Search Results

Search found 21463 results on 859 pages for 'broken link'.

Page 571/859 | < Previous Page | 567 568 569 570 571 572 573 574 575 576 577 578  | Next Page >

  • Community TFS Build Manager available for Visual Studio 2012 RC

    - by Jakob Ehn
    I finally got around to push out a version of the Community TFS Build Manager that is compatible with Visual Studio 2012 RC. Unfortunately I had to do this as a separate extension, it references different versions of the TFS assemblies and also some properties and methods that the 2010 version uses are now obsolete in the TFS 2012 API. To download it, just open the Extension Manager, select Online and search for TFS Build:   You can also download it from this link: http://visualstudiogallery.msdn.microsoft.com/cfdb84b4-285e-4eeb-9fa9-dad9bfe2cd10 The functionality is identical to the 2010 version, the only difference is that you can’t start it from the Team Explorer Builds node (since the TE has been completely rewritten and the extension API’s are not yet published). So, to start it you must use the Tools menu: We will continue shipping updates to both versions in the future, as long as it functionality that is compatible with both TFS 2010 and TFS 2012. You might also note that the color scheme used for the build manager doesn’t look as good with the VS2012 theme….   Hope you will enjoy the tool in Visual Studio 2012 as well. I want to thank all the people who have downloaded and used the 2010 version! For feedback, feature requests, bug reports please post this to the CodePlex site: http://tfsbuildextensions.codeplex.com

    Read the article

  • Tomcat directly serve static (css, js) files shared by multiple applications

    - by Josvic Zammit
    I'm using the ExtJS framework which has a bulk of js and css files that are used for all apps. I intend to share these between a number of web applications (different war files). For this reason I would like to serve ExtJS js and css directly from the web server, in my case Tomcat6, which can be used to serve static files, as in this helpful link. Therefore I put my files under /var/lib/tomcat6/webapps/ROOT/extjs/. The static files that are directly under that directory are served correctly, e.g. /extjs/ext.js correctly serves the file at /var/lib/tomcat6/webapps/ROOT/extjs/ext.js. However files in lower-level directories, for example /extjs/welcome/css/welcome.css, which should serve the file at /var/lib/tomcat6/webapps/ROOT/extjs/welcome/css/welcome.css, return a 404. TL/DR Tomcat serves static files only at top-level directory. A 404 is returned for files deeper in the hierarchy. Config file contents: server.xml application's web.xml

    Read the article

  • model association or controller?

    - by andybritton
    I'm trying to create a rails app that allows users to submit information about their pets. I've come to a point where my knowledge is limited and I don't know enough about what/how this could be done so I'm hoping this will be relatively easy to answer. At the moment I have a model called Pet, this model currently stores basic information like name, picture etc but it also holds more specific data like type, breed, date of birth etc. What I would like to be able to do is create a page that can match various records without having to be manually categorized if that makes sense so a users pet could be matched to other pets with the same breed, age etc. I've read about nested models as I understand this information could be submitted to 2 models in one form but I am not sure whether this could be done directly in a separate controller which would only be visible to users with pets in these matched "groups" if that makes sense. So in essence is it best practice to use 1 table to store all the information and just use a controller to match pets based on rows having the same values or would it be far simpler to have a form with a nested model and link 2 tables together? The main feature needs to be matching without a user having to create a group or categorize pets so the second model would need to add id's to an array instead of just creating more and more rows.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • ADF Hands on Training &ndash; Prerequisites for 22nd March 2011

