Search Results

Search found 62532 results on 2502 pages for 'id string'.

Page 572/2502 | < Previous Page | 568 569 570 571 572 573 574 575 576 577 578 579  | Next Page >

  • Convert PDF to Image Batch

    - by tro
    I am working on a solution where I can convert pdf files to images. I am using the following example from codeproject: http://www.codeproject.com/Articles/317700/Convert-a-PDF-into-a-series-of-images-using-Csharp?msg=4134859#xx4134859xx now I tried with the following code to generate from more then 1000 pdf files new images: using Cyotek.GhostScript; using Cyotek.GhostScript.PdfConversion; using System; using System.Collections.Generic; using System.Drawing; using System.IO; using System.Linq; using System.Text; using System.Threading.Tasks; namespace RefClass_PDF2Image { class Program { static void Main(string[] args) { string outputPath = Properties.Settings.Default.outputPath; string pdfPath = Properties.Settings.Default.pdfPath; if (!Directory.Exists(outputPath)) { Console.WriteLine("Der angegebene Pfad " + outputPath + " für den Export wurde nicht gefunden. Bitte ändern Sie den Pfad (outputPath) in der App.Config Datei."); return; } else { Console.WriteLine("Output Pfad: " + outputPath + " gefunden."); } if (!Directory.Exists(pdfPath)) { Console.WriteLine("Der angegebene Pfad " + pdfPath + " zu den PDF Zeichnungen wurde nicht gefunden. Bitte ändern Sie den Pfad (pdfPath) in der App.Config Datei."); return; } else { Console.WriteLine("PDF Pfad: " + pdfPath + " gefunden."); } Pdf2ImageSettings settings = GetPDFSettings(); DateTime start = DateTime.Now; TimeSpan span; Console.WriteLine(""); Console.WriteLine("Extraktion der PDF Zeichnungen wird gestartet: " + start.ToShortTimeString()); Console.WriteLine(""); DirectoryInfo diretoryInfo = new DirectoryInfo(pdfPath); DirectoryInfo[] directories = diretoryInfo.GetDirectories(); Console.WriteLine(""); Console.WriteLine("Es wurden " + directories.Length + " verschiedende Verzeichnisse gefunden."); Console.WriteLine(""); List<string> filenamesPDF = Directory.GetFiles(pdfPath, "*.pdf*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); List<string> filenamesOutput = Directory.GetFiles(outputPath, "*.*", SearchOption.AllDirectories).Select(x => Path.GetFullPath(x)).ToList(); Console.WriteLine(""); Console.WriteLine("Es wurden " + filenamesPDF.Count + " verschiedende PDF Zeichnungen gefunden."); Console.WriteLine(""); List<string> newFileNames = new List<string>(); int cutLength = pdfPath.Length; for (int i = 0; i < filenamesPDF.Count; i++) { string temp = filenamesPDF[i].Remove(0, cutLength); temp = outputPath + temp; temp = temp.Replace("pdf", "jpg"); newFileNames.Add(temp); } for (int i = 0; i < filenamesPDF.Count; i++) { FileInfo fi = new FileInfo(newFileNames[i]); if (!fi.Exists) { if (!Directory.Exists(fi.DirectoryName)) { Directory.CreateDirectory(fi.DirectoryName); } Bitmap firstPage = new Pdf2Image(filenamesPDF[i], settings).GetImage(); firstPage.Save(newFileNames[i], System.Drawing.Imaging.ImageFormat.Jpeg); firstPage.Dispose(); } //if (i % 20 == 0) //{ // GC.Collect(); // GC.WaitForPendingFinalizers(); //} } Console.ReadLine(); } private static Pdf2ImageSettings GetPDFSettings() { Pdf2ImageSettings settings; settings = new Pdf2ImageSettings(); settings.AntiAliasMode = AntiAliasMode.Medium; settings.Dpi = 150; settings.GridFitMode = GridFitMode.Topological; settings.ImageFormat = ImageFormat.Png24; settings.TrimMode = PdfTrimMode.CropBox; return settings; } } } unfortunately, I always get in the Pdf2Image.cs an out of memory exception. here the code: public Bitmap GetImage(int pageNumber) { Bitmap result; string workFile; //if (pageNumber < 1 || pageNumber > this.PageCount) // throw new ArgumentException("Page number is out of bounds", "pageNumber"); if (pageNumber < 1) throw new ArgumentException("Page number is out of bounds", "pageNumber"); workFile = Path.GetTempFileName(); try { this.ConvertPdfPageToImage(workFile, pageNumber); using (FileStream stream = new FileStream(workFile, FileMode.Open, FileAccess.Read)) { result = new Bitmap(stream); // --->>> here is the out of memory exception stream.Close(); stream.Dispose(); } } finally { File.Delete(workFile); } return result; } how can I fix that to avoid this exception? thanks for any help, tro

    Read the article

  • JQuery form submit Question?

    - by SLAPme
    I'm kind of new to JQuery and was wondering how can I have the following text appear when the user submits there changes <p>Your changes have been saved.</p>? How do I fix my code so it displays this message? JQuery script. $(function() { $(".save-button").click(function() { $.post($("#contact-form").attr("action"), $("#contact-form").serialize(), function(html) { $("div.contact-info-form").html(html); }); return false; // prevent normal submit }); }); Here is the html. <div id="contact-info-form" class="form-content"> <h2>Contact Information</h2> <form method="post" action="index.php" id="contact-form"> <fieldset> <ul> <li><label for="address">Address 1: </label><input type="text" name="address" id="address" size="25" class="input-size" value="<?php if (isset($_POST['address'])) { echo $_POST['address']; } else if(!empty($address)) { echo $address; } ?>" /></li> <li><label for="address_two">Address 2: </label><input type="text" name="address_two" id="address_two" size="25" class="input-size" value="<?php if (isset($_POST['address_two'])) { echo $_POST['address_two']; } else if(!empty($address_two)) { echo $address_two; } ?>" /></li> <li><label for="city_town">City/Town: </label><input type="text" name="city_town" id="city_town" size="25" class="input-size" value="<?php if (isset($_POST['city_town'])) { echo $_POST['city_town']; } else if(!empty($city_town)) { echo $city_town; } ?>" /></li> <li><label for="state_province">State/Province: </label> <?php echo '<select name="state_province" id="state_province">' . "\n"; foreach($state_options as $option) { if ($option == $state_province) { echo '<option value="' . $option . '" selected="selected">' . $option . '</option>' . "\n"; } else { echo '<option value="'. $option . '">' . $option . '</option>'."\n"; } } echo '</select>'; ?> </li> <li><label for="zipcode">Zip/Post Code: </label><input type="text" name="zipcode" id="zipcode" size="5" class="input-size" value="<?php if (isset($_POST['zipcode'])) { echo $_POST['zipcode']; } else if(!empty($zipcode)) { echo $zipcode; } ?>" /></li> <li><label for="country">Country: </label> <?php echo '<select name="country" id="country">' . "\n"; foreach($countries as $option) { if ($option == $country) { echo '<option value="' . $option . '" selected="selected">' . $option . '</option>' . "\n"; } else if($option == "-------------") { echo '<option value="' . $option . '" disabled="disabled">' . $option . '</option>'; } else { echo '<option value="'. $option . '">' . $option . '</option>'."\n"; } } echo '</select>'; ?> </li> <li><label for="email">Email Address: </label><input type="text" name="email" id="email" size="25" class="input-size" value="<?php if (isset($_POST['email'])) { echo $_POST['email']; } else if(!empty($email)) { echo $email; } ?>" /><br /><span>We don't spam or share your email with third parties. We respect your privacy.</span></li> <li><p>Changes have been saved</p><input type="submit" name="submit" value="Save Changes" class="save-button" /> <input type="hidden" name="contact_info_submitted" value="true" /> <input type="submit" name="submit" value="Preview Changes" class="preview-changes-button" /></li> </ul> </fieldset> </form> </div>

    Read the article

  • Firefox and TinyMCE 3.4.9 won't play nice together

    - by Patricia
    I've submitted a bug to the tinyMCE people, but i'm hoping someone else has come across this and has a suitable workaround. Here's the situation: I've got a form with a tinyMCE control that i load into a jquery dialog. it works great the first time, then after they close it, and open a new one. any interaction with the tinyMCE control gives: "Node cannot be used in a document other than the one in which it was created" it also doesn't fill the control with the text it's supposed to be prepopulated with. In my jquery dialogs i have the following scripts in my beforeClose handler: if (typeof tinyMCE != 'undefined') { $(this).find(':tinymce').each(function () { var theMce = $(this); tinyMCE.execCommand('mceFocus', false, theMce.attr('id')); tinyMCE.execCommand('mceRemoveControl', false, theMce.attr('id')); $(this).remove(); }); } and here's my tinyMCE setup script: $('#' + controlId).tinymce({ script_url: v2ScriptPaths.TinyMCEPath, mode: "none", elements: controlId, theme: "advanced", plugins: "paste", paste_retain_style_properties: "*", theme_advanced_toolbar_location: "top", theme_advanced_buttons1: "bold, italic, underline, strikethrough, separator, justifyleft, justifycenter, justifyright, justifyfull, indent, outdent, separator, undo, redo, separator, numlist, bullist, hr, link, unlink,removeformat", theme_advanced_buttons2: "fontsizeselect, forecolor, backcolor, charmap, pastetext,pasteword,selectall, sub, sup", theme_advanced_buttons3: "", language: v2LocalizedSettings.languageCode, gecko_spellcheck : true, onchange_callback: function (editor) { tinyMCE.triggerSave(); }, setup: function (editor) { editor.onInit.add(function (editor, event) { if (typeof v2SetInitialContent == 'function') { v2SetInitialContent(); } }) } }); is there anything obvious here? i've got all that complicated removal stuff in the close b/c tinymce doesn't like having it's html removed without it being removed. the setInitialContent() stuff is just so i can pre-load it with their email signature if they have one. it's broken with or without that code so that's not the problem. i was forced to update to 3.4.9 because of this issue: http://www.tinymce.com/forum/viewtopic.php?id=28400 so if someone can solve that, it would help this situation to. I have tried the suggestion from aknosis with no luck. EDIT: I originally thought this only affected firefox 11, but i have downloaded 10, and it is also affected. EDIT: Ok, i've trimmed down all my convoluted dynamic forms and links that cause this into a fairly simple example. the code for the base page: <a href="<%=Url.Action(MVC.Temp.GetRTEDialogContent)%>" id="TestSendEmailDialog">Get Dialog</a> <div id="TestDialog"></div> <script type="text/javascript"> $('#TestSendEmailDialog').click(function (e) { e.preventDefault(); var theDialog = buildADialog('Test', 500, 800, 'TestDialog'); theDialog.dialog('open'); theDialog.empty().load($(this).attr('href'), function () { }); }); function buildADialog(title, height, width, dialogId, maxHeight) { var customDialog = $('#' + dialogId); customDialog.dialog('destory'); customDialog.dialog({ title: title, autoOpen: false, height: height, modal: true, width: width, close: function (ev, ui) { $(this).dialog("destroy"); $(this).empty(); }, beforeClose: function (event, ui) { if (typeof tinyMCE != 'undefined') { $(this).find(':tinymce').each(function () { var theMce = $(this); tinyMCE.execCommand('mceFocus', false, theMce.attr('id')); tinyMCE.execCommand('mceRemoveControl', false, theMce.attr('id')); $(this).remove(); }); } } }); return customDialog; } </script> and the code for the page that is loaded into the dialog: <form id="SendAnEmailForm" name="SendAnEmailForm" enctype="multipart/form-data" method="post"> <textarea cols="50" id="MessageBody" name="MessageBody" rows="10" style="width: 710px; height:200px;"></textarea> </form> <script type="text/javascript"> $(function () { $('#MessageBody').tinymce({ script_url: v2ScriptPaths.TinyMCEPath, mode: "exact", elements: 'MessageBody', theme: "advanced", plugins: "paste, preview", paste_retain_style_properties: "*", theme_advanced_toolbar_location: "top", theme_advanced_buttons1: "bold, italic, underline, strikethrough, separator, justifyleft, justifycenter, justifyright, justifyfull, indent, outdent, separator, undo, redo, separator, numlist, bullist, hr, link, unlink,removeformat", theme_advanced_buttons2: "fontsizeselect, forecolor, backcolor, charmap, pastetext,pasteword,selectall, sub, sup, preview", theme_advanced_buttons3: "", language: 'EN', gecko_spellcheck: true, onchange_callback: function (editor) { tinyMCE.triggerSave(); } }); }); </script> a very interesting thing i noticed, if i move the tinyMCE setup into the load callback, it seems to work. this isn't really a solution though, because when i'm loading dialogs, i don't know in the code ahead of time if it has tinyMCE controls or not!

