Search Results

Search found 14532 results on 582 pages for 'dynamic types'.

Page 573/582 | < Previous Page | 569 570 571 572 573 574 575 576 577 578 579 580  | Next Page >

  • Threading extra state through a parser in Scala

    - by Travis Brown
    I'll give you the tl;dr up front I'm trying to use the state monad transformer in Scalaz 7 to thread extra state through a parser, and I'm having trouble doing anything useful without writing a lot of t m a -> t m b versions of m a -> m b methods. An example parsing problem Suppose I have a string containing nested parentheses with digits inside them: val input = "((617)((0)(32)))" I also have a stream of fresh variable names (characters, in this case): val names = Stream('a' to 'z': _*) I want to pull a name off the top of the stream and assign it to each parenthetical expression as I parse it, and then map that name to a string representing the contents of the parentheses, with the nested parenthetical expressions (if any) replaced by their names. To make this more concrete, here's what I'd want the output to look like for the example input above: val target = Map( 'a' -> "617", 'b' -> "0", 'c' -> "32", 'd' -> "bc", 'e' -> "ad" ) There may be either a string of digits or arbitrarily many sub-expressions at a given level, but these two kinds of content won't be mixed in a single parenthetical expression. To keep things simple, we'll assume that the stream of names will never contain either duplicates or digits, and that it will always contain enough names for our input. Using parser combinators with a bit of mutable state The example above is a slightly simplified version of the parsing problem in this Stack Overflow question. I answered that question with a solution that looked roughly like this: import scala.util.parsing.combinator._ class ParenParser(names: Iterator[Char]) extends RegexParsers { def paren: Parser[List[(Char, String)]] = "(" ~> contents <~ ")" ^^ { case (s, m) => (names.next -> s) :: m } def contents: Parser[(String, List[(Char, String)])] = "\\d+".r ^^ (_ -> Nil) | rep1(paren) ^^ ( ps => ps.map(_.head._1).mkString -> ps.flatten ) def parse(s: String) = parseAll(paren, s).map(_.toMap) } It's not too bad, but I'd prefer to avoid the mutable state. What I want Haskell's Parsec library makes adding user state to a parser trivially easy: import Control.Applicative ((*>), (<$>), (<*)) import Data.Map (fromList) import Text.Parsec paren = do (s, m) <- char '(' *> contents <* char ')' h : t <- getState putState t return $ (h, s) : m where contents = flip (,) [] <$> many1 digit <|> (\ps -> (map (fst . head) ps, concat ps)) <$> many1 paren main = print $ runParser (fromList <$> paren) ['a'..'z'] "example" "((617)((0)(32)))" This is a fairly straightforward translation of my Scala parser above, but without mutable state. What I've tried I'm trying to get as close to the Parsec solution as I can using Scalaz's state monad transformer, so instead of Parser[A] I'm working with StateT[Parser, Stream[Char], A]. I have a "solution" that allows me to write the following: import scala.util.parsing.combinator._ import scalaz._, Scalaz._ object ParenParser extends ExtraStateParsers[Stream[Char]] with RegexParsers { protected implicit def monadInstance = parserMonad(this) def paren: ESP[List[(Char, String)]] = (lift("(" ) ~> contents <~ lift(")")).flatMap { case (s, m) => get.flatMap( names => put(names.tail).map(_ => (names.head -> s) :: m) ) } def contents: ESP[(String, List[(Char, String)])] = lift("\\d+".r ^^ (_ -> Nil)) | rep1(paren).map( ps => ps.map(_.head._1).mkString -> ps.flatten ) def parse(s: String, names: Stream[Char]) = parseAll(paren.eval(names), s).map(_.toMap) } This works, and it's not that much less concise than either the mutable state version or the Parsec version. But my ExtraStateParsers is ugly as sin—I don't want to try your patience more than I already have, so I won't include it here (although here's a link, if you really want it). I've had to write new versions of every Parser and Parsers method I use above for my ExtraStateParsers and ESP types (rep1, ~>, <~, and |, in case you're counting). If I had needed to use other combinators, I'd have had to write new state transformer-level versions of them as well. Is there a cleaner way to do this? I'd love to see an example of a Scalaz 7's state monad transformer being used to thread state through a parser, but Scala 6 or Haskell examples would also be useful.