    - by Grant Ronald
    For those of you coming to the ADF Hands on training on the 22nd March in London, there was a link to the prerequisites.  Unfortunately, in a reshuffle of content on OTN, this page was removed.  So, over the next day or so I’m hoping to the pull together the relevant information into this blog post.  So keep checking back! Firstly, you need to being your laptop with you to do the hands on exercises.  No laptop, no hands on. Recommended 2GB RAM running Microsoft Windows XP SP2, 2003 Server SP2, Vista (32 bit only), Windows 7 or Linux or Mac 2GHz Processor (less will be acceptable but slower) Mozilla Firefox 2.0 or higher, Internet Explorer 7 or higher, Safari 3.0 and higher, Google Chrome 1.0 or higher Winzip or other extracting software Adobe Acrobat reader Flash (if you want to see dynamic graphs in your application) As for software, you will need have installed JDeveloper 11g.  The hands on instructions are based on 11.1.1.2 (or is it 11.1.1.3)! anyway, either of those or 11.1.1.4 would be required. You also need an Oracle database on your machine and access to the HR schema (which should be unlocked).  Don’t expect to have access to a network and VPN to a database. A simple test, unplug your laptop from your corporate network, run up JDev  and select File –> New –> Database connection and make sure you can connect to HR database and see the Emp/Dept etc tables.  If you can do that, you should be good to go. I would strongly recommend ensuring you have this in place before you arrive on Tuesday. Look forward to seeing you there.

    Read the article

  • Why are my Google searches redirected?

    - by Please Help
    This machine was infected with various malware. I have scanned the system with Malwarebytes. It found and removed some 600 or so infected files. Now the machine seems to be running well with only one exception. Some Google search results are being redirected to some shady search engines. If I were to copy the url from the Google Search results and paste it in the address bar it would go to the correct site but if I click the link I will be redirected somewhere else. Here is my log file from HijackThis: http://pastebin.com/ZE3wiCrk

    Read the article

  • South Florida Code Camp and Other Events

    - by MOSSLover
    My grandmother wanted me to make her a video when she heard I got MVP in SharePoint Server of one of my sessions.  I decided I haven’t visited in two years, so maybe I can do an in person session.  I googled around and found South Florida Code Camp, which will be Saturday, February 12th.  I will be doing a session at 9:50 in the morning on Silverlight just for my grandmother and whoever shows up.  Here is the link for more information: http://www.fladotnet.com/codecamp/. In the upcoming months I plan to return to SharePoint Saturday speaking.  We are also organizing another New York event on Saturday, July 30th.  We will open up submissions for sponsors and speakers somewhere after Best Practices Conference in LaJolla.  I will be speaking at Best Practices LaJolla and the The Expert’s Conference in the upcoming months.  I am really sorry for the lack of updates it’s just been incredibly crazy going back and forth to DC and not having internet on weekdays or having the slowest internet in the world has just not helped.  I am also trying to attend Coders 4 Charity this year, so I can visit some people in St. Louis.  I’ve already got an incredibly crazy schedule going for the year.  I might be helping organize more events.  I’m going to volunteer at New York Code Camp too doing whatever they need this year.  Check back for more updates. Technorati Tags: SharePoint Conferences 2011,Events 2011

    Read the article

  • Greater than or equal check when using Group Policy Preferences and Item Level Targeting in the Registry

    - by edusysadmin
    I'm implementing some screen saver configurations via Group Policy Preferences (on Win7 Enterprise x64 desktops). The desired configuration is to have users be able to adjust their screen saver and screen saver time out, but not allow them to select non screen saver or a time out higher than 45min. I've found a great write-up for configuration of the screen saver (link) but cannot find a way to configure the time out. I cannot find a way to have the item level targeting compare the reg key HKCU\Control Panel\Desktop\ScreenSaveTimeOut value and force an over-write of the key if configured above 45min/2700seconds. Anyone else tried something like this or found a means to do this?

    Read the article

  • SANS Mobility Policy Survey Webcast follow up

    - by Darin Pendergraft
    Hello Everyone!  If you missed the SANS mobility survey webcast on October 23 - here is a link to the replay and to the slides: [Warning -  you have to register to see the replay and to get the slides] https://www.sans.org/webcasts/byod-security-lists-policies-mobility-policy-management-survey-95429 The webcast had a lot of great information about how organizations are setting up and managing their mobile access policies.  Here are a couple of key takeaways: 1.  Who is most concerned about mobile access policy? Security Analysts >> CISOs >> CIOs - the focus is coming from the risk and security office - so what does that mean for the IT teams? 2. How important is mobile policy? 77% said "Critical" or "Extremely Important" - so this means mobile access policies will get a lot of attention.  3. When asked about the state of their mobile policies: Over 35% said they didn't have a mobile access policy and another 35% said they simply ask their employees to sign a usage agreement.  So basically ~70% of the respondents were not actively managing or monitoring mobile access. Be sure to watch the webcast replay for all of the details. Box, Oracle and RSA were all co-sponsors of the survey and webcast and all were invited to give a brief presentation at the end.

