdatingAtPath:filePath]; [myHandle seekToEndOfFile]; [myHandle writeData:dataInizioTag]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataName]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataX]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataY]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataZ]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataFineTag]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; NSLog(@"zp26 %@",filePath); } @end

    Read the article

  • Managing multiple AJAX calls to PHP scripts

    - by relativelycoded
    I have a set of 5 HTML dropdowns that act as filters for narrowing results returned from a mySQL database. The three pertinent filters are for "Province", "Region", and "City" selection, respectively. I have three functions: findSchools(), which runs when any of the filters (marked with CSS class .filter) are changed, and fetches the results via AJAX from a PHP script. Once that is done, two other functions are called... changeRegionOptions(), which, upon changing the "Province" filter, and updates the available options using the same method as the first function, but posting to a different script. changeCityOptions(), which runs if the "Region" filter was changed, and updates options, again using the same method. The problem is that since I want these AJAX functions to run simultaneously, and they by nature run asynchronously, I've tried using $.when to control the execution of the functions, but it doesn't fix the problem. The functions run, but the Region and City filters return blank (no options); the FireBug report shows absolutely no output, even though the POST request went through. The posted parameter for filter_province gets sent normally, but the one for region gets cut off at the end -- it sends as filter_region=, with no value passed. So I'm presuming my logic is wrong somewhere. The code is below: // When any of the filters are changed, let's query the database... $("select.filter").change(function() { findSchools(); }); // First, we see if there are any results... function findSchools() { var sch_province = document.filterform.filter_province.value; var sch_region = document.filterform.filter_region.value; var sch_city = document.filterform.filter_city.value; var sch_cat = document.filterform.filter_category.value; var sch_type = document.filterform.filter_type.value; $.post("fetch_results.php", { filter_province : sch_province, filter_region : sch_region, filter_city : sch_city, filter_category : sch_cat, filter_type : sch_type }, function(data) { $("#results").html(""); $("#results").hide(); $("#results").html(data); $("#results").fadeIn(600); } ); // Once the results are fetched, we want to see if the filter they changed was the one for Province, and if so, update the Region and City options to match that selection... $("#filter_province").change(function() { $.when(findSchools()) .done(changeRegionOptions()); $.when(changeRegionOptions()) .done(changeCityOptions()); }); }; This is just one of the ways I've tried to solve it; I've tried using an IF statement, and tried calling the functions directly inside the general select.filter.change() function (after findSchools(); ), but they all return the same result. Any help with this would be great!

    Read the article

  • jQuery - draggable images on iPad / iPhone - how to integrate event.preventDefault();?

    - by Tim
    Hello! I use jQuery, jQuery UI and jQuery mobile to build a web application for iPhone / iPad. Now I create images and they should be draggable, so I did this: <!DOCTYPE html> <html> <head> <meta http-equiv="Content-type" content="text/html; charset=utf-8"> <title>Drag - Test</title> <link rel="stylesheet" href="http://code.jquery.com/mobile/1.0a2/jquery.mobile-1.0a2.min.css" /> <script src="http://code.jquery.com/jquery-1.4.4.min.js"></script> <script src="http://code.jquery.com/mobile/1.0a2/jquery.mobile-1.0a2.min.js"></script> <script src="https://ajax.googleapis.com/ajax/libs/jqueryui/1.8.7/jquery-ui.min.js"></script> </head> <body> <div> <div style="width:500px;height:500px;border:1px solid red;"> <img src="http://upload.wikimedia.org/wikipedia/en/thumb/9/9e/JQuery_logo.svg/200px-JQuery_logo.svg.png" class="draggable" alt="jQuery logo" /> <img src="http://upload.wikimedia.org/wikipedia/en/a/ab/Apple-logo.png" class="draggable" alt="Apple Inc. logo" /> </div> </div> </body> <script type="text/javascript"> $(document).ready(function() { $(".draggable").draggable(); }); </script> </html> Here you can see the live example: http://jsbin.com/igena4/ The problem is, that the whole page want to scroll. I searched in Apple's HTML5 examples and found this to prevent the scrolling of the page, so that the image is draggable: ... onDragStart: function(event) { // stop page from panning on iPhone/iPad - we're moving a note, not the page event.preventDefault(); ... } But the problem is for me, how can I include this into my jQuery? Where do I get event? Best Regards.

