Search Results

Search found 61944 results on 2478 pages for 'text database'.

Page 57/2478 | < Previous Page | 53 54 55 56 57 58 59 60 61 62 63 64  | Next Page >

  • The problem about use the exist sqlite database,

    - by flybirdtt
    I have a sqlite database, and i put this file in "assets" folder. The code like below, Pls help and tell what's wrong in this code, How to use my own sqlite database. public class DataBaseHelper extends SQLiteOpenHelper { private static String DB_PATH = "/data/data/com.SGMalls/databases/"; private static String DB_NAME = "mallMapv2.sqlite"; private SQLiteDatabase myDataBase; private final Context myContext; public DataBaseHelper(Context context) { super(context, DB_NAME, null, 1); this.myContext = context; } public void createDataBase() throws IOException { File dbDir = new File(DB_PATH); if (!dbDir.exists()) { dbDir.mkdir(); } boolean dbExist = checkDataBase(); if (dbExist) { } else { this.getReadableDatabase(); try { copyDataBase(); } catch (IOException e) { throw new Error("Error copying database"); } } close(); } private boolean checkDataBase() { SQLiteDatabase checkDB = null; boolean isnull=false; try { String myPath = DB_PATH + DB_NAME; checkDB = SQLiteDatabase.openDatabase(myPath, null, SQLiteDatabase.OPEN_READONLY); } catch (SQLiteException e) { // database does't exist yet. } if (checkDB != null) { isnull=true; checkDB.close(); } return isnull; } private void copyDataBase() throws IOException { InputStream myInput = myContext.getAssets().open(DB_NAME); String outFileName = DB_PATH + DB_NAME; OutputStream myOutput = new FileOutputStream(outFileName); byte[] buffer = new byte[1024]; int length; while ((length = myInput.read(buffer)) > 0) { myOutput.write(buffer, 0, length); } // Close the streams myOutput.flush(); myOutput.close(); myInput.close(); } public void openDataBase() throws SQLException { // Open the database String myPath = DB_PATH + DB_NAME; myDataBase = SQLiteDatabase.openDatabase(myPath, null, SQLiteDatabase.OPEN_READONLY); } @Override public synchronized void close() { if (myDataBase != null) myDataBase.close(); super.close(); } @Override public void onCreate(SQLiteDatabase db) { } @Override public void onUpgrade(SQLiteDatabase db, int oldVersion, int newVersion) { } } public class GetData { private static String DB_PATH = "/data/data/com.SGMalls/databases/mallMapv2.sqlite"; // private static String DB_NAME = "mallMapv2.sqlite"; public static ArrayList<Mall> getMalls() { ArrayList<Mall> mallsList = new ArrayList<Mall>(); SQLiteDatabase malldatabase = SQLiteDatabase.openDatabase(DB_PATH, null, SQLiteDatabase.OPEN_READONLY); String queryString="select id,title from malls order by title"; Cursor cursor=malldatabase.rawQuery(queryString, null); if(cursor!=null){ cursor.moveToFirst(); while(!cursor.isLast()){ Mall mall=new Mall(); mall.setMallid(cursor.getInt(0)); mall.setMallname(cursor.getString(0)); mallsList.add(mall); cursor.moveToNext(); } } malldatabase.close(); return mallsList; } } The error message: ERROR/Database(725): sqlite3_open_v2("/data/data/com.SGMalls/databases/ mallMapv2.sqlite", &handle, 1, NULL) failed 03-15 22:34:11.747: ERROR/AndroidRuntime(725): Uncaught handler: thread main exiting due to uncaught exception 03-15 22:34:11.766: ERROR/AndroidRuntime(725): java.lang.Error: Error copying database Thanks very much

    Read the article

  • Pros and cons of programmatically enforcing foreign key than in database

    - by Jeffrey
    It is causing so much trouble in terms of development just by letting database enforcing foreign key. Especially during unit test I can’t drop table due to foreign key constrains, I need to create table in such an order that foreign key constrain warning won’t get triggered. In reality I don’t see too much point of letting database enforcing the foreign key constrains. If the application has been properly designed there should not be any manual database manipulation other than select queries. I just want to make sure that I am not digging myself into a hole by not having foreign key constrains in database and leaving it solely to the application’s responsibility. Am I missing anything? P.S. my real unit tests (not those that use mocking) will drop existing tables if the structure of underlying domain object has been modified.