    Read the article

  • Problem with From field in contact form and mail() function

    - by Matthew
    I've got a contact form with 3 fields and a textarea... I use jQuery to validate it and then php to send emails. This contact form works fine but, when I receive an email, From field isn't correct. I'd like to want that From field shows text typed in the Name field of the contact form. Now I get a From field like this: <[email protected]> For example, if an user types "Matthew" in the name field, I'd like to want that this word "Matthew" appears in the From field. This is my code (XHTML, jQuery, PHP): <div id="contact"> <h3 id="formHeader">Send Us a Message!</h3> <form id="contactForm" method="post" action=""> <div id="risposta"></div> <!-- End Risposta Div --> <span>Name:</span> <input type="text" id="formName" value="" /><br /> <span>E-mail:</span> <input type="text" id="formEmail" value="" /><br /> <span>Subject:</span> <input type="text" id="formSubject" value="" /><br /> <span>Message:</span> <textarea id="formMessage" rows="9" cols="20"></textarea><br /> <input type="submit" id="formSend" value="Send" /> </form> </div> <script type="text/javascript"> $(document).ready(function(){ $("#formSend").click(function(){ var valid = ''; var nome = $("#formName").val(); var mail = $("#formEmail").val(); var oggetto = $("#formSubject").val(); var messaggio = $("#formMessage").val(); if (nome.length<1) { valid += '<span>Name field empty.</span><br />'; } if (!mail.match(/^([a-z0-9._-]+@[a-z0-9._-]+\.[a-z]{2,4}$)/i)) { valid += '<span>Email not valid or empty field.</span><br />'; } if (oggetto.length<1) { valid += '<span>Subject field empty.</span><br />'; } if (valid!='') { $("#risposta").fadeIn("slow"); $("#risposta").html("<span><b>Error:</b></span><br />"+valid); $("#risposta").css("background-color","#ffc0c0"); } else { var datastr ='nome=' + nome + '&mail=' + mail + '&oggetto=' + oggetto + '&messaggio=' + encodeURIComponent(messaggio); $("#risposta").css("display", "block"); $("#risposta").css("background-color","#FFFFA0"); $("#risposta").html("<span>Sending message...</span>"); $("#risposta").fadeIn("slow"); setTimeout("send('"+datastr+"')",2000); } return false; }); }); function send(datastr){ $.ajax({ type: "POST", url: "contactForm.php", data: datastr, cache: false, success: function(html) { $("#risposta").fadeIn("slow"); $("#risposta").html('<span>Message successfully sent.</span>'); $("#risposta").css("background-color","#e1ffc0"); setTimeout('$("#risposta").fadeOut("slow")',2000); } }); } </script> <?php $mail = $_POST['mail']; $nome = $_POST['nome']; $oggetto = $_POST['oggetto']; $text = $_POST['messaggio']; $ip = $_SERVER['REMOTE_ADDR']; $to = "[email protected]"; $message = $text."<br /><br />IP: ".$ip."<br />"; $headers = "From: $nome \n"; $headers .= "Reply-To: $mail \n"; $headers .= "MIME-Version: 1.0 \n"; $headers .= "Content-Type: text/html; charset=UTF-8 \n"; mail($to, $oggetto, $message, $headers); ?>

    Read the article

  • Is there an equivalent to Java's ClassFileTransformer in .NET? (a way to replace a class)