    Read the article

  • plupload not working in wordpress theme files

    - by Kedar B
    This is my code for image upload.... <a id="aaiu-uploader" class="aaiu_button" href="#"><?php _e('*Select Images (mandatory)','wpestate');?></a> <input type="hidden" name="attachid" id="attachid" value="<?php echo $attachid;?>"> <input type="hidden" name="attachthumb" id="attachthumb" value="<? php echo $thumbid;?>"> i want upload functionality more than one time in single page in wordpress.i have add js code for that same as first upload block but its not working. This is js code for image upload.... jQuery(document).ready(function($) { "use strict"; if (typeof(plupload) !== 'undefined') { var uploader = new plupload.Uploader(ajax_vars.plupload); uploader.init(); uploader.bind('FilesAdded', function (up, files) { $.each(files, function (i, file) { // console.log('append'+file.id ); $('#aaiu-upload-imagelist').append( '<div id="' + file.id + '">' + file.name + ' (' + plupload.formatSize(file.size) + ') <b></b>' + '</div>'); }); up.refresh(); // Reposition Flash/Silverlight uploader.start(); }); uploader.bind('UploadProgress', function (up, file) { $('#' + file.id + " b").html(file.percent + "%"); }); // On erro occur uploader.bind('Error', function (up, err) { $('#aaiu-upload-imagelist').append("<div>Error: " + err.code + ", Message: " + err.message + (err.file ? ", File: " + err.file.name : "") + "</div>" ); up.refresh(); // Reposition Flash/Silverlight }); uploader.bind('FileUploaded', function (up, file, response) { var result = $.parseJSON(response.response); // console.log(result); $('#' + file.id).remove(); if (result.success) { $('#profile-image').css('background-image','url("'+result.html+'")'); $('#profile-image').attr('data-profileurl',result.html); $('#profile-image_id').val(result.attach); var all_id=$('#attachid').val(); all_id=all_id+","+result.attach; $('#attachid').val(all_id); $('#imagelist').append('<div class="uploaded_images" data- imageid="'+result.attach+'"><img src="'+result.html+'" alt="thumb" /><i class="fa deleter fa-trash-o"></i> </div>'); delete_binder(); thumb_setter(); } }); $('#aaiu-uploader').click(function (e) { uploader.start(); e.preventDefault(); }); $('#aaiu-uploader2').click(function (e) { uploader.start(); e.preventDefault(); }); } });

    Read the article

  • How to align this div contents properly?

    - by Pandiya Chendur
    Here is my layout, I am using one div and many spans for getting the above view... Look at all the rows ther are not properly aligned... <div class="resultsdiv"><br /> <span style="width:200px;" class="resultName">' + employee.Emp_Name + '</span> <span class="resultfields" style="padding-left:100px;">Category&nbsp;:</span>&nbsp; <span class="resultfieldvalues">' + employee.Desig_Name + '</span><br /><br /> <span id="SalaryBasis" class="resultfields">Salary Basis&nbsp;:</span>&nbsp;<span class="resultfieldvalues">' + employee.SalaryBasis + '</span> <span class="resultfields" style="padding-left:25px;">Salary&nbsp;:</span>&nbsp;<span class="resultfieldvalues">' + employee.FixedSalary + '</span> <span style="font-size:110%;font-weight:bolder;padding-left:25px;">Address&nbsp;:</span>&nbsp; <span class="resultfieldvalues">' + employee.Address + '</span> </div> and my css are .resultsdiv { background-color: #FFF;border-top:solid 1px #ddd; height:50px; border-bottom:solid 1px #ddd; padding-bottom:15px; width:450px; } .resultseven { background-color: #EFF1f1; } .resultshover { background-color: #F4F2F2; cursor:pointer; } .resultName { font-size:125%;font-weight:bolder;color:#476275;font-family:Arial,Liberation Sans,DejaVu Sans,sans-serif; } .resultfields { font-size:110%;font-weight:bolder;font-family:Arial,Liberation Sans,DejaVu Sans,sans-serif; } .resultfieldvalues { color:#476275;font-size:110%;font-weight:bold;font-family:Arial,Liberation Sans,DejaVu Sans,sans-serif; } Any suggestion to get it aligned properly.... Should i use divs insted of spans to get this properly aligned...

    Read the article

  • How to define paper in raphael JS liberary?