    Read the article

  • Ubuntu 12.04 startup is slow and dmesg output seems to lose several seconds

    - by cdowen
    I use ubuntu on Dell Inspiron n4050.I have upgraded to ubuntu 12.04 from 10.04. But now I find the system startup is a little slow and plymouth only show purple screen without logo during startup. When I use dmesg, it shows such messages: [ 2.497750] EXT4-fs (sda1): mounted filesystem with ordered data mode. Opts: (null) [ 2.603028] usb 2-1.6: new high-speed USB device number 3 using ehci_hcd [ 2.715538] Initializing USB Mass Storage driver... [ 2.715594] usbcore: registered new interface driver usb-storage [ 2.715596] USB Mass Storage support registered. [ 21.317843] Adding 2000892k swap on /dev/sda5. Priority:-1 extents:1 across:2000892k [ 21.323724] ADDRCONF(NETDEV_UP): eth0: link is not ready [ 21.391450] udevd[431]: starting version 175 I wonder what it is doing between 2 second and 21 second. Is it related to being so slow? I tried bootchart. It gave me a complex picture. Sorry I can't post it here. http://3.bp.blogspot.com/-7LX8T5uQvlw/UKhdFMVkp4I/AAAAAAAAADg/dtxePkE94mg/s320/lengzhen-ubuntu-precise-20121118-1.png While ubuntu is booting , I also noticed that it appears:/tmp is not ready or present And sometimes follows *Stop saving kernel messages. Is this the reason dmesg lost output?

    Read the article

  • aptana/eclipse blocks other apps

    - by waquner
    Hi, I've got a fresh win7 installation, the only apps installed so far are aptana (beta 3)/eclipse and firefox + chrome (except antivirus and drivers) Every time I start aptana, chrome and firefox are blocked, so firefox can't load a webpage (or sometimes takes veeeery long) and chrome doesn't even take care of events (so for example hovering over a link doesn't change the cursor and a click does...nothing or typing in an url, press enter - nothing happens) First I thought, aptana downloads something and blocks my internet connection... but IE works well and also there are no signs in the taskmanager (cpu%, network or memory) When I close Aptana, all works as before. I tried updating Java, which didn't help... On my office-computer I use the same apps and it works perfect. Got any ideas? TIA, waquner

    Read the article

  • Smart Phones Shockingly Energy Efficient; Lead to Decreased Household Power Consumption

    - by Jason Fitzpatrick
    Given how often our smart phones and tablets spend plugged in and topping off their battery reserves, it’s easy to assume they’re sucking down a lot of power. Analysis shows the lilliputian but powerful devices are surprisingly efficient and may be decreasing our overall power consumption. Courtesy of energy-centric blog Outlier, we’re treated to a look at the power sipping habits of popular smart phones and mobile devices. The simple take away? They use shockingly little electricity over the course of the year–you can charge your new iPhone for a year of regular usage for under a buck. The more complex analysis? The proliferation of tiny and energy efficient devices is displacing heavier energy consumers (large televisions, desktop computers, etc.) and driving a more efficient gadget-to-consumption ratio is many households. Hit up the link below to read the full post. How Much Does It Take to Charge an iPhone [via Mashable] 7 Ways To Free Up Hard Disk Space On Windows HTG Explains: How System Restore Works in Windows HTG Explains: How Antivirus Software Works

    Read the article

  • Somehow Google considers a properly 301'd URL as 200 and is still indexing the new content in old page?