    - by Alix
    I've been searching for this for quite a while with no luck so far. Is there an equivalent to Java's ClassFileTransformer in .NET? Basically, I want to create a class CustomClassFileTransformer (which in Java would implement the interface ClassFileTransformer) that gets called whenever a class is loaded, and is allowed to tweak it and replace it with the tweaked version. I know there are frameworks that do similar things, but I was looking for something more straightforward, like implementing my own ClassFileTransformer. Is it possible? EDIT #1. More details about why I need this: Basically, I have a C# application and I need to monitor the instructions it wants to run in order to detect read or write operations to fields (operations Ldfld and Stfld) and insert some instructions before the read/write takes place. I know how to do this (except for the part where I need to be invoked to replace the class): for every method whose code I want to monitor, I must: Get the method's MethodBody using MethodBase.GetMethodBody() Transform it to byte array with MethodBody.GetILAsByteArray(). The byte[] it returns contains the bytecode. Analyse the bytecode as explained here, possibly inserting new instructions or deleting/modifying existing ones by changing the contents of the array. Create a new method and use the new bytecode to create its body, with MethodBuilder.CreateMethodBody(byte[] il, int count), where il is the array with the bytecode. I put all these tweaked methods in a new class and use the new class to replace the one that was originally going to be loaded. An alternative to replacing classes would be somehow getting notified whenever a method is invoked. Then I'd replace the call to that method with a call to my own tweaked method, which I would tweak only the first time is invoked and then I'd put it in a dictionary for future uses, to reduce overhead (for future calls I'll just look up the method and invoke it; I won't need to analyse the bytecode again). I'm currently investigating ways to do this and LinFu looks pretty interesting, but if there was something like a ClassFileTransformer it would be much simpler: I just rewrite the class, replace it, and let the code run without monitoring anything. An additional note: the classes may be sealed. I want to be able to replace any kind of class, I cannot impose restrictions on their attributes. EDIT #2. Why I need to do this at runtime. I need to monitor everything that is going on so that I can detect every access to data. This applies to the code of library classes as well. However, I cannot know in advance which classes are going to be used, and even if I knew every possible class that may get loaded it would be a huge performance hit to tweak all of them instead of waiting to see whether they actually get invoked or not. POSSIBLE (BUT PRETTY HARDCORE) SOLUTION. In case anyone is interested (and I see the question has been faved, so I guess someone is), this is what I'm looking at right now. Basically I'd have to implement the profiling API and I'll register for the events that I'm interested in, in my case whenever a JIT compilation starts. An extract of the blogpost: In your ICorProfilerCallback2::ModuleLoadFinished callback, you call ICorProfilerInfo2::GetModuleMetadata to get a pointer to a metadata interface on that module. QI for the metadata interface you want. Search MSDN for "IMetaDataImport", and grope through the table of contents to find topics on the metadata interfaces. Once you're in metadata-land, you have access to all the types in the module, including their fields and function prototypes. You may need to parse metadata signatures and this signature parser may be of use to you. In your ICorProfilerCallback2::JITCompilationStarted callback, you may use ICorProfilerInfo2::GetILFunctionBody to inspect the original IL, and ICorProfilerInfo2::GetILFunctionBodyAllocator and then ICorProfilerInfo2::SetILFunctionBody to replace that IL with your own. The great news: I get notified when a JIT compilation starts and I can replace the bytecode right there, without having to worry about replacing the class, etc. The not-so-great news: you cannot invoke managed code from the API's callback methods, which makes sense but means I'm on my own parsing the IL code, etc, as opposed to be able to use Cecil, which would've been a breeze. I don't think there's a simpler way to do this without using AOP frameworks (such as PostSharp). If anyone has any other idea please let me know. I'm not marking the question as answered yet.

    Read the article

  • Why am I getting null object reference error when saving (OnItemUpdating event) the first edit item