    - by cj333
    Hi, I want to learn raphael JS liberary to draw a square. I copied the official code, but it is not work, "paper is not defined on line 34". how to define it? The demo is on http://www.irunmywebsite.com/raphael/additionalhelp.php the left menu "animate" ,Thanks. <!DOCTYPE html PUBLIC "-//W3C//DTD HTML 4.01//EN" "http://www.w3.org/TR/html4/strict.dtd"> <html lang="en"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8"> <title>Raphaël · Gear</title> <style type="text/css"> body { background: #333; color: #fff; font: 300 100.1% "Helvetica Neue", Helvetica, "Arial Unicode MS", Arial, sans-serif; } #holder { height: 480px; left: 50%; margin: -240px 0 0 -320px; position: absolute; top: 50%; width: 640px; } #copy { bottom: 0; font: 300 .7em "Helvetica Neue", Helvetica, "Arial Unicode MS", Arial, sans-serif; position: absolute; right: 1em; text-align: right; } #copy a { color: #fff; } </style> <script src="raphael-min.js" type="text/javascript" charset="utf-8"></script> <script type="text/javascript" charset="utf-8"> var a = paper.circle(320, 100, 60).attr({fill:'#FF0000'}); a.animate({ 'translation': '0,300' }, 500, 'bounce'); var b = paper.circle(320, 100, 60).attr({fill:'#FFFF00'});; b.animate({ cx: 320, cy: 300 }, 500, 'bounce'); var path1=paper.path("M114 253").attr({"stroke": "#f00", "stroke-width":3}); path1.animate({path: "M114 253 L 234 253"},3000,function(){ var path2=paper.path("M234 253").attr({"stroke": "#f00","stroke-width":3}); path2.animate({path: "M234 253 L 234 134"},3000,function(){ var path3=paper.path("M234 134").attr({"stroke": "#f00","stroke-width":3}); path3.animate({path: "M234 134 L 97 134"},3000); }); }); </script> </head> <body> <div id="stroke"></div> </body> </html>

    Read the article

  • Howcome I cannot make my javascript 'executable' in an address bar

    - by imHavoc
    The second link does not work like the first one. How come? <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN"> <html> <head> <title>Dynamic CSS Properties</title> <script language="JavaScript"> function change(){ //document.getElementById("box1").style.visibility = "visible"; var spanArray = document.getElementsByTagName('span'); var number_spans = spanArray.length ; for( var i = 0; i < number_spans ; i++ ){ var target = spanArray[ i ] ; // do something with target like set visibility target.style.visibility = "visible"; } } function change2(){ var spanArray=document.getElementsByTagName('span');var number_spans=spanArray.length;for(var i=0;i<number_spans;i++){var target=spanArray[i];target.style.visibility="visible";} } </script> </head> <body> <a href="javascript:change2();">Change</a> <br /> <a href="javascript:var spanArray=document.getElementsByTagName('span');va r number_spans=spanArray.length;for(var i=0;i<number_spans;i++){var target=spanArray[i];target.style.visibility='visible';}; ">Show Spans</a> <br /> <div style="position: relative; overflow: hidden;"><center> <br><br> <font size="5" color="blue"> 1. just press the <img src="http://up203.siz.co.il/up1/jw2k4az1imny.jpg"> button on the top to see the picture i promise you its so funny!!!!: <br><br><br> <span style="background: none repeat scroll 0% 0% white;"><span style="visibility: hidden;"> <a onmousedown="UntrustedLink.bootstrap($(this), &quot;77a0d&quot;, event)" rel="nofollow" target="_blank" onclick="(new Image()).src = '/ajax/ct.php?app_id=4949752878&amp;action_type=3&amp;post_form_id=3917211492ade40ee468fbe283b54b3b&amp;position=16&amp;' + Math.random();return true;" href="http://thebigbrotherisrael.blogspot.com/2010/04/all-family-guy-characters-in-real-life.html">Press here to see the picture!!!</a> </span><span style="visibility: visible;"></span></span></font></center></div> </body> </html>

    Read the article

  • shuffling array javascript

    - by Dennis Callanan
    <!doctype html> <html lang="en"> <head> <meta charset="utf=8" /> <title>Blackjack</title> <link rel="stylesheet" href="blackjack.css" /> <script type="text/javascript"> var H2 = 2; var S2 = 2; var D2 = 2; var C2 = 2; var H3 = 3; var S3 = 3; var D3 = 3; var C3 = 3; var deck = new Array(H2, S2, D2, C2, H3, S3, D3, C3); var new_deck = new Array(); var r; document.write("deck = ") for (r =0; r<deck.length; r++){ document.write(deck[r]); } document.write("</br>") document.write("new deck = ") for (r=0; r<new_deck.length; r++){ document.write(new_deck[r]); } document.write("</br>") for (r=0;r<deck.length;r++){ var randomindex = Math.floor(Math.random()*deck.length); new_deck.push(randomindex) deck.pop(randomindex) } document.write("deck = ") for (r =0; r<deck.length; r++){ document.write(deck[r]); } document.write("</br>") document.write("new deck = ") for (r=0; r<new_deck.length; r++){ document.write(new_deck[r]); } document.write("</br>") </script> </head> <body> </body> </html> Obviously this isn't the full Blackjack game here. It's just a test to see if shuffling the array works by printing the contents of both decks (arrays) before and after the shuffle. I'm only using 8 cards at the moment, 4 2's and 4 3's. What I am getting from this is: deck = 22223333 new deck = deck = 2222 new deck = 7502 What I'm hoping to get is: deck = 22223333 new deck = deck = new deck = 23232323 (or any of the 8 numbers, generated randomly) So it should be shuffling those 8 cards, what am I doing wrong? I'm only new to javascript but I've used some python before. I've done something similar in python and worked perfectly, but I'm not sure what's wrong here. Thanks for any answers in advance!!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Escaping Code for Different Shells