    Read the article

  • Problem with From field in contact form and mail() function

    - by Matthew
    I've got a contact form with 3 fields and a textarea... I use jQuery to validate it and then php to send emails. This contact form works fine but, when I receive an email, From field isn't correct. I'd like to want that From field shows text typed in the Name field of the contact form. Now I get a From field like this: <[email protected]> For example, if an user types "Matthew" in the name field, I'd like to want that this word "Matthew" appears in the From field. This is my code (XHTML, jQuery, PHP): <div id="contact"> <h3 id="formHeader">Send Us a Message!</h3> <form id="contactForm" method="post" action=""> <div id="risposta"></div> <!-- End Risposta Div --> <span>Name:</span> <input type="text" id="formName" value="" /><br /> <span>E-mail:</span> <input type="text" id="formEmail" value="" /><br /> <span>Subject:</span> <input type="text" id="formSubject" value="" /><br /> <span>Message:</span> <textarea id="formMessage" rows="9" cols="20"></textarea><br /> <input type="submit" id="formSend" value="Send" /> </form> </div> <script type="text/javascript"> $(document).ready(function(){ $("#formSend").click(function(){ var valid = ''; var nome = $("#formName").val(); var mail = $("#formEmail").val(); var oggetto = $("#formSubject").val(); var messaggio = $("#formMessage").val(); if (nome.length<1) { valid += '<span>Name field empty.</span><br />'; } if (!mail.match(/^([a-z0-9._-]+@[a-z0-9._-]+\.[a-z]{2,4}$)/i)) { valid += '<span>Email not valid or empty field.</span><br />'; } if (oggetto.length<1) { valid += '<span>Subject field empty.</span><br />'; } if (valid!='') { $("#risposta").fadeIn("slow"); $("#risposta").html("<span><b>Error:</b></span><br />"+valid); $("#risposta").css("background-color","#ffc0c0"); } else { var datastr ='nome=' + nome + '&mail=' + mail + '&oggetto=' + oggetto + '&messaggio=' + encodeURIComponent(messaggio); $("#risposta").css("display", "block"); $("#risposta").css("background-color","#FFFFA0"); $("#risposta").html("<span>Sending message...</span>"); $("#risposta").fadeIn("slow"); setTimeout("send('"+datastr+"')",2000); } return false; }); }); function send(datastr){ $.ajax({ type: "POST", url: "contactForm.php", data: datastr, cache: false, success: function(html) { $("#risposta").fadeIn("slow"); $("#risposta").html('<span>Message successfully sent.</span>'); $("#risposta").css("background-color","#e1ffc0"); setTimeout('$("#risposta").fadeOut("slow")',2000); } }); } </script> <?php $mail = $_POST['mail']; $nome = $_POST['nome']; $oggetto = $_POST['oggetto']; $text = $_POST['messaggio']; $ip = $_SERVER['REMOTE_ADDR']; $to = "[email protected]"; $message = $text."<br /><br />IP: ".$ip."<br />"; $headers = "From: $nome \n"; $headers .= "Reply-To: $mail \n"; $headers .= "MIME-Version: 1.0 \n"; $headers .= "Content-Type: text/html; charset=UTF-8 \n"; mail($to, $oggetto, $message, $headers); ?>

    Read the article

  • asp.net - csharp - jquery - looking for a better and usage solution

    - by LostLord
    hi my dear friends i have a little problem about using jquery...(i reeally do not know jquery but i forced to use it) i am using vs 2008 - asp.net web app with c# also i am using telerik controls in my pages also i am using sqldatasources (Connecting to storedprocedures) in my pages my pages base on master and content pages and in content pages i have mutiviews ================================================================================= in one of the views(inside one of those multiviews)i had made two radcombo boxes for country and city requirement like cascading dropdowns as parent and child combo boxes. i used old way for doing that , i mean i used update panel and in the SelectedIndexChange Event of Parent RadComboBox(Country) i Wrote this code : protected void RadcomboboxCountry_SelectedIndexChanged(object o, RadComboBoxSelectedIndexChangedEventArgs e) { hfSelectedCo_ID.Value = RadcomboboxCountry.SelectedValue; RadcomboboxCity.Items.Clear(); RadcomboboxCity.Items.Add(new RadComboBoxItem(" ...", "5")); RadcomboboxCity.DataBind(); RadcomboboxCity.SelectedIndex = 0; } my child radcombo box can fill by upper code , let me tell you how : the child sqldatasource have a sp that has a parameter and i fill that parameter by this line - hfSelectedCo_ID.Value = RadcbCoNameInInsert.SelectedValue; RadcbCoNameInInsert.SelectedValue means country ID. after doing that SelectedIndexChange Event of Parent RadComboBox(Country) could not be fire therefore i forced to set the autopostback property to true. afetr doing that every thing was ok until some one told me can u control focus and keydown of your radcombo boxes (when u press enter key on the parent combobox[country] , so child combobox gets focus -- and when u press upperkey on child radcombobox [city], so parent combobox[country] gets focus) (For Users That Do Not Want To Use Mouse for Input Info And Choose items) i told him this is web app , not win form and we can not do that. i googled it and i found jquery the only way for doing that ... so i started using jquery . i wrote this code with jquery for both of them : <script src="../JQuery/jquery-1.4.1.js" language="javascript" type="text/javascript"></script> <script type="text/javascript"> $(function() { $('input[id$=RadcomboboxCountry_Input]').focus(); $('input[id$=RadcomboboxCountry_Input]').select(); $('input[id$=RadcomboboxCountry_Input]').bind('keyup', function(e) { var code = (e.keyCode ? e.keyCode : e.which); if (code == 13) { -----------> Enter Key $('input[id$=RadcomboboxCity_Input]').focus(); $('input[id$=RadcomboboxCity_Input]').select(); } }); $('input[id$=RadcomboboxCity_Input]').bind('keyup', function(e) { var code = (e.keyCode ? e.keyCode : e.which); if (code == 38) { -----------> Upper Key $('input[id$=RadcomboboxCountry_Input]').focus(); $('input[id$=RadcomboboxCountry_Input]').select(); } }); }); </script> this jquery code worked BBBBBBUUUUUUUTTTTTT autopostback=true of the Parent RadComboBox Became A Problem , Because when SelectedIndex Change Of ParentRadComboBox is fired after that Telerik Skins runs and after that i lost parent ComboBox Focus and we should use mouse but we don't want it.... for fix this problem i decided to set autopostback of perentCB to false and convert protected void RadcomboboxCountry_SelectedIndexChanged(object o, RadComboBoxSelectedIndexChangedEventArgs e) { hfSelectedCo_ID.Value = RadcomboboxCountry.SelectedValue; RadcomboboxCity.Items.Clear(); RadcomboboxCity.Items.Add(new RadComboBoxItem(" ...", "5")); RadcomboboxCity.DataBind(); RadcomboboxCity.SelectedIndex = 0; } to a public non static method without parameters and call it with jquey like this : (i used onclientchanged property of parentcombo box like onclientchanged = "MyMethodForParentCB_InJquery();" insread of selectedindexchange event) public void MyMethodForParentCB_InCodeBehind() { hfSelectedCo_ID.Value = RadcomboboxCountry.SelectedValue; RadcomboboxCity.Items.Clear(); RadcomboboxCity.Items.Add(new RadComboBoxItem(" ...", "5")); RadcomboboxCity.DataBind(); RadcomboboxCity.SelectedIndex = 0; } for doing that i read the blow manual and do that step by step : ======================================================================= http://www.ajaxprojects.com/ajax/tutorialdetails.php?itemid=732 ======================================================================= but this manual is about static methods and this is my new problem ... when i am using static method like : public static void MyMethodForParentCB_InCodeBehind() { hfSelectedCo_ID.Value = RadcomboboxCountry.SelectedValue; RadcomboboxCity.Items.Clear(); RadcomboboxCity.Items.Add(new RadComboBoxItem(" ...", "5")); RadcomboboxCity.DataBind(); RadcomboboxCity.SelectedIndex = 0; } so i recieved some errors and this method could not recognize my controls and hidden field... one of those errors like this : Error 2 An object reference is required for the non-static field, method, or property 'Darman.SuperAdmin.Users.hfSelectedCo_ID' C:\Javad\Copy of Darman 6\Darman\SuperAdmin\Users.aspx.cs 231 13 Darman any idea or is there any way to call non static methods with jquery (i know we can not do that but is there another way to solve my problem)???????????????

    Read the article

  • JQuery text display problem?