    - by user2178914
    We redirected all the old URL's to new ones properly using htaccess. The problem is Google, somehow is still finding content in the old page(which it shouldn't) and stores it in the cache rather than the new URL. For eg: Old Page- http://www.natures-energies.com/iching.htm New Page- http://www.natures-energies.com/index.php?option=com_content&view=article&id=760 If you type the old URL into the browser it redirects If you fetch the old URL as Googlebot in the webmaster tools the header says 301/permanently redirected. If I try to crawl as any other bot it still says 301 redirected. Even if you click the old link in Google it redirects to the new URL. Only in its cache it shows the old URL and moreover it shows the new content in it! I am stumped on how Google manages to grab the new content and puts in the old URL instead of the new one! One more interesting thing is that if I try a cache for the new page it shows the cache of the new content with old URL! Any help would be appreciated. I am at end of my wits. I think i have tried almost everything. Is there anything that I'm missing to see? You can use this search to find the old url's. Maybe you'll some patterns that i missed. site:www.natures-energies.com inurl:htm -inurl:https|index

    Read the article

  • Building MySQL with boost on windows

    - by user13177919
    As you've probably heard already MySQL needs boost to build. However, in the good ol' MySQL tradition, the above link does give you only the instructions on how to build it on linux. And completely ignores the fact that there're other OSes too that people develop on. To fill in that gap, I've compiled a small step by step guide on how to do it on windows. Note that I always, as a principle, build out-of-source. The typical setup I have is : bzr clone lp:~mysql/mysql-server/5.7 mysql-trunkcd mysql-trunkmkdir bldcd bldcmake -DWITH_DEBUG=1 -DMYSQL_PROJECT_NAME=mysql-trunk ..devenv /build debug mysql-trunk.sln This has been tested to work on a 32 bit compile using VS2013 on a Windows7 64 bit build. Note that you'll need other things too (bison, eventually openssl etc) that I will assume you already have set up. Steps: Download Boost 1.55.0. It's the *only* version that is known to work currently. Extract boost_1_55_0/ from the zip to c:\boost\boost_1_55_0 Go to Control Panel/System/Environment variables and set WITH_BOOST=C:\boost\boost_1_55_0 in User variables. Make sure you restart your open command line terminal windows after this !  If you're upgrading from non-boost build, remove your bld/ directory and create a new one. run cmake as you'd typically do. You should get: -- Local boost dir C:/boost/boost_1_55_0 -- Local boost zip LOCAL_BOOST_ZIP-NOTFOUND -- BOOST_VERSION_NUMBER is #define BOOST_VERSION 105500 -- BOOST_INCLUDE_DIR C:/boost/boost_1_55_0 Build as normal (devenv /build debug ...). It should work.

    Read the article

  • What is the world wide web? [closed]

    - by think123
    I don't know where to post this question, so please move it if necessary. Ok, so I've heard of how the professional hosting companies can create 'links' to the world wide web to register an unregistered domain. So that's where my question comes from. Is the world wide web a server to which servers link? Is it created by abstract linkage? I'm not sure. Also, what does it mean for the DNS to be updated throughout the whole world?

    Read the article

  • How to make the internal subwoofer work on an Asus G73JW?