    - by Jon Purdy
    Question: What characters do I need to escape in a user-entered string to securely pass it into shells on Windows and Unix? What shell differences and version differences should be taken into account? Can I use printf "%q" somehow, and is that reliable across shells? Backstory (a.k.a. Shameless Self-Promotion): I made a little DSL, the Vision Web Template Language, which allows the user to create templates for X(HT)ML documents and fragments, then automatically fill them in with content. It's designed to separate template logic from dynamic content generation, in the same way that CSS is used to separate markup from presentation. In order to generate dynamic content, a Vision script must defer to a program written in a language that can handle the generation logic, such as Perl or Python. (Aside: using PHP is also possible, but Vision is intended to solve some of the very problems that PHP perpetuates.) In order to do this, the script makes use of the @system directive, which executes a shell command and expands to its output. (Platform-specific generation can be handled using @unix or @windows, which only expand on the proper platform.) The problem is obvious, I should think: test.htm: <!-- ... --> <form action="login.vis" method="POST"> <input type="text" name="USERNAME"/> <input type="password" name="PASSWORD"/> </form> <!-- ... --> login.vis: #!/usr/bin/vision # Think USERNAME = ";rm -f;" @system './login.pl' { USERNAME; PASSWORD } One way to safeguard against this kind of attack is to set proper permissions on scripts and directories, but Web developers may not always set things up correctly, and the naive developer should get just as much security as the experienced one. The solution, logically, is to include a @quote directive that produces a properly escaped string for the current platform. @system './login.pl' { @quote : USERNAME; @quote : PASSWORD } But what should @quote actually do? It needs to be both cross-platform and secure, and I don't want to create terrible problems with a naive implementation. Any thoughts?

    Read the article

  • Element to string in HTMLDocument

    - by kalpesh
    i have a Element object its a HTMLDocument object and i want to string value of this element. i want this result Christina Toth, Pharm. D. ======================= plz see below code. public static void main(String args[]) throws Exception { InputStream is = Nullsoft.getInputStream(); InputStreamReader isr = new InputStreamReader(is); BufferedReader br = new BufferedReader(isr); HTMLEditorKit htmlKit = new HTMLEditorKit(); HTMLDocument htmlDoc = (HTMLDocument) htmlKit.createDefaultDocument(); HTMLEditorKit.Parser parser = new ParserDelegator(); HTMLEditorKit.ParserCallback callback = htmlDoc.getReader(0); parser.parse(br, callback, true); // Parse ElementIterator iterator = new ElementIterator(htmlDoc); Element element; while ((element = iterator.next()) != null) { AttributeSet attributes = element.getAttributes(); Object name = attributes.getAttribute(StyleConstants.NameAttribute); if ((name instanceof HTML.Tag) && ((name == HTML.Tag.DIV) || (name == HTML.Tag.H2) || (name == HTML.Tag.H3))) { StringBuffer text = new StringBuffer(); int count = element.getElementCount(); for (int i = 0; i < count; i++) { Element child = element.getElement(i); AttributeSet childAttributes = child.getAttributes(); // if (childAttributes.getAttribute(StyleConstants.NameAttribute) == HTML.Tag.CONTENT) { int startOffset = child.getStartOffset(); int endOffset = child.getEndOffset(); int length = endOffset - startOffset; text.append(htmlDoc.getText(startOffset, length)); } } System.out.println(name + ": " + text.toString()); } } System.exit(0); } public static InputStream getInputStream() { String text = "<html>\n" + "<head>\n" + "<title>pg_0001</title>\n" + "\n" + "<style type=\"text/css\">\n" + ".ft3{font-style:normal;font-weight:bold;font-size:11px;font-family:Helvetica;color:#000000;}\n" + "</style>\n" + "</head>\n" + "<body vlink=\"#FFFFFF\" link=\"#FFFFFF\" bgcolor=\"#ffffff\">\n" + "\n" + "\n" + "<div style=\"position:absolute;top:597;left:252\"><nobr><span class=\"ft3\">Christina Toth, Pharm. D.</span></nobr></div>\n" + "\n" + "\n" + "</body>\n" + "</html>"; InputStream is = null; try { is = new ByteArrayInputStream(text.getBytes("UTF-8")); } catch (UnsupportedEncodingException e) { e.printStackTrace(); } return is; }