    - by SLAPme
    Kind of new to JQuery and I was wondering how can I state that the users submitted info was saved when they click the submit button by displaying the message Changes saved at the top of the form and then have it disappear when the user leaves the web page and return back to it? Right now my code only displays that changes were saved at the bottom of the form outside of the lists and will not disappear when the users leave the web page and return back to it. Here is the JQuery code. $(function() { $(".save-button").click(function() { $.post($("#contact-form").attr("action"), $("#contact-form").serialize(), function(html) { $("div.contact-info-form").html(html); $('#contact-form').append('<li>Changes saved!</li>'); }); return false; // prevent normal submit }); }); Here is the html code. <div id="contact-info-form" class="form-content"> <h2>Contact Information</h2> <form method="post" action="index.php" id="contact-form"> <fieldset> <ul> <li><label for="address">Address 1: </label><input type="text" name="address" id="address" size="25" class="input-size" value="<?php if (isset($_POST['address'])) { echo $_POST['address']; } else if(!empty($address)) { echo $address; } ?>" /></li> <li><label for="address_two">Address 2: </label><input type="text" name="address_two" id="address_two" size="25" class="input-size" value="<?php if (isset($_POST['address_two'])) { echo $_POST['address_two']; } else if(!empty($address_two)) { echo $address_two; } ?>" /></li> <li><label for="city_town">City/Town: </label><input type="text" name="city_town" id="city_town" size="25" class="input-size" value="<?php if (isset($_POST['city_town'])) { echo $_POST['city_town']; } else if(!empty($city_town)) { echo $city_town; } ?>" /></li> <li><label for="state_province">State/Province: </label> <?php echo '<select name="state_province" id="state_province">' . "\n"; foreach($state_options as $option) { if ($option == $state_province) { echo '<option value="' . $option . '" selected="selected">' . $option . '</option>' . "\n"; } else { echo '<option value="'. $option . '">' . $option . '</option>'."\n"; } } echo '</select>'; ?> </li> <li><label for="zipcode">Zip/Post Code: </label><input type="text" name="zipcode" id="zipcode" size="5" class="input-size" value="<?php if (isset($_POST['zipcode'])) { echo $_POST['zipcode']; } else if(!empty($zipcode)) { echo $zipcode; } ?>" /></li> <li><label for="country">Country: </label> <?php echo '<select name="country" id="country">' . "\n"; foreach($countries as $option) { if ($option == $country) { echo '<option value="' . $option . '" selected="selected">' . $option . '</option>' . "\n"; } else if($option == "-------------") { echo '<option value="' . $option . '" disabled="disabled">' . $option . '</option>'; } else { echo '<option value="'. $option . '">' . $option . '</option>'."\n"; } } echo '</select>'; ?> </li> <li><label for="email">Email Address: </label><input type="text" name="email" id="email" size="25" class="input-size" value="<?php if (isset($_POST['email'])) { echo $_POST['email']; } else if(!empty($email)) { echo $email; } ?>" /><br /><span>We don't spam or share your email with third parties. We respect your privacy.</span></li> <li><input type="submit" name="submit" value="Save Changes" class="save-button" /> <input type="hidden" name="contact_info_submitted" value="true" /> <input type="submit" name="submit" value="Preview Changes" class="preview-changes-button" /></li> </ul> </fieldset> </form> </div>

    Read the article

  • Lazy loading of child throwing session error

    - by Thomas Buckley
    I'm the following error when calling purchaseService.updatePurchase(purchase) inside my TagController: SEVERE: Servlet.service() for servlet [PurchaseAPIServer] in context with path [/PurchaseAPIServer] threw exception [Request processing failed; nested exception is org.hibernate.LazyInitializationException: failed to lazily initialize a collection of role: com.app.model.Purchase.tags, no session or session was closed] with root cause org.hibernate.LazyInitializationException: failed to lazily initialize a collection of role: com.app.model.Purchase.tags, no session or session was closed at org.hibernate.collection.AbstractPersistentCollection.throwLazyInitializationException(AbstractPersistentCollection.java:383) at org.hibernate.collection.AbstractPersistentCollection.throwLazyInitializationExceptionIfNotConnected(AbstractPersistentCollection.java:375) at org.hibernate.collection.AbstractPersistentCollection.initialize(AbstractPersistentCollection.java:368) at org.hibernate.collection.PersistentSet.add(PersistentSet.java:212) at com.app.model.Purchase.addTags(Purchase.java:207) at com.app.controller.TagController.createAll(TagController.java:79) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.springframework.web.method.support.InvocableHandlerMethod.invoke(InvocableHandlerMethod.java:212) at org.springframework.web.method.support.InvocableHandlerMethod.invokeForRequest(InvocableHandlerMethod.java:126) at org.springframework.web.servlet.mvc.method.annotation.ServletInvocableHandlerMethod.invokeAndHandle(ServletInvocableHandlerMethod.java:96) at org.springframework.web.servlet.mvc.method.annotation.RequestMappingHandlerAdapter.invokeHandlerMethod(RequestMappingHandlerAdapter.java:617) at org.springframework.web.servlet.mvc.method.annotation.RequestMappingHandlerAdapter.handleInternal(RequestMappingHandlerAdapter.java:578) at org.springframework.web.servlet.mvc.method.AbstractHandlerMethodAdapter.handle(AbstractHandlerMethodAdapter.java:80) at org.springframework.web.servlet.DispatcherServlet.doDispatch(DispatcherServlet.java:900) at org.springframework.web.servlet.DispatcherServlet.doService(DispatcherServlet.java:827) at org.springframework.web.servlet.FrameworkServlet.processRequest(FrameworkServlet.java:882) at org.springframework.web.servlet.FrameworkServlet.doPost(FrameworkServlet.java:789) at javax.servlet.http.HttpServlet.service(HttpServlet.java:641) at javax.servlet.http.HttpServlet.service(HttpServlet.java:722) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:305) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:210) at org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.java:225) at org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.java:169) at org.apache.catalina.authenticator.AuthenticatorBase.invoke(AuthenticatorBase.java:472) at org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:168) at org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:98) at org.apache.catalina.valves.AccessLogValve.invoke(AccessLogValve.java:927) at org.apache.catalina.core.StandardEngineValve.invoke(StandardEngineValve.java:118) at org.apache.catalina.connector.CoyoteAdapter.service(CoyoteAdapter.java:407) at org.apache.coyote.http11.AbstractHttp11Processor.process(AbstractHttp11Processor.java:999) at org.apache.coyote.AbstractProtocol$AbstractConnectionHandler.process(AbstractProtocol.java:565) at org.apache.tomcat.util.net.JIoEndpoint$SocketProcessor.run(JIoEndpoint.java:309) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:662) TagController: @RequestMapping(value = "purchases/{purchaseId}/tags", method = RequestMethod.POST, params = "manyTags") @ResponseStatus(HttpStatus.CREATED) public void createAll(@PathVariable("purchaseId") final Long purchaseId, @RequestBody final Tag[] entities) { Purchase purchase = purchaseService.getById(purchaseId); Set<Tag> tags = new HashSet<Tag>(Arrays.asList(entities)); purchase.addTags(tags); purchaseService.updatePurchase(purchase); } Purchase: @Entity @XmlRootElement public class Purchase implements Serializable { /** * */ private static final long serialVersionUID = 6603477834338392140L; @Id @GeneratedValue(strategy = GenerationType.AUTO) private Long id; @OneToMany(mappedBy = "purchase", fetch = FetchType.LAZY, cascade={CascadeType.ALL}) private Set<Tag> tags; @JsonIgnore public Set<Tag> getTags() { if (tags == null) { tags = new LinkedHashSet<Tag>(); } return tags; } public void setTags(Set<Tag> tags) { this.tags = tags; } ... } Tag: @Entity @XmlRootElement public class Tag implements Serializable { /** * */ private static final long serialVersionUID = 5165922776051697002L; @Id @GeneratedValue(strategy = GenerationType.AUTO) private Long id; @ManyToOne(fetch = FetchType.LAZY) @JoinColumns({@JoinColumn(name = "PURCHASEID", referencedColumnName = "ID")}) private Purchase purchase; @JsonIgnore public Purchase getPurchase() { return purchase; } public void setPurchase(Purchase purchase) { this.purchase = purchase; } } PurchaseService: @Service public class PurchaseService implements IPurchaseService { @Autowired private IPurchaseDAO purchaseDAO; public PurchaseService() { } @Transactional public List<Purchase> getAll() { return purchaseDAO.findAll(); } @Transactional public Purchase getById(Long id) { return purchaseDAO.findOne(id); } @Transactional public void addPurchase(Purchase purchase) { purchaseDAO.save(purchase); } @Transactional public void updatePurchase(Purchase purchase) { purchaseDAO.update(purchase); } } TagService: @Service public class TagService implements ITagService { @Autowired private ITagDAO tagDAO; public TagService() { } @Transactional public List<Tag> getAll() { return tagDAO.findAll(); } @Transactional public Tag getById(Long id) { return tagDAO.findOne(id); } @Transactional public void addTag(Tag tag) { tagDAO.save(tag); } @Transactional public void updateTag(Tag tag) { tagDAO.update(tag); } } Any ideas on how I can fix this? (I want to avoid using EAGER loading). Do I need to setup some form of session management for transactions? Thanks

    Read the article

  • -(void)... does not work/appeal (iOS)

    - by user1012535
    Hi I've got a problem with my -(void) in my Xcode project for iOS. First of all here is the code ViewController.h #import <UIKit/UIKit.h> @interface ViewController : UIViewController { IBOutlet UIWebView *webview; IBOutlet UIActivityIndicatorView *active; UIAlertView *alert_start; UIAlertView *alert_error; } -(IBAction)tele_button:(id)sender; -(IBAction)mail_button:(id)sender; -(IBAction)web_button:(id)sender; -(IBAction)news_button:(id)sender; @end ViewController.m #import "ViewController.h" @implementation ViewController - (void)didReceiveMemoryWarning { [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } #pragma mark - View lifecycle - (void)viewDidLoad { [super viewDidLoad]; //Stop Bounce for WebView for (id subview in webview.subviews) if ([[subview class] isSubclassOfClass: [UIScrollView class]]) ((UIScrollView *)subview).bounces = NO; //First Start Alert [alert_start show]; NSLog(@"first alert"); NSString *start_alert = [[NSUserDefaults standardUserDefaults] objectForKey:@"alert_start"]; if(start_alert == nil) { [[NSUserDefaults standardUserDefaults] setValue:@"1" forKey:@"alert_start"]; [[NSUserDefaults standardUserDefaults] synchronize]; UIAlertView *alert_start = [[UIAlertView alloc] initWithTitle:@"iOptibelt" message:@"On some points this application need a internet connection." delegate:self cancelButtonTitle:@"OK" otherButtonTitles:nil]; [alert_start show]; [alert_start release]; } // Do any additional setup after loading the view, typically from a nib. [webview loadRequest:[NSURLRequest requestWithURL:[NSURL fileURLWithPath:[[NSBundle mainBundle] pathForResource:@"home-de" ofType:@"html"]isDirectory:NO]]]; NSLog(@"webview fertig"); } -(void)webViewDidStartLoad:(UIWebView *) webview { [UIApplication sharedApplication].networkActivityIndicatorVisible = YES; [active startAnimating]; NSLog(@"lade"); } -(void)webViewDidFinishLoad:(UIWebView *) webview { [UIApplication sharedApplication].networkActivityIndicatorVisible = NO; [active stopAnimating]; NSLog(@"fertig"); } -(void)webView: (UIWebView *) webview didFailLoadWithError:(NSError *)error{ NSLog(@"lade error"); UIAlertView *alert_error = [[UIAlertView alloc] initWithTitle:@"Error" message:@"Can't connect. Please check your internet Connection" delegate:self cancelButtonTitle:@"OK" otherButtonTitles:nil]; [alert_error show]; [alert_error release]; }; - (IBAction)tele_button:(id)sender{ NSLog(@"it's connected!"); //Local HTML Call Button NSURLRequest *theRequest = [NSURLRequest requestWithURL:[NSURL fileURLWithPath:[[NSBundle mainBundle] pathForResource:@"phone" ofType:@"html"]isDirectory:NO]]; [webview loadRequest:theRequest]; } - (IBAction)mail_button:(id)sender{ NSLog(@"it's connected!"); //Mail App Mail Button [[UIApplication sharedApplication] openURL:[NSURL URLWithString:@"mailto://[email protected]"]]; } - (IBAction)web_button:(id)sender{ NSLog(@"it's connected!"); //Local HTML Button NSURLRequest *theRequest = [NSURLRequest requestWithURL:[NSURL URLWithString: @"http://optibelt.com"]]; [webview loadRequest:theRequest]; } - (IBAction)news_button:(id)sender{ NSLog(@"it's connected!"); //local Home Button NSURLRequest *theRequest = [NSURLRequest requestWithURL:[NSURL fileURLWithPath:[[NSBundle mainBundle] pathForResource:@"home-de" ofType:@"html"]isDirectory:NO]]; [webview loadRequest:theRequest]; } - (void)viewDidUnload { [super viewDidUnload]; // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)viewWillAppear:(BOOL)animated { [super viewWillAppear:animated]; } - (void)viewDidAppear:(BOOL)animated { [super viewDidAppear:animated]; } - (void)viewWillDisappear:(BOOL)animated { [super viewWillDisappear:animated]; } - (void)viewDidDisappear:(BOOL)animated { [super viewDidDisappear:animated]; } - (BOOL)shouldAutorotateToInterfaceOrientation:(UIInterfaceOrientation)interfaceOrientation { // Return YES for supported orientations return (interfaceOrientation != UIInterfaceOrientationPortraitUpsideDown); } @end At last my 3. -(void) does not work and i ve no more idea what could be the problem.... -(void)webViewDidStartLoad:(UIWebView *) webview { [UIApplication sharedApplication].networkActivityIndicatorVisible = YES; [active startAnimating]; NSLog(@"lade"); } -(void)webViewDidFinishLoad:(UIWebView *) webview { [UIApplication sharedApplication].networkActivityIndicatorVisible = NO; [active stopAnimating]; NSLog(@"fertig"); } -(void)webView: (UIWebView *) webview didFailLoadWithError:(NSError *)error{ NSLog(@"lade error"); UIAlertView *alert_error = [[UIAlertView alloc] initWithTitle:@"Error" message:@"Can't connect. Please check your internet Connection" delegate:self cancelButtonTitle:@"OK" otherButtonTitles:nil]; [alert_error show]; [alert_error release];