    Read the article

  • How to tell the database type checking the file

    - by Click Ok
    My friend have a system to manage customers. The program per si is terrible, and my friend lost contact with the developers. The case is, now my friend lost the access to program (something that the developers say "locked to machine" so when moved to another pc, he lost the access to program and data. I get mission of to try to recover the database, migrating to another database, and create a cool program to my friend. Now I need to discover wich database was used by the developers. I know that the program was made using Visual Basic, because the MSVBVM60.DLL is required. There is some program to read the metadata in the .dat files and discover wich database was used?

    Read the article

  • Why are there so many Database Management Systems?

    - by mr.bio
    Why are there so many Database management systems? I am not an DB expert and I've never thought about using another Database other than mySQL. Programming languages offer different paradigms, so it makes sense to choose a specific language for your purpose. Question What are the factors in choosing a specific Database management system ?

    Read the article

  • June Edition - Oracle Database Insider

    - by jgelhaus
    Now available.  The June edition of the Oracle Database Insider includes: NEWS June 10: Oracle CEO Larry Ellison Live on the Future of Database Performance At a live webcast on June 10 at Oracle’s headquarters, Oracle CEO Larry Ellison is expected to announce the upcoming availability of Oracle Database In-Memory, which dramatically accelerates business decision-making by processing analytical queries in memory without requiring any changes to existing applications. Read More New Study Confirms Capital Expenditure Savings with Oracle Multitenant A new study finds that Oracle Multitenant, an option of Oracle Database 12c, drives significant savings in capital expenditures by enabling the consolidation of a large number of databases on the same number or fewer hardware resources. Read More VIDEO Oracle Database 12c: Multitenant Environment with Tom Kyte Tom Kyte discusses Oracle Multitenant, followed by a demo of the multitenant architecture that includes moving a pluggable database (PDB) from one multitenant container database to another, cloning a PDB, and creating a new PDB.  and much more.

    Read the article

  • Database schema for multiple category/product relationship

    - by sree01
    I want to design a database for an e-commerce application with category/subcategory management. Please suggest a database schema where we can create categories and subcategories and add products to those categories. Each product can have multiple categories and we can select products belong to multiple categories using a boolean database query Thanks

    Read the article

  • database for streets world wide?

    - by fayer
    i use the downloadable geonames database for all countries, states, counties and cities in the world. but i wonder if there is a database for streets? so you could pick: country - state/department/district - (county/region) - city - street in whatever country you like? cause when i do a search for a street in google map i can see all the upper levels (country/region/city). is there a database you could download for mysql for this? there has to be a database for this, cause there are always national companies that provide this kind of information. where did they get it from? thanks in advance!

    Read the article

  • Check how old an Oracle database is?

    - by Jamie
    Hi all, So, we have a mirror of a santized version of the production database. Is there anyway (that you know of) to find out how old the database is? i.e. when the database was put on the Oracle server. Thanks for any help!

    Read the article

  • Very long strings as primary keys in a database for caching

    - by Bill Zimmerman
    Hi, I am working on a web app that allows users to create dynamic PDF files based on what they enter into a form (it is not very structured data). The idea is that User 1 enters several words (arbitrary # of words, practically capped of course), for example: A B C D E There is no such string in the database, so I was thinking: Store this string as a primary key in a MySQL database (it could be maybe around 50-100k of text, but usually probably less than 200 words) Generate the PDF file, and create a link to it in the database When the next user requests A B C D E, then I can just serve the file instead of recreating it each time. (simple cache) The PDF is cpu intensive to generate, so I am trying to cache as much as I can... My questions are: Does anyone have any alternative ideas to my approach What will the database performance be like? Is there a better way to design the schema than using the input string as the primary key?

    Read the article

  • CREATE mysql database with default InnoDB tables?

    - by memilanuk
    Hello, I've been working on writing a SQL statement to create a MySQL database with several default options, including default character set and default collate. Is it possible to add syntax to make the default engine type for tables in this database to be innodb? I've been looking through the MySQL manual for v.5.1 and I've found the statement 'ENGINE=innodb' which would be appended to a CREATE TABLE statement... but I haven't found anything related to a CREATE DATABASE statement. Is there a normal way to do this as part of the database creation, or does it need to be specified on a table-by-table basis? Thanks, Monte

    Read the article

  • knockout bind text label to dropdown value selected option text

    - by Adam Levitt
    Is there a simple way to bind the textbox of a div to change based on the text value of the selected option in a dropdown on the same page? <div data-bind="text: dropdownValue"></div> <select> <option value="1">Value1</option> <option value="2">Value2</option> </select> Please note, I don't want to put the values into the select element using javascript. I'd like to bind to the value straight from the HTML. I can also include jQuery to make it work.