    Read the article

  • not able to get a processed list in jquery variable

    - by Pradyut Bhattacharya
    I have html list <ol id="newlist"> <li>Test <ol> <li>1</li> <li>2</li> <li>3</li> </ol> </li> <li>Another test <ol> <li>1</li> </ol> </li> <li>Cool Test <ol> <li>1</li> <li>2</li> </ol> </li> </ol> Now i have hidden the list using the css... #newlist li { display:none; list-style: none; } I want to display the list and the only the descendants which have greater than 1 descendants... the output should be... Test 1 2 3 Another test Cool Test 1 2 I have used jquery and able to get the output... the code i used... $("ol#newlist > li").show(); for (var i = 0; i < $("ol#newlist > li").length; i++) { if ($("ol#newlist > li:eq(" + i + ") ol > li").length > 1) $("ol#newlist > li:eq(" + i + ") ol > li").show(); } the sample page here Now i want all the list in a single variable like i can get the lis in a variable... var $li = $("ol#newlist > li"); but the code $li.add($("ol#newlist > li:eq(" + i + ") ol > li")); is not working... the sample page here Please help... Thanks Pradyut India

    Read the article

  • Monitoring DOM Changes in JQuery

    - by user363866
    Is there a way to detect when the disabled attribute of an input changes in JQuery. I want to toggle the style based on the value. I can copy/paste the same enable/disable code for each change event (as I did below) but I was looking for a more generic approach. Can I create a custom event that will monitor the disabled attribute of specified inputs? Example: <style type="text/css">.disabled{ background-color:#dcdcdc; }</style> <fieldset> <legend>Option 1</legend> <input type="radio" name="Group1" id="Radio1" value="Yes" />Yes <input type="radio" name="Group1" id="Radio2" value="No" checked="checked" />No <div id="Group1Fields" style="margin-left: 20px;"> Percentage 1: <input type="text" id="Percentage1" disabled="disabled" /><br /> Percentage 2: <input type="text" id="Percentage2" disabled="disabled" /><br /> </div> </fieldset> <fieldset> <legend>Option 2</legend> <input type="radio" name="Group2" id="Radio3" value="Yes" checked="checked" />Yes <input type="radio" name="Group2" id="Radio4" value="No" />No <div id="Group2Fields" style="margin-left: 20px;"> Percentage 1: <input type="text" id="Text1" /><br /> Percentage 2: <input type="text" id="Text2" /><br /> </div> </fieldset> <script type="text/javascript"> $(document).ready(function () { //apply disabled style to all disabled controls $("input:disabled").addClass("disabled"); $("input[name='Group1']").change(function () { var disabled = ($(this).val() == "No") ? "disabled" : ""; $("#Group1Fields input").attr("disabled", disabled); //apply disabled style to all disabled controls $("input:disabled").addClass("disabled"); //remove disabled style to all enabled controls $("input:not(:disabled)").removeClass("disabled"); }); $("input[name='Group2']").change(function () { var disabled = ($(this).val() == "No") ? "disabled" : ""; $("#Group2Fields input").attr("disabled", disabled); //apply disabled style to all disabled controls $("input:disabled").addClass("disabled"); //remove disabled style to all enabled controls $("input:not(:disabled)").removeClass("disabled"); }); }); </script>

    Read the article

  • Very simple jquery ui drag and drop does not work. Why not?

    - by Catfish
    WHy doesn't this work? <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <style type="text/css"> #content { background:#CCCCCC; width:500px; height:500px; } #drop { height:200px; width:200px; background:#00FFFF; float:right; } #drag { background:#009966; width:100px; height:100px; float:left; } .active { background:#FFCC33; } </style> <script type="text/ecmascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4.2/jquery.min.js"></script> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jqueryui/1.7.2/jquery-ui.min.js"></script> <script type="text/javascript"> $(document).ready(function() { $('#drag').draggable({ containment: '#content', scrollSensitivity: 60, revert: true, cursor: 'move' }); $('#drop').droppable({ accept: '#drag', drop: function(event, ui) { $(this).addClass('.active'); } }); }); </script> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <title>Untitled Document</title> </head> <body> <div id="content"> <div id="drag"> </div> <div id="drop"> </div> </div> </body> </html>

    Read the article

  • Issues loading Jquery (Galleria) script from inside an i-frame (beginner javascript?)

    - by 103188530284789248582
    Hello, first of all - I'm not entirely new to javascript, but am not fluent in it as I am with html and css, and am especially new to jQuery... so please excuse me if this questions seems easy or obvious, but after days of google I still have no solution to the problem... using jQuery 1.4.2.min, jQuery-ui-1.8.1 .... the site in question: http://homecapture.ca/sets/project_index.html The scenario: I have a tabbed menu generated from an unordered list, when a menu item is clicked it reveals an iframe which links to the page containing an image gallery. I am using jQuery UI tabs for the tabbed menu, and the galleries to which I'm linking are jQuery Galleria pages, automatically generated with Jalbum. The problem: The galleria plug-in only works normally from inside of the containing iframe in Chrome, has inconsistent behaviour in IE8 (seems to work in my local copy, but won't load properly online), and is not loaded properly in Firefox. Instead of displaying a thumbnail area and the first large image, the Galleria page shows the first thumbnail only, then when it is clicked the image it links to, but if you right-click and go Back, the iframe content shows up as a properly rendered Galleria page. Jalbum generates more script in the < head of the page in addition to linking to jquery and the galleria plug-in. All of it seems to be in charge of the gallery navigation , and I have relocated it to the < body of the page, in an effort to make it load after the parent page scripts, and together with the gallery content. At this point I am not sure what else I could do to solve the problem, without digging around in all or some of the library and pluging .js files (which I am not knowledgeable enough to do without some pointers). Has anyone dealt with a similar issue? I'm seeing some solutions for manipulating iframe content from a parent page with jQuery on here, is that what I should be researching instead? Thanks in advance for all the help! ps. I tried posting some code, but it seems I do not have enough 'reputation' for things to work right on here either :)