    - by craigmoliver
    I'm getting the error "Object reference not set to an instance of an object." when trying to reference a HiddenField (lvEditProjectSteps_hdnStepStatusId for future reference) from the EditItem during the OnItemUpdating event after the Update event fires in a ListView. This only occurs on the FIRST item in the ListView. I checked the source and the HTML is being rendered properly. ANY insight is appreciated! Thanks in advance... Source error: var lvEditProjectSteps_hdnStepStatusId = (HiddenField) lvEditProjectSteps.EditItem.FindControl("lvEditProjectSteps_hdnStepStatusId"); Here's the aspx side of the ListView: <asp:ListView ID="lvEditProjectSteps" runat="server" OnItemDataBound="lvEditProjectSteps_OnItemDataBound" OnItemUpdating="lvEditProjectSteps_OnItemUpdating" DataSourceID="odsEditProjectStep" DataKeyNames="Id"> <LayoutTemplate> <table class="standard-box-style" style="width:800px"> <thead> <tr> <th>&nbsp;</th> <th>&nbsp;</th> <th>Created</th> <th>Updated</th> </tr> </thead> <tbody> <asp:PlaceHolder ID="itemPlaceHolder" runat="server" /> </tbody> </table> </LayoutTemplate> <ItemTemplate> <tr> <td style="width:50px"<%# (Container.DisplayIndex % 2 == 0)?"":" class=\"row-alternating\"" %>> <asp:ImageButton ID="lvEditProjectSteps_btnEdit" runat="server" ImageUrl="~/admin/images/icons/edit.gif" AlternateText="Edit" SkinID="interfaceButton" CommandName="Edit" /> <asp:HiddenField ID="lvEditProjectSteps_hdnId" runat="server" Value='<%# Bind("Id")%>' /> <asp:HiddenField ID="lvEditProjectSteps_hdnStepStatusId" runat="server" Value='<%# Bind("StepStatusId")%>' /> <asp:HiddenField ID="lvEditProjectSteps_hdnStepStatusStepId" runat="server" Value='<%# Bind("StepStatus_StepId")%>' /> </td> <td style="width:30px"<%# (Container.DisplayIndex % 2 == 0)?"":" class=\"row-alternating\"" %>><asp:Image ID="imgStatus" runat="server" /></td> <td style="width:75px"<%# (Container.DisplayIndex % 2 == 0)?"":" class=\"row-alternating\"" %>><asp:Literal ID="litTsCreated" runat="server" /></td> <td style="width:75px"<%# (Container.DisplayIndex % 2 == 0)?"":" class=\"row-alternating\"" %>><asp:Literal ID="litTsUpdated" runat="server" /></td> </tr> </ItemTemplate> <EditItemTemplate> <tr> <td style="width:50px"<%# (Container.DisplayIndex % 2 == 0)?"":" class=\"row-alternating\"" %>> <asp:ImageButton ID="lvEditProjectSteps_btnUpdate" runat="server" ImageUrl="~/admin/images/icons/save.png" AlternateText="Save" SkinID="interfaceButton" CommandName="Update" ValidationGroup="EditProjectStepsSave" /> <asp:ImageButton ID="lvEditProjectSteps_btnCancel" runat="server" ImageUrl="~/admin/images/icons/cancel.png" AlternateText="Cancel" SkinID="interfaceButton" CommandName="Cancel" /> <asp:HiddenField ID="lvEditProjectSteps_hdnId" runat="server" Value='<%# Bind("Id")%>' /> <asp:HiddenField ID="lvEditProjectSteps_hdnStepStatusId" runat="server" Value='<%# Bind("StepStatusId")%>' /> <asp:HiddenField ID="lvEditProjectSteps_hdnStepStatusStepId" runat="server" Value='<%# Bind("StepStatus_StepId")%>' /> </td> <td style="width:180px" colspan="3"<%# (Container.DisplayIndex % 2 == 0)?"":" class=\"row-alternating\"" %>> <div><strong>Status</strong></div> <div class="radiobuttonlist-status"> <asp:RadioButtonList ID="lvEditProjectSteps_rblStatus" runat="server" RepeatDirection="Horizontal" AutoPostBack="true" OnSelectedIndexChanged="lvEditProjectSteps_rblStatus_OnSelectedIndexChanged"> <asp:ListItem Value="1"><img src="/images/icon/project-status/1.png" alt="Error" /></asp:ListItem> <asp:ListItem Value="2"><img src="/images/icon/project-status/2.png" alt="In Progress" /></asp:ListItem> <asp:ListItem Value="3"><img src="/images/icon/project-status/3.png" alt="Complete" /></asp:ListItem> </asp:RadioButtonList> <asp:RequiredFieldValidator ID="valRequired_lvEditProjectSteps_rblStatus" runat="server" ControlToValidate="lvEditProjectSteps_rblStatus" SetFocusOnError="true" Display="Dynamic" ErrorMessage="<br />^ required ^" ValidationGroup="EditProjectStepsSave" /> </div> </td> </tr> </EditItemTemplate> </asp:ListView> And the code-behind: protected void lvEditProjectSteps_OnItemDataBound(object sender, ListViewItemEventArgs e) { if (e.Item.ItemType == ListViewItemType.DataItem) { var info = (ProjectStepInfo)DataBinder.GetDataItem(e.Item); // View Item var litTsCreated = (Literal)e.Item.FindControl("litTsCreated"); var litTsUpdated = (Literal)e.Item.FindControl("litTsUpdated"); var imgStatus = (Image) e.Item.FindControl("imgStatus"); if (litTsCreated != null) litTsCreated.Text = String.Format("{0:d}", info.TsCreated); if (litTsUpdated != null) litTsUpdated.Text = String.Format("{0:d}", info.TsCreated); if (imgStatus != null) imgStatus.ImageUrl = String.Format("/images/icon/project-status/{0}.png", info.StepStatus_StatusId); // Edit Item var lvEditProjectSteps_rblStatus = (RadioButtonList) e.Item.FindControl("lvEditProjectSteps_rblStatus"); if (lvEditProjectSteps_rblStatus != null) lvEditProjectSteps_rblStatus.SelectedValue = info.StepStatus_StatusId.ToString(); } } protected void lvEditProjectSteps_OnItemUpdating(object sender, ListViewUpdateEventArgs e) { if (IsValid) { var oController = new Controller(); var lvEditProjectSteps_hdnStepStatusId = (HiddenField) lvEditProjectSteps.EditItem.FindControl("lvEditProjectSteps_hdnStepStatusId"); var lvEditProjectSteps_hdnStepStatusStepId = (HiddenField) lvEditProjectSteps.EditItem.FindControl("lvEditProjectSteps_hdnStepStatusStepId"); var lvEditProjectSteps_rblStatus = (RadioButtonList) lvEditProjectSteps.EditItem.FindControl("lvEditProjectSteps_rblStatus"); var infoStepStatus = oController.StepStatus_SelectOne_StepId_StatusId(Convert.ToInt32(lvEditProjectSteps_hdnStepStatusStepId.Value), Convert.ToInt32(lvEditProjectSteps_rblStatus.SelectedValue)); if (lvEditProjectSteps_hdnStepStatusId != null) { e.NewValues["ProjectId"] = Convert.ToInt32(lvEditProjectSteps_hdnProjectId.Value); e.NewValues["StepStatusId"] = infoStepStatus.Id; } else { Response.Write("cancel"); e.Cancel = true; } } else { Response.Write("cancel, not valid"); e.Cancel = true; } } protected void lvEditProjectSteps_rblStatus_OnSelectedIndexChanged(object sender, EventArgs e) { var oController = new Controller(); var rbl = (RadioButtonList)sender; var lvEditProjectSteps_txtText = (TextBox) rbl.NamingContainer.FindControl("lvEditProjectSteps_txtText"); var lvEditProjectSteps_txtComment = (TextBox)rbl.NamingContainer.FindControl("lvEditProjectSteps_txtComment"); var lvEditProjectSteps_hdnStepStatusStepId = (HiddenField) rbl.NamingContainer.FindControl("lvEditProjectSteps_hdnStepStatusStepId"); if (!String.IsNullOrEmpty(lvEditProjectSteps_hdnStepStatusStepId.Value) && lvEditProjectSteps_txtText != null && lvEditProjectSteps_txtComment != null) { var infoStep = oController.Step_SelectOne(Convert.ToInt32(lvEditProjectSteps_hdnStepStatusStepId.Value)); var infoStepStatus = oController.StepStatus_SelectOne_StepId_StatusId(Convert.ToInt32(lvEditProjectSteps_hdnStepStatusStepId.Value), Convert.ToInt32(rbl.SelectedValue)); lvEditProjectSteps_txtText.Text = infoStep.Name; lvEditProjectSteps_txtComment.Text = infoStepStatus.Text; } }