    - by CodyLoco
    I have an Asus G73JW laptop which has an internal subwoofer built-in. Currently, the system detects the internal speakers as a 2.0 system (or I can change do 4.0 is the only other option). I found a bug report here: https://bugs.launchpad.net/ubuntu/+source/alsa-driver/+bug/673051 which discusses the bug and according to them a fix was sent upstream back at the end of 2010. I would have thought this would have made it into 12.04 but I guess not? I tried following the link given at the very bottom to install the latest ALSA drivers, here: https://wiki.ubuntu.com/Audio/InstallingLinuxAlsaDriverModules however I keep running into an error when trying to install: sudo apt-get install linux-alsa-driver-modules-$(uname -r) Reading package lists... Done Building dependency tree Reading state information... Done E: Unable to locate package linux-alsa-driver-modules-3.2.0-24-generic E: Couldn't find any package by regex 'linux-alsa-driver-modules-3.2.0-24-generic' I believe I have added the repository correctly: sudo add-apt-repository ppa:ubuntu-audio-dev/ppa [sudo] password for codyloco: You are about to add the following PPA to your system: This PPA will be used to provide testing versions of packages for supported Ubuntu releases. More info: https://launchpad.net/~ubuntu-audio-dev/+archive/ppa Press [ENTER] to continue or ctrl-c to cancel adding it Executing: gpg --ignore-time-conflict --no-options --no-default-keyring --secret-keyring /tmp/tmp.7apgZoNrqK --trustdb-name /etc/apt/trustdb.gpg --keyring /etc/apt/trusted.gpg --primary-keyring /etc/apt/trusted.gpg --keyserver hkp://keyserver.ubuntu.com:80/ --recv 4E9F485BF943EF0EABA10B5BD225991A72B194E5 gpg: requesting key 72B194E5 from hkp server keyserver.ubuntu.com gpg: key 72B194E5: public key "Launchpad Ubuntu Audio Dev team PPA" imported gpg: Total number processed: 1 gpg: imported: 1 (RSA: 1) And I also ran an update as well (followed the instructions on the fix above). Any ideas?

    Read the article

  • Installing multiple versions of a shared library

    - by nsfyn55
    I am running ubuntu 10.04 and I want to use tmux 1.6. tmux has a dependency on libevent 2. My solution was to compile libevent2 and drop into /usr/local/lib then compile tmux against this lib and drop into /usr/local/bin. This works great until...I restart. This is just an assumption on my part but it seems that other binaries are now linking to the libevent2 library presumably because its on the library path. Because there are 60+ packages with libevent1 dependencies this causes my install to basically lose its mind. Is there an idiomatic way to approach running an application that has a core library dependency on a different version? Should I just statically link the lib?

    Read the article

  • NetworkManager detects no networks with a RTL8188CE

    - by Cormac O'Brien
    I'm on a 2011 Lenovo Thinkpad T420i with a Realtek RTL8188CE WiFi adapter. Here's the scenario: I pop in the Ubuntu LiveCD to install. Laptop detects all networks in range, I connect to my home network, internet working great. Once Ubuntu finishes installing, the home network I am connected to is the only one which appears in the applet list. Upon restarting or waking from suspend, NetworkManager does not detect any networks – it simply displays "Disconnected" under the Wireless Network section of the menu. I am able to connect to my home network by using the "Connect to Hidden Wireless Network" option and it works immediately. I have yet to test if this works with other SSIDs. I have tried reinstalling the entire OS as well as NetworkManager and my wireless drivers. For hardware info, I ran: cormac@cormac-T420:~$ sudo lshw -c network Here is the output for my wireless card: *-network description: Wireless interface product: RTL8188CE 802.11b/g/n WiFi Adapter vendor: Realtek Semiconductor Co., Ltd. physical id: 0 bus info: pci@0000:03:00.0 logical name: wlan0 version: 01 serial: d0:df:9a:08:73:50 width: 64 bits clock: 33MHz capabilities: pm msi pciexpress bus_master cap_list ethernet physical wireless configuration: broadcast=yes driver=rtl8192ce driverversion=3.2.0-26-generic firmware=N/A ip=192.168.1.138 latency=0 link=yes multicast=yes wireless=IEEE 802.11bgn resources: irq:17 ioport:5000(size=256) memory:f2500000-f2503fff I can provide more information if required. This was not a problem in Natty or Oneiric. I hope this can be fixed, I don't want to have to ask for an SSID wherever I need to connect.

    Read the article

  • VPN PPTPD with MPPE Support for Debian or Ubuntu

    - by user78395
    Having an unencrypted vpn connection from a windows client to linux is pretty easy by using pptpd. When I was looking for an solution for encrypted (per MPPE) connection, I found a lot of information about patching the kernel etc. - so it definitly works after some work. But all these information is pretty old (2005-2006). Is it the same solution nowadays? I am not asking for a complete instruction (only if it's short) - I am more asking for a link to the right solution.