    Read the article

  • Drawing text to <canvas> with @font-face does not work at the first time

    - by lemonedo
    Hi all, First try the test case please: http://lemon-factory.net/test/font-face-and-canvas.html I'm not good at English, so I made the test case to be self-explanatory. On the first click to the DRAW button, it will not draw text, or will draw with an incorrect typeface instead of the specified "PressStart", according to your browser. After then it works as expected. At the first time the text does not appear correctly in all browsers I've tested (Firefox, Google Chrome, Safari, Opera). Is it the standard behavior or something? Thank you. PS: Following is the code of the test case <!DOCTYPE html> <html> <head> <meta http-equiv=Content-Type content="text/html;charset=utf-8"> <title>@font-face and canvas</title> <style> @font-face { font-family: 'PressStart'; src: url('http://lemon-factory.net/css/fonts/prstart.ttf'); } canvas, pre { border: 1px solid #666; } pre { float: left; margin: .5em; padding: .5em; } </style> </head> <body> <div> <canvas id=canvas width=250 height=250> Your browser does not support the CANVAS element. Try the latest Firefox, Google Chrome, Safari or Opera. </canvas> <button>DRAW</button> </div> <pre id=style></pre> <pre id=script></pre> <script src="http://ajax.googleapis.com/ajax/libs/jquery/1.4.2/jquery.min.js"></script> <script> var canvas = document.getElementById('canvas') var ctx = canvas.getContext('2d') var x = 30 var y = 10 function draw() { ctx.font = '12px PressStart' ctx.fillStyle = '#000' ctx.fillText('Hello, world!', x, y += 20) ctx.fillRect(x - 20, y - 10, 10, 10) } $('button').click(draw) $('pre#style').text($('style').text()) $('pre#script').text($('script').text()) </script> </body> </html>

    Read the article

  • Do you know why introducing jquery ui autocomplete for my dropdown boxes is also changing my listbox

    - by oo
    I am trying to change my comboboxes to use autocomplete so i leverage the code listed here (which worked perfectly for my dropdowns) The issue is that i also on the same page have a listbox with the following code: <%= Html.ListBox("Cars", Model.BodyParts.Select( x => new SelectListItem { Text = x.Name, Value = x.Id, Selected = Model.CarsSelected.Any(y => y.Id == x.Id) } ))%> and it appears that the jquery ui code is changing this to a autocomplete dropdown as well (as opposed to keeping it as a multi select list box) any idea how to prevent this from happening? i literally am just using the exact code on this page <script type="text/javascript"> (function($) { $.widget("ui.combobox", { _create: function() { var self = this; var select = this.element.hide(); var input = $("<input>") .insertAfter(select) .autocomplete({ source: function(request, response) { var matcher = new RegExp(request.term, "i"); response(select.children("option").map(function() { var text = $(this).text(); if (!request.term || matcher.test(text)) return { id: $(this).val(), label: text.replace(new RegExp("(?![^&;]+;)(?!<[^<>]*)(" + request.term.replace(/([\^\$\(\)\[\]\{\}\*\.\+\?\|\\])/gi, "\\$1") + ")(?![^<>]*>)(?![^&;]+;)", "gi"), "<strong>$1</strong>"), value: text }; })); }, delay: 0, select: function(e, ui) { if (!ui.item) { // remove invalid value, as it didn't match anything $(this).val(""); return false; } $(this).focus(); select.val(ui.item.id); self._trigger("selected", null, { item: select.find("[value='" + ui.item.id + "']") }); }, minLength: 0 }) .addClass("ui-widget ui-widget-content ui-corner-left"); $("<button>&nbsp;</button>") .insertAfter(input) .button({ icons: { primary: "ui-icon-triangle-1-s" }, text: false }).removeClass("ui-corner-all") .addClass("ui-corner-right ui-button-icon") .position({ my: "left center", at: "right center", of: input, offset: "-1 0" }).css("top", "") .click(function() { // close if already visible if (input.autocomplete("widget").is(":visible")) { input.autocomplete("close"); return; } // pass empty string as value to search for, displaying all results input.autocomplete("search", ""); input.focus(); }); } }); })(jQuery); $(function() { $("select").combobox(); }); </script>