    Read the article

  • How to add Category in DotClear blog with HttpWebRequest or MetaWeblog API

    - by Pitming
    I'm trying to create/modify dotclear blogs. For most of the options, i use XmlRpc API (DotClear.MetaWeblog). But didn't find any way to handle categories. So I start to look at the Http packet and try to do "the same as the browser". Here si the method I use to "Http POST" protected HttpStatusCode HttpPost(Uri url_, string data_, bool allowAutoRedirect_) { HttpWebRequest Request; HttpWebResponse Response = null; Stream ResponseStream = null; Request = (System.Net.HttpWebRequest)HttpWebRequest.Create(url_); Request.UserAgent = "Mozilla/5.0 (Windows; U; Windows NT 5.1; fr; rv:1.9.1.5) Gecko/20091102 Firefox/3.5.5 (.NET CLR 3.5.30729)"; Request.Accept = "text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8"; Request.AllowAutoRedirect = allowAutoRedirect_; // Add the network credentials to the request. Request.Credentials = new NetworkCredential(Username, Password); string authInfo = Username + ":" + Password; authInfo = Convert.ToBase64String(Encoding.Default.GetBytes(authInfo)); Request.Headers["Authorization"] = "Basic " + authInfo; Request.Method = "POST"; Request.CookieContainer = Cookies; if(ConnectionCookie!=null) Request.CookieContainer.Add(url_, ConnectionCookie); if (dcAdminCookie != null) Request.CookieContainer.Add(url_, dcAdminCookie); Request.PreAuthenticate = true; ASCIIEncoding encoding = new ASCIIEncoding(); string postData = data_; byte[] data = encoding.GetBytes(postData); //Encoding.UTF8.GetBytes(data_); //encoding.GetBytes(postData); Request.ContentLength = data.Length; Request.ContentType = "application/x-www-form-urlencoded"; Stream newStream = Request.GetRequestStream(); // Send the data. newStream.Write(data, 0, data.Length); newStream.Close(); try { // get the response from the server. Response = (HttpWebResponse)Request.GetResponse(); if (!allowAutoRedirect_) { foreach (Cookie c in Response.Cookies) { if (c.Name == "dcxd") ConnectionCookie = c; if (c.Name == "dc_admin") dcAdminCookie = c; } Cookies.Add(Response.Cookies); } // Get the response stream. ResponseStream = Response.GetResponseStream(); // Pipes the stream to a higher level stream reader with the required encoding format. StreamReader readStream = new StreamReader(ResponseStream, Encoding.UTF8); string result = readStream.ReadToEnd(); if (Request.RequestUri == Response.ResponseUri) { _log.InfoFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } else { _log.WarnFormat("RequestUri:{0}\r\nResponseUri:{1}\r\nstatus code:{2} Status descr:{3}", Request.RequestUri, Response.ResponseUri, Response.StatusCode, Response.StatusDescription); } } catch (WebException wex) { Response = wex.Response as HttpWebResponse; if (Response != null) { _log.ErrorFormat("{0} ==&gt; {1}({2})", Request.RequestUri, Response.StatusCode, Response.StatusDescription); } Request.Abort(); } finally { if (Response != null) { // Releases the resources of the response. Response.Close(); } } if(Response !=null) return Response.StatusCode; return HttpStatusCode.Ambiguous; } So the first thing to do is to Authenticate as admin. Here is the code: protected bool HttpAuthenticate() { Uri u = new Uri(this.Url); Uri url = new Uri(string.Format("{0}/admin/auth.php", u.GetLeftPart(UriPartial.Authority))); string data = string.Format("user_id={0}&user_pwd={1}&user_remember=1", Username, Password); var ret = HttpPost(url,data,false); return (ret == HttpStatusCode.OK || ret==HttpStatusCode.Found); } 3.Now that I'm authenticate, i need to get a xd_chek info (that i can find on the page so basically it's a GET on /admin/category.php + Regex("dotclear[.]nonce = '(.*)'")) 4.so I'm authenticate and have the xd_check info. The last thing to do seems to post the next category. But of course it does not work at all... here is the code: string postData = string.Format("cat_title={0}&new_cat_parent={1}&xd_check={2}", category_, 0, xdCheck); HttpPost(url, postData, true); If anyone can help me and explain were is it wrong ? thanks in advance.

    Read the article

  • Formatting jquery timeline?

    - by Beginner
    I am using a timeline plugin from here This is my current code: <ul id="dates"> <li><a href="#1940s">1940s</a></li> <li><a href="#1950s" class="selected">1950s</a></li> <li><a href="#1960s">1960s</a></li> <li><a href="#1970s">1970s</a></li> <li><a href="#1980s">1980s</a></li> <li><a href="#1990s">1990s</a></li> <li><a href="#2000s">2000s</a></li> </ul> <ul id="issues"> <li id="1940s"><img src="/gfx/timeline/1950.jpg" /> <h1>1940's</h1> <p>Ronald.</p> </li> <li id="1950s"><img src="/gfx/timeline/1960.jpg" /> <h1>1950's</h1> <p>Eddy.</p> </li> <li id="1960s"><img src="/gfx/timeline/1970.jpg" /> <h1>1960's</h1> <p>1960s</p> </li> <li id="1970s"><img src="/gfx/timeline/1980.jpg" /> <h1>1970's</h1> <p>1970s</p> </li> <li id="1980s"><img src="/gfx/timeline/1990.jpg" /> <h1>1980's</h1> <p>1980s</p> </li> <li id="1990s"><img src="/gfx/timeline/1990.jpg" /> <h1>1990's</h1> <p>1990s</p> </li> <li id="2000s"><img src="/gfx/timeline/2000.jpg" /> <h1>2000s</h1> <p>2000s</p> </li> </ul> But I don't understand how I can make it look like this... Any assistance?thanks Current CSS: #timeline { width: 660px; height: 350px; overflow: hidden; margin: 100px auto; position: relative; background: url('Img/vline.png') left 65px repeat-x; } #dates { width: 660px; height: 60px; overflow: hidden; } #dates li { list-style: none; float: left; width: 100px; height: 50px; font-size: 24px; text-align: center; background: url('Img/hline.png') center bottom no-repeat; } #dates a { line-height: 38px; text-decoration:none; color:#999; font-size:15px; font-weight:bold; } #dates .selected { font-size: 38px; color:#000; } #issues { width: 660px; height: 350px; overflow: hidden; } #issues li { width: 660px; height: 350px; list-style: none; float: left; } #issues li img { float: right; margin: 100px 30px 10px 50px; } #issues li h1 { color: #999; font-size: 20px; margin: 20px 0; } #issues li p { font-size: 14px; margin-right: 70px; font-weight: normal; line-height: 22px; }

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • creating a Menu from SQLite values in Java

    - by shanahobo86
    I am trying to create a ListMenu using data from an SQLite database to define the name of each MenuItem. So in a class called menu.java I have defined the array String classes [] = {}; which should hold each menu item name. In a DBAdapter class I created a function so the user can insert info to a table (This all works fine btw). public long insertContact(String name, String code, String location, String comments, int days, int start, int end, String type) { ContentValues initialValues = new ContentValues(); initialValues.put(KEY_NAME, name); initialValues.put(KEY_CODE, code); initialValues.put(KEY_LOCATION, location); initialValues.put(KEY_COMMENTS, comments); initialValues.put(KEY_DAYS, days); initialValues.put(KEY_START, start); initialValues.put(KEY_END, end); initialValues.put(KEY_TYPE, type); return db.insert(DATABASE_TABLE, null, initialValues); } It would be the Strings inserted into KEY_NAME that I need to populate that String array with. Does anyone know if this is possible? Thanks so much for the help guys. If I implement that function by Sam/Mango the program crashes, am I using it incorrectly or is the error due to the unknown size of the array? DBAdapter db = new DBAdapter(this); String classes [] = db.getClasses(); edit: I should mention that if I manually define the array: String classes [] = {"test1", "test2", "test3", etc}; It works fine. The error is a NullPointerException Here's the logcat (sorry about the formatting). I hadn't initialized with db = helper.getReadableDatabase(); in the getClasses() function but unfortunately it didn't fix the problem. 11-11 22:53:39.117: D/dalvikvm(17856): Late-enabling CheckJNI 11-11 22:53:39.297: D/TextLayoutCache(17856): Using debug level: 0 - Debug Enabled: 0 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libGLES_android.so 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libEGL_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv1_CM_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv2_adreno200.so 11-11 22:53:39.387: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:39.407: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c66d000 size:36593664 offset:32825344 fd:65 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: D/OpenGLRenderer(17856): Enabling debug mode 0 11-11 22:53:39.477: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5ecd3000 size:40361984 offset:36593664 fd:68 11-11 22:53:40.507: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61451000 size:7254016 offset:3485696 fd:71 11-11 22:53:41.077: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:41.077: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c4c000 size:7725056 offset:7254016 fd:74 11-11 22:53:41.097: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x623aa000 size:8196096 offset:7725056 fd:80 11-11 22:53:41.937: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x62b7b000 size:8667136 offset:8196096 fd:83 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61c4c000 size:7725056 offset:7254016 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x623aa000 size:8196096 offset:7725056 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x62b7b000 size:8667136 offset:8196096 11-11 22:53:42.167: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:42.177: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c5d000 size:17084416 offset:13316096 fd:74 11-11 22:53:42.317: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x63853000 size:20852736 offset:17084416 fd:80 11-11 22:53:42.357: D/OpenGLRenderer(17856): Flushing caches (mode 0) 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5c66d000 size:36593664 offset:32825344 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5ecd3000 size:40361984 offset:36593664 11-11 22:53:42.367: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61451000 size:7254016 offset:3485696 11-11 22:53:42.757: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c56d000 size:24621056 offset:20852736 fd:65 11-11 22:53:44.247: D/AndroidRuntime(17856): Shutting down VM 11-11 22:53:44.247: W/dalvikvm(17856): threadid=1: thread exiting with uncaught exception (group=0x40ac3210) 11-11 22:53:44.257: E/AndroidRuntime(17856): FATAL EXCEPTION: main 11-11 22:53:44.257: E/AndroidRuntime(17856): java.lang.RuntimeException: Unable to instantiate activity ComponentInfo{niall.shannon.timetable/niall.shannon.timetable.menu}: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1891) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1992) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.access$600(ActivityThread.java:127) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1158) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Handler.dispatchMessage(Handler.java:99) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Looper.loop(Looper.java:137) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.main(ActivityThread.java:4441) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invokeNative(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invoke(Method.java:511) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:823) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:590) 11-11 22:53:44.257: E/AndroidRuntime(17856): at dalvik.system.NativeStart.main(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): Caused by: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.content.ContextWrapper.openOrCreateDatabase(ContextWrapper.java:221) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.database.sqlite.SQLiteOpenHelper.getWritableDatabase(SQLiteOpenHelper.java:157) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.DBAdapter.getClasses(DBAdapter.java:151) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.menu.<init>(menu.java:15) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstanceImpl(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstance(Class.java:1319) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.Instrumentation.newActivity(Instrumentation.java:1023) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1882) 11-11 22:53:44.257: E/AndroidRuntime(17856): ... 11 more 11-11 22:53:46.527: I/Process(17856): Sending signal. PID: 17856 SIG: 9