    Read the article

  • How to Configure and run DataBase Mail in SQL Server

    - by Nasser Hajloo
    How to enable and run Database Mail in SQL Server 2008 . I know that it need Enabling Service Broker Configuring SMTP (a Mail server is needed) Using Configuration Storeprocedure. I don't know what's the relation between application and dataBase mail. Actually How to enable Database mail for a RollBack and Commit Transaction ? (not for all SP , just for some of them)

    Read the article

  • ASP.NET Conditionally Change ButtonField text at runTime

    - by Rodney Vinyard
    ASP.NET Conditionally Change ButtonField text at runTime   <asp:ButtonField CommandName="Edit" HeaderText="" Text="Edit" ButtonType="Link" />       protected void gvRequests_RowDataBound(object sender, GridViewRowEventArgs e)     {         if (e.Row.RowType == DataControlRowType.DataRow)         {             //----------------------------------------------------             // If status = "Saved", change buttonField.LinkButton.Text to "Copy"             //----------------------------------------------------             if (e.Row.Cells[(int)gCol.Status].Text == "Saved")             {                 //----------------------------------------------------                 // no !                 //----------------------------------------------------                 //string x = e.Row.Cells[(int)gCol.EditLink].Text;                 //e.Row.Cells[(int)gCol.EditLink].Text = "Copy";                   //----------------------------------------------------                 // yes !                 //----------------------------------------------------                 LinkButton linkButton = (LinkButton)e.Row.Cells[(int)gCol.EditLink].Controls[0];                 linkButton.Text = "Copy";             }         }     }

    Read the article

  • What to do with database in dev/production phases of a website?

    - by TheLQ
    For a while now I've been keeping a website I'm developing in the standard dev/production phases. Its been pretty simple: Mercurial repo for dev, repo for production. Do work in dev, get approved, push to production. But now I'm trying to apply this process to a new website that has a database and am struggling on how to figure out a development strategy. What I didn't mention above is that I do all my work on my own repo, push it to dev, then later push it to production, so its 3 different servers. So how do I manage my database? The obvious solution of mysqldump every commit isn't going to happen, and a dump at the end of the day isn't all that helpful when you want to undo later one change that happened in the middle of the day. What is the best way to accomplish this?

    Read the article

  • Issue with parsed text with HTMLCleaner - spaces at the begining of text

    - by ansol90
    Im able to get text using HTMLCleaner from website. The problem is that when I set the text to a TextView it shows the beginning of the text with a big space on it. Here is the screenshot of what im talking about. I have tried android:gravity but nothing happened. Please help. Here is my Code: private class SiteParser extends AsyncTask<String, Void, String> { protected String doInBackground(String... arg) { String output = null; try { HtmlHelper hh = new HtmlHelper(new URL(arg[0])); List<TagNode> news = hh.getnewsByClass("TextoPrint"); for (Iterator<TagNode> iterator = newss.iterator(); iterator .hasNext();) { TagNode divElement = (TagNode) iterator.next(); output = divElement.getText().toString(); } } catch (Exception e) { e.printStackTrace(); } return output; } protected void onPostExecute(String output) { Bundle bundle=new Bundle(); bundle.putString("body",output); Intent mainIntent = new Intent(act, MyView.class); mainIntent.putExtras(bundle); startActivity(mainIntent); act.finish(); } } public class HtmlHelper { TagNode rootNode; public HtmlHelper(URL htmlPage) throws IOException, XPatherException { HtmlCleaner cleaner = new HtmlCleaner(); rootNode = cleaner.clean(htmlPage); } List<TagNode> getnewsByClass(String Classname){ List<TagNode> newsList = new ArrayList<TagNode>(); TagNode divElements[] = rootNode.getElementsByName("div", true); for (int i = 0; divElements != null && i < divElements.length; i++) { String classType = divElements[i].getAttributeByName("id"); if (classType != null && classType.equals(Classname)) { newsList.add(divElements[i]); } } return newsList; } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Object Oriented Database - why most of the companies do not use them

    - by GigaPr
    Hi, I am pretty new to programming(just finished University). I have been thought in the last 4 years about Object Oriented development and the numerous advantages of this approach. My question is Isn't it easier to use a pure Object Oriented database in development applications? Why Object Oriented database are not as much diffuse as relational? From my point of view makes sense to use OO database, the latter will avoid the numerous construction necessary for the mapping of complex objects on the tables.