    Read the article

  • Lookups targeting merged cells - only returning value for first row

    - by Ian
    I have a master worksheet which contains data that I wish to link to another 'summary' sheet using a lookup. However, some of the cells whose data I wish to include in the summary sheet are merged across two or more adjacent rows. To be clear, the 'primary' column A that I am using in my formula in order to identify the target row does not contain merged cells, but the column from which I wish to return a value does. I have tried VLOOKUP and INDEX+MATCH. The problem is that the data is only returned for the first row's key, and the others return zero (as though the cell in the target column were blank, where actually it is merged). I have tried inelegant ways around this, e.g. using IF statements to try to find the top row of the merged cell. However, these don't work well if the order of values in the summary sheet is different from that in the master sheet, as well as being messy. Can this be done?

    Read the article

  • Compilation problem [closed]

    - by Misery
    I am trying to compile a program called Triangle Mesh Generator. It is an open source code written in ANSI C. I need it to bo a callable lib so I am using a switch (#define) created by it's Author. However I get this error: /usr/lib/gcc/x86_64-linux-gnu/4.6/../../../x86_64-linux-gnu/crt1.o: In function `_start': collect2: ld returned 1 exit status make: *** [triangle] Error 1 I am not sure why such an error occurs. Worth adding is that compiling it as a stand alone program is succesful. I am using GCC on 12.04. The lines quoted above constitute the total output. What I put in the terminal is just make in the proper folder. There are no other errors, warnings, or other messages. Link to the sources I found some additional instructions. I'll get back after reading them :] EDIT: I have found some additional instructions that let me compile it. Thanks for help. I am closing question right now. Regards

    Read the article

  • Problem downloading Android SDK?

    - by primehunter326
    So I'm trying to download the Android SDK for Windows from their website but it isn't working. The download seems to proceed without a hitch but something is wrong because the downloaded .zip is only 2-3 MB (size varies), MD5 doesn't match and the file won't open or extract. Obviously the download is corrupt but I have no idea why. A quick google didn't turn up anyone else with this problem to indicate that it might be on the server side. My connection is rock solid and I've never had issues with it so I'm not sure what it could be on my end. I tried downloading the linux version as well and tried using the alternate link, both to no avail. Having recently discovered this amazing community I thought I'd ask here. Any ideas?

    Read the article

  • What do I put on my developers box in regard to SharePoint 2010

    - by Jisaak
    So we are venturing out into the world of SharePoint and it seems that I have to install SharePoint Server directly on each developer's box. Is this correct? I have SharePoint up and running on a separate sever so it seems redundant to have to install it on each box. Not to mention installing SharePoint on Windows 7 is a pain in the ars. I'm just trying to clarify how to correctly set the environment up. I've been using this link as a guide so far: http://msdn.microsoft.com/en-us/library/ee554869(office.14).aspx Any advice is greatly appreciated!

    Read the article

  • Is it possible to put an 8000 series socket-F Opteron into a dual-socket motherboard?

    - by René Kåbis
    Exactly what it says on the Tin. I have a dual-socket, socket-F motherboard in which I am looking to put two high-end quad-core Opterons, but the 2000 series are nearly double the price of the 8000 series on eBay. Can I just drop in a pair of 8000 series processors and be done with it, or are there processor-critical motherboard features that would be present on a quad(+)-socket motherboard that don’t exist on a dual-socket motherboard? Please elaborate or link to resources that can explain this further, as I am not adverse to research (and I am interested in the technical issues involved) I am probably using the wrong search terms, as Google failed to return anything within the first few dozen results.

    Read the article

  • How to know which revision or router I do have? [migrated]

    - by Rosamunda
    I´m trying to update my D-link Dir-600 router with the dd-wrt firmware. I´ve searched for it at the site and found that: Revision A1, B1 and B2 are supported, while C isn´t. Now my router has this information on the back: P/N IIR600GNA .... C1G H/W Ver: C1 F/W Ver: 3.01 So I guess the H/W Ver is the revision, and it´s C... so it´s a lost cause? Or maybe because it´s not just C but C1 I could do something with it? Thanks!

    Read the article

< Previous Page | 567 568 569 570 571 572 573 574 575 576 577 578  | Next Page >