    Read the article

  • Android ksoap nested soap objects in request gives error in response

    - by Smalesy
    I'm trying to do the following soap request on Android using KSOAP. It contains a list of nested soap objects. However, I must be doing something wrong as I get an error back. The request I am trying to generate is as follows: <?xml version="1.0" encoding="utf-8"?> <soap12:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://www.w3.org/2003/05/soap-envelope"> <soap12:Body> <SetAttendanceMarks xmlns="http://hostname.net/"> <strSessionToken>string</strSessionToken> <LessonMarks> <Count>int</Count> <LessonMarks> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> </LessonMarks> </LessonMarks> </SetAttendanceMarks> </soap12:Body> </soap12:Envelope> My code is as follows: public boolean setAttendanceMarks(List<Mark> list) throws Exception { boolean result = false; String methodName = "SetAttendanceMarks"; String soapAction = getHost() + "SetAttendanceMarks"; SoapObject lessMarksN = new SoapObject(getHost(), "LessonMarks"); for (Mark m : list) { PropertyInfo smProp =new PropertyInfo(); smProp.setName("LessonMark"); smProp.setValue(m); smProp.setType(Mark.class); lessMarksN.addProperty(smProp); } PropertyInfo cProp =new PropertyInfo(); cProp.setName("Count"); cProp.setValue(list.size()); cProp.setType(Integer.class); SoapObject lessMarks = new SoapObject(getHost(), "LessonMarks"); lessMarks.addProperty(cProp); lessMarks.addSoapObject(lessMarksN); PropertyInfo sProp =new PropertyInfo(); sProp.setName("strSessionToken"); sProp.setValue(mSession); sProp.setType(String.class); SoapObject request = new SoapObject(getHost(), methodName); request.addProperty(sProp); request.addSoapObject(lessMarks); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(getURL()); androidHttpTransport.debug = true; androidHttpTransport.call(soapAction, envelope); String a = androidHttpTransport.requestDump; String b = androidHttpTransport.responseDump; SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; SoapObject res = (SoapObject) resultsRequestSOAP.getProperty(0); String resultStr = res.getPropertyAsString("Result"); if (resultStr.contentEquals("OK")) { result = true; } return result; } The error I get is as follows: <?xml version="1.0" encoding="utf-8"?><soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <soap:Body> <soap:Fault> <soap:Code> <soap:Value>soap:Sender</soap:Value> </soap:Code> <soap:Reason> <soap:Text xml:lang="en">Server was unable to read request. ---&gt; There is an error in XML document (1, 383). ---&gt; The specified type was not recognized: name='LessonMarks', namespace='http://gsdregapp.net/', at &lt;LessonMarks xmlns='http://gsdregapp.net/'&gt;.</soap:Text> </soap:Reason> <soap:Detail /> </soap:Fault> </soap:Body> </soap:Envelope> Can anybody tell me what I am doing wrong? I will be most grateful for any assistance!

    Read the article

  • Hibernate error: cannot resolve table

    - by Roman
    I'm trying to make work the example from hibernate reference. I've got simple table Pupil with id, name and age fields. I've created correct (as I think) java-class for it according to all java-beans rules. I've created configuration file - hibernate.cfg.xml, just like in the example from reference. I've created hibernate mapping for one class Pupil, and here is the error occured. <hibernate-mapping> <class name="Pupil" table="pupils"> ... </class> </hibernate-mapping> table="pupils" is red in my IDE and I see message "cannot resolve table pupils". I've also founded very strange note in reference which says that most users fail with the same problem trying to run the example. Ah.. I'm very angry with this example.. IMHO if authors know that there is such problem they should add some information about it. But, how should I fix it? I don't want to deal with Ant here and with other instruments used in example. I'm using MySql 5.0, but I think it doesn't matter. UPD: source code Pupil.java - my persistent class package domain; public class Pupil { private Integer id; private String name; private Integer age; protected Pupil () { } public Pupil (String name, int age) { this.age = age; this.name = name; } public Integer getId () { return id; } public void setId (Integer id) { this.id = id; } public String getName () { return name; } public void setName (String name) { this.name = name; } public Integer getAge () { return age; } public void setAge (Integer age) { this.age = age; } public String toString () { return "Pupil [ name = " + name + ", age = " + age + " ]"; } } Pupil.hbm.xml is mapping for this class <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="domain" > <class name="Pupil" table="pupils"> <id name="id"> <generator class="native" /> </id> <property name="name" not-null="true"/> <property name="age"/> </class> </hibernate-mapping> hibernate.cfg.xml - configuration for hibernate <hibernate-configuration> <session-factory> <!-- Database connection settings --> <property name="connection.driver_class">com.mysql.jdbc.Driver</property> <property name="connection.url">jdbc:mysql://localhost/hbm_test</property> <property name="connection.username">root</property> <property name="connection.password">root</property> <property name="connection.pool_size">1</property> <property name="dialect">org.hibernate.dialect.MySQL5Dialect</property> <property name="current_session_context_class">thread</property> <property name="show_sql">true</property> <mapping resource="domain/Pupil.hbm.xml"/> </session-factory> </hibernate-configuration> HibernateUtils.java package utils; import org.hibernate.SessionFactory; import org.hibernate.HibernateException; import org.hibernate.cfg.Configuration; public class HibernateUtils { private static final SessionFactory sessionFactory; static { try { sessionFactory = new Configuration ().configure ().buildSessionFactory (); } catch (HibernateException he) { System.err.println (he); throw new ExceptionInInitializerError (he); } } public static SessionFactory getSessionFactory () { return sessionFactory; } } Runner.java - class for testing hibernate import org.hibernate.Session; import java.util.*; import utils.HibernateUtils; import domain.Pupil; public class Runner { public static void main (String[] args) { Session s = HibernateUtils.getSessionFactory ().getCurrentSession (); s.beginTransaction (); List pups = s.createQuery ("from Pupil").list (); for (Object obj : pups) { System.out.println (obj); } s.getTransaction ().commit (); HibernateUtils.getSessionFactory ().close (); } } My libs: antlr-2.7.6.jar, asm.jar, asm-attrs.jar, cglib-2.1.3.jar, commons-collections-2.1.1.jar, commons-logging-1.0.4.jar, dom4j-1.6.1.jar, hibernate3.jar, jta.jar, log4j-1.2.11.jar, mysql-connector-java-5.1.7-bin.jar Compile error: cannot resolve table pupils

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Problem with ajax form on Codeigniter

    - by Code Burn
    Everytime I test the email is send correctly. (I have tested in PC: IE6, IE7, IE8, Safari, Firefox, Chrome. MAC: Safari, Firefox, Chrome.) Nome: Jon Doe Empresa: Star Cargo: Developer Email: [email protected] Telefone: 090909222988 Assunto: Subject here.. But I keep recieving emails like this from costumers: Nome: Empresa: Cargo: Email: Telefone: Assunto: CONTACT_FORM.PHP <form name="frm" id="frm"> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Nome<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="Cnome" id="Cnome" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Empresa<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CEmpresa" id="CEmpresa" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Cargo</div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CCargo" id="CCargo" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Email<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CEmail" id="CEmail" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Telefone</div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CTelefone" id="CTelefone" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Assunto<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><textarea class="texto textocinzaescuro" name="CAssunto" id="CAssunto" rows="2" cols="28"></textarea></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >&nbsp;</div> <div class="campoFormulario inputDeCampo" style="text-align:right;" ><input id="Cbutton" class="texto textocinzaescuro" type="submit" name="submit" value="Enviar" /></div> </form> <script type="text/javascript"> $(function() { $("#Cbutton").click(function() { if(validarForm()){ var Cnome = $("input#Cnome").val(); var CEmpresa = $("input#CEmpresa").val(); var CEmail = $("input#CEmail").val(); var CCargo = $("input#CCargo").val(); var CTelefone = $("input#CTelefone").val(); var CAssunto = $("textarea#CAssunto").val(); var dataString = 'nome='+ Cnome + '&Empresa=' + CEmpresa + '&Email=' + CEmail + '&Cargo=' + CCargo + '&Telefone=' + CTelefone + '&Assunto=' + CAssunto; //alert (dataString);return false; $.ajax({ type: "POST", url: "http://www.myserver.com/index.php/pt/envia", data: dataString, success: function() { $('#frm').remove(); $('#blocoform').append("<br />Obrigado. <img id='checkmark' src='http://www.myserver.com/public/images/estrutura/ok.gif' /><br />Será contactado brevemente.<br /><br /><br /><br /><br /><br />") .hide() .fadeIn(1500); } }); } return false; }); }); function validarForm(){ var error = 0; if(!validateNome(document.getElementById("Cnome"))){ error = 1 ;} if(!validateNome(document.getElementById("CEmpresa"))){ error = 1 ;} if(!validateEmail(document.getElementById("CEmail"))){ error = 1 ;} if(!validateNome(document.getElementById("CAssunto"))){ error = 1 ;} if(error == 0){ //frm.submit(); return true; }else{ alert('Preencha os campos correctamente.'); return false; } } function validateNome(fld){ if( fld.value.length == 0 ){ fld.style.backgroundColor = '#FFFFCC'; //alert('Descrição é um campo obrigatório.'); return false; }else { fld.style.background = 'White'; return true; } } function trim(s) { return s.replace(/^\s+|\s+$/, ''); } function validateEmail(fld) { var tfld = trim(fld.value); var emailFilter = /^[^@]+@[^@.]+\.[^@]*\w\w$/ ; var illegalChars= /[\(\)\<\>\,\;\:\\\"\[\]]/ ; if (fld.value == "") { fld.style.background = '#FFFFCC'; //alert('Email é um campo obrigatório.'); return false; } else if (!emailFilter.test(tfld)) { //alert('Email inválido.'); fld.style.background = '#FFFFCC'; return false; } else if (fld.value.match(illegalChars)) { fld.style.background = '#FFFFCC'; //alert('Email inválido.'); return false; } else { fld.style.background = 'White'; return true; } } </script> FUNCTION ENVIA (email sender): function envia() { $this->load->helper(array('form', 'url')); $nome = $_POST['nome']; $empresa = $_POST['Empresa']; $cargo = $_POST['Cargo']; $email = $_POST['Email']; $telefone = $_POST['Telefone']; $assunto = $_POST['Assunto']; $mensagem = " Nome:".$nome." Empresa:".$empresa." Cargo:".$cargo." Email:".$email." Telefone:".$telefone." Assunto:".$assunto.""; $headers = 'From: [email protected]' . "\r\n" . 'Reply-To: no-reply' . "\r\n" . 'X-Mailer: PHP/' . phpversion(); mail('[email protected]', $mensagem, $headers); }