    Read the article

  • IE8 isn't resizing tbody or thead when a column is hidden in a table with table-layout:fixed

    - by tom
    IE 8 is doing something very strange when I hide a column in a table with table-layout:fixed. The column is hidden, the table element stays the same width, but the tbody and thead elements are not resized to fill the remaining width. It works in IE7 mode (and FF, Chrome, etc. of course). Has anyone seen this before or know of a workaround? Here is my test page - toggle the first column and use the dev console to check out the table, tbody and thead width: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html> <head> <title>bug</title> <style type="text/css"> table { table-layout:fixed; width:100%; border-collapse:collapse; } td, th { border:1px solid #000; } </style> </head> <body> <table> <thead> <tr> <th id="target1">1</th> <th>2</th> <th>3</th> <th>4</th> </tr> </thead> <tbody> <tr> <td id="target2">1</td> <td>2</td> <td>3</td> <td>4</td> </tr> </tbody> </table> <a href="#" id="toggle">toggle first column</a> <script type="text/javascript"> function toggleFirstColumn() { if (document.getElementById('target1').style.display=='' || document.getElementById('target1').style.display=='table-cell') { document.getElementById('target1').style.display='none'; document.getElementById('target2').style.display='none'; } else { document.getElementById('target1').style.display='table-cell'; document.getElementById('target2').style.display='table-cell'; } } document.getElementById('toggle').onclick = function(){ toggleFirstColumn(); return false; }; </script> </body> </html>

    Read the article

  • live search with Jquery

    - by user272899
    Hello! I am trying to implement a live search on my site. I am using a script somebody has already created. http://www.reynoldsftw.com/2009/03/live-mysql-database-search-with-jquery/ I have got the Jquery, css, html working correctly but am having troubles with the php. I need to change it to contain my database information but everytime I do I recieve an error: Warning: mysql_fetch_array() expects parameter 1 to be resource, boolean given in C:\wamp\www\search.php on line 33 These are the details of my database: database name: development table name: links Columns: id, sitename, siteurl, description, category This is the php script <?php $dbhost = "localhost"; $dbuser = "root"; $dbpass = "password"; $dbname = "links"; $conn = mysql_connect($dbhost, $dbuser, $dbpass) or die ('Error connecting to mysql'); mysql_select_db($dbname); if(isset($_GET['query'])) { $query = $_GET['query']; } else { $query = ""; } if(isset($_GET['type'])) { $type = $_GET['type']; } else { $query = "count"; } if($type == "count") { $sql = mysql_query("SELECT count(url_id) FROM urls WHERE MATCH(url_url, url_title, url_desc) AGAINST('$query' IN BOOLEAN MODE)"); $total = mysql_fetch_array($sql); $num = $total[0]; echo $num; } if($type == "results") { $sql = mysql_query("SELECT url_url, url_title, url_desc FROM urls WHERE MATCH(url_url, url_title, url_desc) AGAINST('$query' IN BOOLEAN MODE)"); while($array = mysql_fetch_array($sql)) { $url_url = $array['url_url']; $url_title = $array['url_title']; $url_desc = $array['url_desc']; echo "<div class=\"url-holder\"><a href=\"" . $url_url . "\" class=\"url-title\" target=\"_blank\">" . $url_title . "</a> <div class=\"url-desc\">" . $url_desc . "</div></div>"; } } mysql_close($conn); ?> Can anybody help me input this database info correctly? I have tried many times but keep getting an error. Thanks in advance.

    Read the article

  • jQuery gallery turn over with next and previous buttons

    - by Ralf
    Hi, i'm trying to do some kind of Gallery-Turn Over Script with jQuery. Therefor i got an array with - let's say 13 - images: galleryImages = new Array( 'images/tb_01.jpg', 'images/tb_02.jpg', 'images/tb_03.jpg', 'images/tb_04.jpg', 'images/tb_05.jpg', 'images/tb_06.jpg', 'images/tb_07.jpg', 'images/tb_08.jpg', 'images/tb_09.jpg', 'images/tb_10.jpg', 'images/tb_11.jpg', 'images/tb_12.jpg', 'images/tb_13.jpg' ); My gallery looks like a grid showing only 9 images at once. My current script already counts the number of li-elements in #gallery, loads the first 9 images and displays them. The HTML looks like this: <ul id="gallery"> <li></li> <li></li> <li></li> <li></li> <li></li> <li></li> <li></li> <li></li> <li></li> </ul> <ul id="gallery-controls"> <li id="gallery-prev"><a href="#">Previous</a></li> <li id="gallery-next"><a href="#">Next</a></li> </ul> I'm pretty new to jQuery an my problem is that i can't figure out how to split the array in portions with 9 elements to attach it as a link on the control buttons. I need something like this: $('#gallery-next').click(function(){ $('ul#gallery li').children().remove(); $('ul#gallery li').each(function(index,el){ var img = new Image(); $(img).load(function () { $(this).css('display','none'); $(el).append(this); $(this).fadeIn(); }).attr('src', galleryImages[index]); //index for the next 9 images?!?! }); }); Thanks for help!