    Read the article

  • Backing Up Database from Remote Server to Local in VB.NET

    - by Pradeep
    Hi, I am making a VB.NET application that can download/backup the database that is currently on a remote server. I have Remote Server IP,Username,Password and Database name. I am also able to connect to it. But i don't know what to do after connecting to it. I don't know what all files are need to be backed up. ( i think database and log file both must be backed up, i am not sure ) please let me know that basic commmands that i will need to backup the whole database. Thanks in advance.

    Read the article

  • Top techniques to avoid 'data scraping' from a website database

    - by Addsy
    I am setting up a site using PHP and MySQL that is essentially just a web front-end to an existing database. Understandably my client is very keen to prevent anyone from being able to make a copy of the data in the database yet at the same time wants everything publicly available and even a "view all" link to display every record in the db. Whilst I have put everything in place to prevent attacks such as SQL injection attacks, there is nothing to prevent anyone from viewing all the records as html and running some sort of script to parse this data back into another database. Even if I was to remove the "view all" link, someone could still, in theory, use an automated process to go through each record one by one and compile these into a new database, essentially pinching all the information. Does anyone have any good tactics for preventing or even just dettering this that they could share. Thanks

    Read the article

  • Oracle Database Customers In the News!

    - by jenny.gelhausen
    Our database customers are implementing some pretty interesting applications. Here are a few recent ones in the news: Dressbarn, Maurices and Justice Brands' Parent Company Ascena Retail Group, Inc. all using Oracle Database 11g to power their Oracle E-Business Suite 12.1 applications for growth Hotwire, Inc. Innovates Faster with Oracle Exadata Database Machine Disney Store Completes International Implementation of @OracleRetail Point of Service using Oracle Database 11g Banca Transilvania selects Oracle FLEXCUBE Universal Banking (uses #Exadata Database Machine X2-2) Shop Direct Group Selects Oracle to Support E-Commerce Growth Strategy With Oracle Retail on Oracle Database 11g Let us know your story - how are you utilizing Oracle Database? var gaJsHost = (("https:" == document.location.protocol) ? "https://ssl." : "http://www."); document.write(unescape("%3Cscript src='" + gaJsHost + "google-analytics.com/ga.js' type='text/javascript'%3E%3C/script%3E")); try { var pageTracker = _gat._getTracker("UA-13185312-1"); pageTracker._trackPageview(); } catch(err) {}

    Read the article

  • Using views as a data interface between modules in a database

    - by Stefan
    Hello, I am working on the database layout of a straighforward small database in Mysql. We want to modularize this system in order to have more flexiblity for different implementations we are going to make. Now, the idea was to have one module in the database (simple a group of tables with constraints between them) pass its data to the next module via views. In this way, changes in one module would not affect the other ones, as we can make sure in the view that the right data is present there at any time, although the underlying structure of tables might be different. The structure of the App handling the database would likewise be modularized. Is this something that is sometimes done? On a technical side, as I understand views can't have primary keys - how would I then adress such a view? What other issues should be considered?

    Read the article

  • Send SMS text messages for FREE using Java ME

    - by hinkmond
    Here's a way to get around those nasty SMS text messages charges (and maybe a way to get around the Pakistan SMS text censors too!). Use this Java ME SMS text app for your Java ME mobile phone, called JaxtrSMS: See: JaxtrSMS free Java ME SMS Here's a quote: JaxtrSMS lets you send FREE SMS and txt messages to any mobile phone in the world. Best of all, the receiver does not have to have the JaxtrSMS app. International and local SMS/texting can be expensive but with JaxtrSMS you can text anyone in the world for FREE! Great! Now, you can send 2,000 text messages from your phone every month and not worry about a huge bill. You don't send 2,000 text message in a month? Well, get it for your teenage kids then. They certainly send 2,000 text messages in a month... Hinkmond

    Read the article

  • Change input text to regular text on blur and ability to edit jQuery

    - by eknown
    I'm creating a form where I'm eliminating the use of a save button. The form is made up of input text boxes and textareas. After the user enters data into the input field, I want to trigger an onBlur function and change the input into a span that contains the information that the user entered. I also want to have the ability to edit this information, so if the user clicks on the newly created span with text, it will turn back into the input field with the current information for their editing pleasure. For reference, I'm looking to have a functionality pretty much like on editing a photo title on Flickr. If possible, I'd also like to have the textbox show "saving..." for half a second after the blur to reflect interaction with server.

    Read the article

< Previous Page | 53 54 55 56 57 58 59 60 61 62 63 64  | Next Page >