    Read the article

  • Expression Web 4 - Master Page Error

    - by Eric J.
    I created an ASP.Net Web Application in VS 2010. That in turn creates an example Site.Master, Default.aspx, and several other example files. I then opened Default.aspx in Expression Web 4 and get the error message The Master Page file 'Site.Master' cannot be loaded. Default.aspx can still be displayed fine in VS 2010. Source.Master: <%@ Master Language="C#" AutoEventWireup="true" CodeBehind="Site.master.cs" Inherits="SampleWebApp.SiteMaster" %> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en"> <head runat="server"> <title></title> <link href="~/Styles/Site.css" rel="stylesheet" type="text/css" /> <asp:ContentPlaceHolder ID="HeadContent" runat="server"> </asp:ContentPlaceHolder> <style type="text/css"> .style1 { font-family: Tunga; } </style> </head> <body> <form runat="server"> <div class="page"> <div class="header"> <div class="title"> <h1 class="style1"> My Application Master Page</h1> </div> <div class="loginDisplay"> <asp:LoginView ID="HeadLoginView" runat="server" EnableViewState="false"> <AnonymousTemplate> [ <a href="~/Account/Login.aspx" ID="HeadLoginStatus" runat="server">Log In</a> ] </AnonymousTemplate> <LoggedInTemplate> Welcome <span class="bold"><asp:LoginName ID="HeadLoginName" runat="server" /></span>! [ <asp:LoginStatus ID="HeadLoginStatus" runat="server" LogoutAction="Redirect" LogoutText="Log Out" LogoutPageUrl="~/"/> ] </LoggedInTemplate> </asp:LoginView> </div> <div class="clear hideSkiplink"> <asp:Menu ID="NavigationMenu" runat="server" CssClass="menu" EnableViewState="false" IncludeStyleBlock="false" Orientation="Horizontal"> <Items> <asp:MenuItem NavigateUrl="~/Default.aspx" Text="Home"> <asp:MenuItem NavigateUrl="~/Home/NewItem.aspx" Text="New Item" Value="New Item"></asp:MenuItem> <asp:MenuItem NavigateUrl="~/Home/AnotherItem.aspx" Text="Another Item" Value="Another Item"></asp:MenuItem> </asp:MenuItem> <asp:MenuItem NavigateUrl="~/About.aspx" Text="About"/> <asp:MenuItem NavigateUrl="~/ContactUs.aspx" Text="ContactUs" Value="ContactUs"> </asp:MenuItem> </Items> </asp:Menu> </div> </div> <div class="main"> <asp:ContentPlaceHolder ID="MainContent" runat="server"/> </div> <div class="clear"> </div> </div> <div class="footer"> </div> </form> </body> </html> Default.aspx: <%@ Page Title="Home Page" Language="C#" MasterPageFile="~/Site.Master" AutoEventWireup="true" CodeBehind="Default.aspx.cs" Inherits="SampleWebApp._Default" %> <asp:Content ID="HeaderContent" runat="server" ContentPlaceHolderID="HeadContent"> <style type="text/css"> .style2 { color: #669900; } .style3 { background-color: #FFFFCC; } </style> </asp:Content> <asp:Content ID="BodyContent" runat="server" ContentPlaceHolderID="MainContent"> <h2> Welcome to MY page! </h2> <p> To learn more <span class="style2"><strong><em><span class="style3">about</span></em></strong></span> ASP.NET visit <a href="http://www.asp.net" title="ASP.NET Website">www.asp.net</a>. </p> <p> You can also find <a href="http://go.microsoft.com/fwlink/?LinkID=152368&amp;clcid=0x409" title="MSDN ASP.NET Docs">documentation on ASP.NET at MSDN</a>. </p> </asp:Content> Any idea how to get the master page to work properly in Expression Web 4?

    Read the article

  • JSF 2 -- Composite component with optional listener attribute on f:ajax

    - by Dave Maple
    I have a composite component that looks something like this: <!DOCTYPE html> <html xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core" xmlns:dm="http://davemaple.com/dm-taglib" xmlns:rich="http://richfaces.org/rich" xmlns:cc="http://java.sun.com/jsf/composite" xmlns:fn="http://java.sun.com/jsp/jstl/functions" xmlns:ui="http://java.sun.com/jsf/facelets" xmlns:a4j="http://richfaces.org/a4j"> <cc:interface> <cc:attribute name="styleClass" /> <cc:attribute name="textBoxStyleClass" /> <cc:attribute name="inputTextId" /> <cc:attribute name="labelText" /> <cc:attribute name="tabindex" /> <cc:attribute name="required" default="false" /> <cc:attribute name="requiredMessage" /> <cc:attribute name="validatorId" /> <cc:attribute name="converterId" /> <cc:attribute name="title"/> <cc:attribute name="style"/> <cc:attribute name="unicodeSupport" default="false"/> <cc:attribute name="tooltip" default="false"/> <cc:attribute name="tooltipText" default=""/> <cc:attribute name="tooltipText" default=""/> <cc:attribute name="onfail" default=""/> <cc:attribute name="onpass" default=""/> </cc:interface> <cc:implementation> <ui:param name="converterId" value="#{! empty cc.attrs.converterId ? cc.attrs.converterId : 'universalConverter'}" /> <ui:param name="validatorId" value="#{! empty cc.attrs.validatorId ? cc.attrs.validatorId : 'universalValidator'}" /> <ui:param name="component" value="#{formFieldBean.getComponent(cc.attrs.inputTextId)}" /> <ui:param name="componentValid" value="#{((facesContext.maximumSeverity == null and empty component.valid) or component.valid) ? true : false}" /> <ui:param name="requiredMessage" value="#{! empty cc.attrs.requiredMessage ? cc.attrs.requiredMessage : msg['validation.generic.requiredMessage']}" /> <ui:param name="clientIdEscaped" value="#{fn:replace(cc.clientId, ':', '\\\\\\\\:')}" /> <h:panelGroup layout="block" id="#{cc.attrs.inputTextId}ValidPanel" style="display:none;"> <input type="hidden" id="#{cc.attrs.inputTextId}Valid" value="#{componentValid}" /> </h:panelGroup> <dm:outputLabel for="#{cc.clientId}:#{cc.attrs.inputTextId}" id="#{cc.attrs.inputTextId}Label">#{cc.attrs.labelText}</dm:outputLabel> <dm:inputText styleClass="#{cc.attrs.textBoxStyleClass}" tabindex="#{cc.attrs.tabindex}" id="#{cc.attrs.inputTextId}" required="#{cc.attrs.required}" requiredMessage="#{requiredMessage}" title="#{cc.attrs.title}" unicodeSupport="#{cc.attrs.unicodeSupport}"> <f:validator validatorId="#{validatorId}" /> <f:converter converterId="#{converterId}" /> <cc:insertChildren /> <f:ajax event="blur" execute="@this" render="#{cc.attrs.inputTextId}ValidPanel #{cc.attrs.inputTextId}Msg" onevent="on#{cc.attrs.inputTextId}Event" /> </dm:inputText> <rich:message for="#{cc.clientId}:#{cc.attrs.inputTextId}" id="#{cc.attrs.inputTextId}Msg" style="display: none;" /> <script> function on#{cc.attrs.inputTextId}Event(e) { if(e.status == 'success') { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}').trigger($('##{cc.attrs.inputTextId}Valid').val()=='true'?'pass':'fail'); } } $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}').bind('fail', function() { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}, ##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Label, ##{cc.attrs.inputTextId}Msg, ##{cc.id}Msg').addClass('error'); $('##{cc.id}Msg').html($('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Msg').html()); #{cc.attrs.onfail} }).bind('pass', function() { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}, ##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Label, ##{cc.attrs.inputTextId}Msg, ##{cc.id}Msg').removeClass('error'); $('##{cc.id}Msg').html($('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Msg').html()); #{cc.attrs.onpass} }); </script> <a4j:region rendered="#{facesContext.maximumSeverity != null and !componentValid}"> <script> $(document).ready(function() { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}').trigger('fail'); }); </script> </a4j:region> </cc:implementation> </html> I'd like to be able to add an optional "listener" attribute which if defined would add an event listener to my f:ajax but I'm having trouble figuring out how to accomplish this. Any help would be appreciated.

    Read the article

  • XML parsing and transforming (XSLT or otherwise)

    - by observ
    I have several xml files that are formated this way: <ROOT> <OBJECT> <identity> <id>123</id> </identity> <child2 attr = "aa">32</child2> <child3> <childOfChild3 att1="aaa" att2="bbb" att3="CCC">LN</childOfChild3> </child3> <child4> <child5> <child6>3ddf</child6> <child7> <childOfChild7 att31="RR">1231</childOfChild7> </child7> </child5> </child4> </OBJECT> <OBJECT> <identity> <id>124</id> </identity> <child2 attr = "bb">212</child2> <child3> <childOfChild3 att1="ee" att2="ccc" att3="EREA">OP</childOfChild3> </child3> <child4> <child5> <child6>213r</child6> <child7> <childOfChild7 att31="EE">1233</childOfChild7> </child7> </child5> </child4> </OBJECT> </ROOT> How can i format it this way?: <ROOT> <OBJECT> <id>123</id> <child2>32</child2> <attr>aa</attr> <child3></child3> <childOfChild3>LN</childOfChild3> <att1>aaa</att1> <att2>bbb</att2> <att3>CCC</att3> <child4></child4> <child5></child5> <child6>3ddf</child6> <child7></child7> <childOfChild7>1231</childOfChild7> <att31>RR</att31> </OBJECT> <OBJECT> <id>124</id> <child2>212</child2> <attr>bb</attr> <child3></child3> <childOfChild3>LN</childOfChild3> <att1>ee</att1> <att2>ccc</att2> <att3>EREA</att3> <child4></child4> <child5></child5> <child6>213r</child6> <child7></child7> <childOfChild7>1233</childOfChild7> <att31>EE</att31> </OBJECT> </ROOT> I know some C# so maybe a parser there? or some generic xslt? The xml files are some data received from a client, so i can't control the way they are sending it to me. L.E. Basically when i am trying to test this data in excel (for example i want to make sure that the attribute of childOfChild7 corresponds to the correct identity id) i am getting a lot of blank spaces. If i am importing in access to get only the data i want out, i have to do a thousands subqueries to get them all in a nice table. Basically i just want to see for one Object all its data (one object - One row) and then just delete/hide the columns i don't need.