    Read the article

  • HTML wrapper div over embedded flash object cannot be "clickable" by jQuery

    - by Michael Mao
    Hi all: I've been trying to do as the client requested : redirect to campaign page then to destination page once a customer clicks on the top banner in swf format. You can check what's been done at :http://ausdcf.org If you are using Firefox, Chrome or Safari, I suspect you can reach the destination page. However, if you are using IE or Opera, I doubt it. I think to cause of such a weird problem is: The swf ojbects don't have a link to url, SO I have to hack the theme template file like this : <div id="header">'; /* * A quick and dirty way to put some swf into PHP, and rotate among them ... */ //available banners $banners = array( 'http://localhost/smf/flash/banner_fertalign_1.swf', 'http://localhost/smf/flash/banner_fertalign_2.swf', 'http://localhost/smf/flash/banner_fertalign_3.swf' ); //get random banner srand((double) microtime() * 1000000); $rand = rand(0,count($banners)-1); echo '<div id="top_banner_clickable">'; echo '<div id="top_banner_wrapper">'; echo '<object width="400" height="60">'; echo '<param name="wmode" value="transparent">'; echo '<embed wmode="transparent" src="'.$banners[$rand].'" '; echo 'width="400" height="60" type="application/x-shockwave-flash"'; echo 'pluginspage="http://www.macromedia.com/shockwave/download/index.cgi?P1_Prod_Version=ShockwaveFlash" />'; echo '</object>'; echo '</div>'; echo '</div>'; And the related jQuery code is like this: /* master.js */ $(document).ready(function() { $("#top_banner_clickable").click(function() { window.location ="http://ausdcf.org/campaign/"; }); }); I absolutely know nothing about Flash or embedded objects. I guess that's the cause of this problem. Plus, I don't know why it works with some browsers but not all... I even tried to add a z-index to the wrapper div in css like this: #top_banner_clickable { z-index : 100; } No this wouldn't do, either... Is there a way to go around this issue? Many thanks in advance.

    Read the article

  • Callback function in jquery doesn't seem to work......

    - by Pandiya Chendur
    I use the following jquery pagination plugin and i got the error a.parentNode is undefined when i executed it... <script type="text/javascript"> $(document).ready(function() { getRecordspage(1, 5); $(".pager").pagination(17, { callback: pagechange, current_page: '0', items_per_page: '5', num_display_entries : '5', next_text: 'Next', prev_text: 'Prev', num_edge_entries: '1' }); }); function pagechange() { $("#ResultsDiv").empty(); $("#ResultsDiv").css('display', 'none'); getRecordspage($(this).text(), 5); } function getRecordspage(curPage, pagSize) { $.ajax({ type: "POST", url: "Default.aspx/GetRecords", data: "{'currentPage':" + curPage + ",'pagesize':" + pagSize + "}", contentType: "application/json; charset=utf-8", dataType: "json", success: function(jsonObj) { var strarr = jsonObj.d.split('##'); var jsob = jQuery.parseJSON(strarr[0]); var divs = ''; $.each(jsob.Table, function(i, employee) { divs += '<div class="resultsdiv"><br /><span class="resultName">' + employee.Emp_Name + '</span><span class="resultfields" style="padding-left:100px;">Category&nbsp;:</span>&nbsp;<span class="resultfieldvalues">' + employee.Desig_Name + '</span><br /><br /><span id="SalaryBasis" class="resultfields">Salary Basis&nbsp;:</span>&nbsp;<span class="resultfieldvalues">' + employee.SalaryBasis + '</span><span class="resultfields" style="padding-left:25px;">Salary&nbsp;:</span>&nbsp;<span class="resultfieldvalues">' + employee.FixedSalary + '</span><span style="font-size:110%;font-weight:bolder;padding-left:25px;">Address&nbsp;:</span>&nbsp;<span class="resultfieldvalues">' + employee.Address + '</span></div>'; }); $("#ResultsDiv").append(divs).show('slow'); $(".resultsdiv:even").addClass("resultseven"); $(".resultsdiv").hover(function() { $(this).addClass("resultshover"); }, function() { $(this).removeClass("resultshover"); }); } }); } </script> and in my page, <div id="ResultsDiv" style="display:none;"> </div> <div id="pager" class="pager"> </div> Any suggestion....

    Read the article

< Previous Page | 545 546 547 548 549 550 551 552 553 554 555 556  | Next Page >