    Read the article

  • JSF : How to refresh required field in ajax request

    - by Tama
    Ok, here you are the core problem. The page. I have two required "input text". A command button that changes the bean value and reRenderes the "job" object. <a4j:form id="pervForm"> SURNAME:<h:inputText id="surname" label="Surname" value="#{prevManager.surname}" required="true" /> <br/> JOB:<h:inputText value="#{prevManager.job}" id="job" maxlength="10" size="10" label="#{msg.common_label_job}" required="true" /> <br/> <a4j:commandButton value="Set job to Programmer" ajaxSingle="true" reRender="job"> <a4j:actionparam name="jVal" value="Programmer" assignTo="#{prevManager.job}"/> </a4j:commandButton> <h:commandButton id="save" value="save" action="save" class="HATSBUTTON"/> </a4j:form> Here the simple manager: public class PrevManager { private String surname; private String job; public String getSurname() { return surname; } public void setSurname(String surname) { this.surname = surname; } public String getJob() { return job; } public void setJob(String job) { this.job = job; } public String save() { //do something } } Let's do this: Write something on the Job input text (such as "teacher"). Leave empty the surname. Save. Validation error appears (surname is mandatory). Press "Set job to Programmer": nothing happens. Checking the bean value, I discovered that it is correctly updated, indeed the component on the page is not updated! Well, according to the JBoss Docs I found: Ajax region is a key ajax component. It limits the part of the component tree to be processed on the server side when ajax request comes. Processing means invocation during Decode, Validation and Model Update phase. Most common reasons to use a region are: -avoiding the aborting of the JSF lifecycle processing during the validation of other form input unnecessary for given ajax request; -defining the different strategies when events will be delivered (immediate="true/false") -showing an individual indicator of an ajax status -increasing the performance of the rendering processing (selfRendered="true/false", renderRegionOnly="true/false") The following two examples show the situation when a validation error does not allow to process an ajax input. Type the name. The outputText component should reappear after you. However, in the first case, this activity will be aborted because of the other field with required="true". You will see only the error message while the "Job" field is empty. Here you are the example: <ui:composition xmlns="http://www.w3.org/1999/xhtml" xmlns:ui="http://java.sun.com/jsf/facelets" xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core" xmlns:a4j="http://richfaces.org/a4j" xmlns:rich="http://richfaces.org/rich"> <style> .outergridvalidationcolumn { padding: 0px 30px 10px 0px; } </style> <a4j:outputPanel ajaxRendered="true"> <h:messages style="color:red" /> </a4j:outputPanel> <h:panelGrid columns="2" columnClasses="outergridvalidationcolumn"> <h:form id="form1"> <h:panelGrid columns="2"> <h:outputText value="Name" /> <h:inputText value="#{userBean.name}"> <a4j:support event="onkeyup" reRender="outname" /> </h:inputText> <h:outputText value="Job" /> <h:inputText required="true" id="job2" value="#{userBean.job}" /> </h:panelGrid> </h:form> <h:form id="form2"> <h:panelGrid columns="2"> <h:outputText value="Name" /> <a4j:region> <h:inputText value="#{userBean.name}"> <a4j:support event="onkeyup" reRender="outname" /> </h:inputText> </a4j:region> <h:outputText value="Job" /> <h:inputText required="true" id="job1" value="#{userBean.job}" /> </h:panelGrid> </h:form> </h:panelGrid> <h:outputText id="outname" style="font-weight:bold" value="Typed Name: #{userBean.name}" /> <br /> </ui:composition> Form1: the behaviour is incorrect. I need to fill the job and then the name. Form2: the behaviour is correct. I do not need to fill the job to see the correct value. Unfortunately using Ajax region does not help (indeed I used it in a bad way ...) because my fields are both REQUIRED. That's the main different. Any idea? Many thanks.

    Read the article

  • NHibernate AssertException: Interceptor.OnPrepareStatement(SqlString) returned null or empty SqlString.

    - by jwynveen
    I am trying to switch a table from being a many-to-one mapping to being many-to-many with an intermediate mapping table. However, when I switched it over and tried to do a query on it with NHibernate, it's giving me this error: "Interceptor.OnPrepareStatement(SqlString) returned null or empty SqlString." My query was originally something more complex, but I switched it to a basic fetch all and I'm still having the problem: Session.QueryOver<T>().Future(); It would seem to either be a problem in my model mapping files or something in my database. Here are my model mappings: <?xml version="1.0" encoding="utf-8" ?> <hibernate-mapping xmlns="urn:nhibernate-mapping-2.2" assembly="GBI.Core" namespace="GBI.Core.Models"> <class name="Market" table="gbi_Market"> <id name="Id" column="MarketId"> <generator class="identity" /> </id> <property name="Name" /> <property name="Url" /> <property name="Description" type="StringClob" /> <property name="Rating" /> <property name="RatingComment" /> <property name="RatingCommentedOn" /> <many-to-one name="RatingCommentedBy" column="RatingCommentedBy" lazy="proxy"></many-to-one> <property name="ImageFilename" /> <property name="CreatedOn" /> <property name="ModifiedOn" /> <property name="IsDeleted" /> <many-to-one name="CreatedBy" column="CreatedBy" lazy="proxy"></many-to-one> <many-to-one name="ModifiedBy" column="ModifiedBy" lazy="proxy"></many-to-one> <set name="Content" where="IsDeleted=0 and ParentContentId is NULL" order-by="Ordering asc, CreatedOn asc, Name asc" lazy="extra"> <key column="MarketId" /> <one-to-many class="MarketContent" /> </set> <set name="FastFacts" where="IsDeleted=0" order-by="Ordering asc, CreatedOn asc, Name asc" lazy="extra"> <key column="MarketId" /> <one-to-many class="MarketFastFact" /> </set> <set name="NewsItems" table="gbi_NewsItem_Market_Map" lazy="true"> <key column="MarketId" /> <many-to-many class="NewsItem" fetch="join" column="NewsItemId" where="IsDeleted=0"/> </set> <!--<set name="MarketUpdates" table="gbi_Market_MarketUpdate_Map" lazy="extra"> <key column="MarketId" /> <many-to-many class="MarketUpdate" fetch="join" column="MarketUpdateId" where="IsDeleted=0" order-by="CreatedOn desc" /> </set>--> <set name="Documents" table="gbi_Market_Document_Map" lazy="true"> <key column="MarketId" /> <many-to-many class="Document" fetch="join" column="DocumentId" where="IsDeleted=0"/> </set> </class> <?xml version="1.0" encoding="utf-8" ?> <hibernate-mapping xmlns="urn:nhibernate-mapping-2.2" assembly="GBI.Core" namespace="GBI.Core.Models"> <class name="MarketUpdate" table="gbi_MarketUpdate"> <id name="Id" column="MarketUpdateId"> <generator class="identity" /> </id> <property name="Description" /> <property name="CreatedOn" /> <property name="ModifiedOn" /> <property name="IsDeleted" /> <!--<many-to-one name="Market" column="MarketId" lazy="proxy"></many-to-one>--> <set name="Comments" where="IsDeleted=0" order-by="CreatedOn desc" lazy="extra"> <key column="MarketUpdateId" /> <one-to-many class="MarketUpdateComment" /> </set> <many-to-one name="CreatedBy" column="CreatedBy" lazy="proxy"></many-to-one> <many-to-one name="ModifiedBy" column="ModifiedBy" lazy="proxy"></many-to-one> </class> <?xml version="1.0" encoding="utf-8" ?> <hibernate-mapping xmlns="urn:nhibernate-mapping-2.2" assembly="GBI.Core" namespace="GBI.Core.Models"> <class name="MarketUpdateMarketMap" table="gbi_Market_MarketUpdate_Map"> <id name="Id" column="MarketUpdateMarketMapId"> <generator class="identity" /> </id> <property name="CreatedOn" /> <property name="ModifiedOn" /> <property name="IsDeleted" /> <many-to-one name="CreatedBy" column="CreatedBy" lazy="proxy"></many-to-one> <many-to-one name="ModifiedBy" column="ModifiedBy" lazy="proxy"></many-to-one> <many-to-one name="MarketUpdate" column="MarketUpdateId" lazy="proxy"></many-to-one> <many-to-one name="Market" column="MarketId" lazy="proxy"></many-to-one> </class> As I mentioned, MarketUpdate was originally a many-to-one with Market (MarketId column is still in there, but I'm ignoring it. Could this be a problem?). But I've added in the Market_MarketUpdate_Map table to make it a many-to-many. I'm running in circles trying to figure out what this could be. I couldn't find any reference to this error when searching. And it doesn't provide much detail. Using: NHibernate 2.2 .NET 4.0 SQL Server 2005

    Read the article

  • jQuery returning two elements for each one it finds?

    - by John Rudy
    I'll start by saying I'm fairly new to jQuery. For the most part, I've found it intuitive and powerful, but this one circumstance has me thoroughly stumped. In the following method, the call to .each() returns two elements for every one found. It iterates over a set of table rows given IDs starting with the word, "communication," and followed by an ID number. For each row it returns, it processes twice. Using Firebug, I've validated that the DOM only has a single instance of each table row in question. Also using Firebug, I've validated that the method is not being called twice; the iteration in .each() is truly going over each returned table row twice. By the time all the AJAX call goodness is done, I'll have two entries in the database for each row created in the table. This is the code that's causing the issues: function getCommunications() { var list = $('[id^=communication]'); var communications = new Array(); list.each(function () { var communication = { ID: $(this).find('.commCompanyID').val(), /* * SNIP: more object properties here that are * unnecessary to this discussion */ }; communications.push(communication); }); return communications; } At the point of return communications, the Array returned will contain twice as many elements as there are table rows. I should note that nearly identical code (but going against specific lists of divs) is working on the same page. It's just the table that's suffering the issues. I'm using jQuery 1.4.1, the version which shipped with Visual Studio .NET 2010. The table markup is fully dynamic -- that is, aside from the header row, it's dependent on data either returned at page load or created by the user via a dialog box. I'll drop in just the code for what's created at page load; again using Firebug I've validated that what I create dynamically when an end user creates a row with the dialog box matches. (This should be readable by anyone, but for the record this is an ASP.NET MVC 2.0 project.) <table id="commTable"> <tr> <th></th> <th> Date / Time </th> <th> Contact </th> <th> Type </th> <th> Duration </th> <th> Notes </th> </tr> <% foreach (var item in Model) { %> <tr id="communication<%: item.ID %>"> <td> <a href="#" onclick="showEditCommunicationForm(<%: item.ID %>"> Edit</a> <span class="commDeleteButton"> <a href="#" onclick="deleteCommunication(<%: item.ID %>)"> Delete</a> </span> </td> <td> <span class="commDateTime"><%: item.DateTime %></span> <input type="hidden" class="commID" value="<%: item.ID %>" /> <input type="hidden" class="commIsDeleted" value="<%: item.IsDeleted %>" /> </td> <td> <span class="commSourceText"><%: item.Company.CompanyName %></span> <input type="hidden" class="commCompanyID" value="<%: item.CompanyID %>" /> </td> <td> <%: item.CommunicationType.CommunicationTypeText %> <input type="hidden" class="commTypeID" value="<%: item.CommunicationTypeID %>" /> </td> <td> <span class="commDuration"><%: item.DurationMinutes %></span> Minutes </td> <td> <span class="commNotes"><%: item.Notes %></span> </td> </tr> <% } %> </table>

    Read the article

  • DotNetNuke + XPath = Custom navigation menu DNNMenu HTML render

    - by Rui Santos
    I'm developing a skin for DotNetNuke 5 using the Component DNN Done Right menu by Mark Alan which uses XSL-T to convert the XML sitemap into an HTML navigation. The XML sitemap outputs the following structure: <Root > <root > <node id="40" text="Home" url="http://localhost/dnn/Home.aspx" enabled="1" selected="0" breadcrumb="0" first="1" last="0" only="0" depth="0" > <node id="58" text="Child1" url="http://localhost/dnn/Home/Child1.aspx" enabled="1" selected="0" breadcrumb="0" first="1" last="0" only="0" depth="1" > <keywords >Child1</keywords> <description >Child1</description> <node id="59" text="Child1 SubItem1" url="http://localhost/dnn/Home/Child1/Child1SubItem1.aspx" enabled="1" selected="0" breadcrumb="0" first="1" last="0" only="0" depth="2" > <keywords >Child1 SubItem1</keywords> <description >Child1 SubItem1</description> </node> <node id="60" text="Child1 SubItem2" url="http://localhost/dnn/Home/Child1/Child1SubItem2.aspx" enabled="1" selected="0" breadcrumb="0" first="0" last="0" only="0" depth="2" > <keywords >Child1 SubItem2</keywords> <description >Child1 SubItem2</description> </node> <node id="61" text="Child1 SubItem3" url="http://localhost/dnn/Home/Child1/Child1SubItem3.aspx" enabled="1" selected="0" breadcrumb="0" first="0" last="1" only="0" depth="2" > <keywords >Child1 SubItem3</keywords> <description >Child1 SubItem3</description> </node> </node> <node id="65" text="Child2" url="http://localhost/dnn/Home/Child2.aspx" enabled="1" selected="0" breadcrumb="0" first="0" last="1" only="0" depth="1" > <keywords >Child2</keywords> <description >Child2</description> <node id="66" text="Child2 SubItem1" url="http://localhost/dnn/Home/Child2/Child2SubItem1.aspx" enabled="1" selected="0" breadcrumb="0" first="1" last="0" only="0" depth="2" > <keywords >Child2 SubItem1</keywords> <description >Child2 SubItem1</description> </node> <node id="67" text="Child2 SubItem2" url="http://localhost/dnn/Home/Child2/Child2SubItem2.aspx" enabled="1" selected="0" breadcrumb="0" first="0" last="1" only="0" depth="2" > <keywords >Child2 SubItem2</keywords> <description >Child2 SubItem2</description> </node> </node> </node> </root> </Root> My Goal is to render this XML block into this HTML Navigation structure only using UL's LI's, etc.. <ul id="topnav"> <li> <a href="#" class="home">Home</a> <!-- Parent Node - Depth0 --> <div class="sub"> <ul> <li><h2><a href="#">Child1</a></h2></li> <!-- Parent Node 1 - Depth1 --> <li><a href="#">Child1 SubItem1</a></li> <!-- ChildNode - Depth2 --> <li><a href="#">Child1 SubItem2</a></li> <!-- ChildNode - Depth2 --> <li><a href="#">Child1 SubItem3</a></li ><!-- ChildNode - Depth2 --> </ul> <ul> <li><h2><a href="#">Child2</a></h2></li> <!-- Parent Node 2 - Depth1 --> <li><a href="#">Child2 SubItem1</a></li> <!-- ChildNode - Depth2 --> <li><a href="#">Child2 SubItem2</a></li> <!-- ChildNode - Depth2 --> </ul> </div> </li> </ul> Can anyone help with the XSL coding? I'm just starting now with XSL..

    Read the article

  • Android Multiple objects in SimpleAdapter

    - by Adam Sherratt
    I have a need (unless you can think of a better way) of passing multiple objects to a custom list adapter. I know that I'm barking up the wrong tree here, and would appreciate someone setting me on the right course! Thanks playlistadapter = new MyPlaylistAdapter(MyApplication.getAppContext(), songsList, retained_songsList, folderMode, R.layout.file_view, new String[] { "songTitle","songAlbum", "songPath" }, new int[] { R.id.checkTextView, R.id.text2, R.id.text3 }); And my adapter class: public class MyPlaylistAdapter extends SimpleAdapter{ private ArrayList <Song> songsList = new ArrayList<Song>(); private ArrayList <Song> retained_songsList = new ArrayList<Song>(); private ArrayList<Song> playlistcheck = new ArrayList<Song>(); private String folderMode; private String TAG = "AndroidMediaCenter"; public MyPlaylistAdapter(Context context,List<Song> SongsList, List<Song> Retained_songsList, String FolderMode,int resource, String[] from, int[] to) { super(context, null, resource, from, to); songsList.clear(); songsList.addAll(SongsList); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); retained_songsList.clear(); retained_songsList.addAll(Retained_songsList); folderMode = FolderMode; } public View getView(int position, View convertView, ViewGroup parent) { //PlayListViewHolder holder; CheckedTextView checkTextView; TextView text2; TextView text3; if (convertView == null) { LayoutInflater inflater = (LayoutInflater) MyApplication.getAppContext().getSystemService(Context.LAYOUT_INFLATER_SERVICE); //LayoutInflater inflater=getLayoutInflater(); convertView=inflater.inflate(R.layout.file_view, parent, false); //convertView.setBackgroundColor(0xFF00FF00 ); //holder = new PlayListViewHolder(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); //convertView.setTag(holder); } else { //holder = (PlayListViewHolder) convertView.getTag(); } //put something into textviews String tracks = null; String tracks_Details = null; String trackspath = null; tracks = songsList.get(position).getSongTitle(); tracks_Details = songsList.get(position).getAlbum() + " (" + songsList.get(position).getArtist() + ")"; trackspath = songsList.get(position).getSongPath(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); checkTextView.setText(tracks); if(folderMode.equals("Playlists")){ checkTextView.setBackgroundColor(Color.GREEN); checkTextView.setChecked(false); try { int listsize_rs = retained_songsList.size(); for (int j = 0; j<listsize_rs;j++){ if((retained_songsList.get(j).getSongPath()).equals(songsList.get(position).getSongPath())){ checkTextView.setBackgroundColor(Color.TRANSPARENT); //Need to check here whether the checkedtextview is ticked or not checkTextView.setChecked(true); playlistcheck.add(songsList.get(position)); break; } } } catch (Exception e) { e.printStackTrace(); } }else { //Need to check here whether the checkedtextview is ticked or not try { if (songsList.get(position).getSongCheckedStatus()==true){ checkTextView.setChecked(true); }else{ checkTextView.setChecked(false); } } catch (Exception e) { e.printStackTrace(); } } text2.setText(tracks_Details); text3.setText(trackspath); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); return convertView; } } However, this doesn't inflate, throwing the following errors: 10-26 23:11:09.464: E/AndroidRuntime(2826): FATAL EXCEPTION: main 10-26 23:11:09.464: E/AndroidRuntime(2826): java.lang.RuntimeException: Error receiving broadcast Intent { act=android.intent.action.GetMusicComplete flg=0x10 } in com.Nmidia.AMC.MusicActivity$18@414c5770 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:765) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.handleCallback(Handler.java:615) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.dispatchMessage(Handler.java:92) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Looper.loop(Looper.java:137) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.ActivityThread.main(ActivityThread.java:4745) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invokeNative(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invoke(Method.java:511) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:786) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:553) 10-26 23:11:09.464: E/AndroidRuntime(2826): at dalvik.system.NativeStart.main(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): Caused by: java.lang.NullPointerException 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.SimpleAdapter.getCount(SimpleAdapter.java:93) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.ListView.setAdapter(ListView.java:460) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity.setFilterMusic(MusicActivity.java:1230) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity$18.onReceive(MusicActivity.java:996) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:755) 10-26 23:11:09.464: E/AndroidRuntime(2826): ... 9 more

    Read the article

  • CoreData: Same predicate (IN) returns different fetched results after a Save operation

    - by Jason Lee
    I have code below: NSArray *existedTasks = [[TaskBizDB sharedInstance] fetchTasksWatchedByMeOfProject:projectId]; [context save:&error]; existedTasks = [[TaskBizDB sharedInstance] fetchTasksWatchedByMeOfProject:projectId]; NSArray *allTasks = [[TaskBizDB sharedInstance] fetchTasksOfProject:projectId]; First line returns two objects; Second line save the context; Third line returns just one object, which is contained in the 'two objects' above; And the last line returns 6 objects, containing the 'two objects' returned at the first line. The fetch interface works like below: WXModel *model = [WXModel modelWithEntity:NSStringFromClass([WQPKTeamTask class])]; NSPredicate *predicate = [NSPredicate predicateWithFormat:@"(%@ IN personWatchers) AND (projectId == %d)", currentLoginUser, projectId]; [model setPredicate:predicate]; NSArray *fetchedTasks = [model fetch]; if (fetchedTasks.count == 0) return nil; return fetchedTasks; What confused me is that, with the same fetch request, why return different results just after a save? Here comes more detail: The 'two objects' returned at the first line are: <WQPKTeamTask: 0x1b92fcc0> (entity: WQPKTeamTask; id: 0x1b9300f0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p9> ; data: { projectId = 372004; taskId = 338001; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); } <WQPKTeamTask: 0xf3f6130> (entity: WQPKTeamTask; id: 0xf3cb8d0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p11> ; data: { projectId = 372004; taskId = 340006; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); } And the only one object returned at third line is: <WQPKTeamTask: 0x1b92fcc0> (entity: WQPKTeamTask; id: 0x1b9300f0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p9> ; data: { projectId = 372004; taskId = 338001; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); } Printing description of allTasks: <_PFArray 0xf30b9a0>( <WQPKTeamTask: 0xf3ab9d0> (entity: WQPKTeamTask; id: 0xf3cda40 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p6> ; data: <fault>), <WQPKTeamTask: 0xf315720> (entity: WQPKTeamTask; id: 0xf3c23a0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p7> ; data: <fault>), <WQPKTeamTask: 0xf3a1ed0> (entity: WQPKTeamTask; id: 0xf3cda30 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p8> ; data: <fault>), <WQPKTeamTask: 0x1b92fcc0> (entity: WQPKTeamTask; id: 0x1b9300f0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p9> ; data: { projectId = 372004; taskId = 338001; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); }), <WQPKTeamTask: 0xf325e50> (entity: WQPKTeamTask; id: 0xf343820 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p10> ; data: <fault>), <WQPKTeamTask: 0xf3f6130> (entity: WQPKTeamTask; id: 0xf3cb8d0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p11> ; data: { projectId = 372004; taskId = 340006; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); }) ) UPDATE 1 If I call the same interface fetchTasksWatchedByMeOfProject: in: #pragma mark - NSFetchedResultsController Delegate - (void)controllerDidChangeContent:(NSFetchedResultsController *)controller { I will get 'two objects' as well. UPDATE 2 I've tried: NSPredicate *predicate = [NSPredicate predicateWithFormat:@"(ANY personWatchers == %@) AND (projectId == %d)", currentLoginUser, projectId]; NSPredicate *predicate = [NSPredicate predicateWithFormat:@"(ANY personWatchers.personId == %@) AND (projectId == %d)", currentLoginUserId, projectId]; Still the same result. UPDATE 3 I've checked the save:&error, error is nil.

    Read the article

< Previous Page | 568 569 570 571 572 573 574 575 576 577 578 579  | Next Page >