    Read the article

  • setIncludesSubentities: in an NSFetchRequest is broken for entities across multiple persistent store

    - by SG
    Prior art which doesn't quite address this: http://stackoverflow.com/questions/1774359/core-data-migration-error-message-model-does-not-contain-configuration-xyz I have narrowed this down to a specific issue. It takes a minute to set up, though; please bear with me. The gist of the issue is that a persistentStoreCoordinator (apparently) cannot preserve the part of an object graph where a managedObject is marked as a subentity of another when they are stored in different files. Here goes... 1) I have 2 xcdatamodel files, each containing a single entity. In runtime, when the managed object model is constructed, I manually define one entity as subentity of another using setSubentities:. This is because defining subentities across multiple files in the editor is not supported yet. I then return the complete model with modelByMergingModels. //Works! [mainEntity setSubentities:canvasEntities]; NSLog(@"confirm %@ is super for %@", [[[canvasEntities lastObject] superentity] name], [[canvasEntities lastObject] name]); //Output: "confirm Note is super for Browser" 2) I have modified the persistentStoreCoordinator method so that it sets a different store for each entity. Technically, it uses configurations, and each entity has one and only one configuration defined. //Also works! for ( NSString *configName in [[HACanvasPluginManager shared].registeredCanvasTypes valueForKey:@"viewControllerClassName"] ) { storeUrl = [NSURL fileURLWithPath:[[self applicationDocumentsDirectory] stringByAppendingPathComponent:[configName stringByAppendingPathExtension:@"sqlite"]]]; //NSLog(@"entities for configuration '%@': %@", configName, [[[self managedObjectModel] entitiesForConfiguration:configName] valueForKey:@"name"]); //Output: "entities for configuration 'HATextCanvasController': (Note)" //Output: "entities for configuration 'HAWebCanvasController': (Browser)" if (![persistentStoreCoordinator addPersistentStoreWithType:NSSQLiteStoreType configuration:configName URL:storeUrl options:options error:&error]) //etc 3) I have a fetchRequest set for the parent entity, with setIncludesSubentities: and setAffectedStores: just to be sure we get both 1) and 2) covered. When inserting objects of either entity, they both are added to the context and they both are fetched by the fetchedResultsController and displayed in the tableView as expected. // Create the fetch request for the entity. NSFetchRequest *fetchRequest = [[NSFetchRequest alloc] init]; [fetchRequest setEntity:entity]; [fetchRequest setIncludesSubentities:YES]; //NECESSARY to fetch all canvas types [fetchRequest setSortDescriptors:sortDescriptors]; [fetchRequest setFetchBatchSize:20]; // Set the batch size to a suitable number. [fetchRequest setAffectedStores:[[managedObjectContext persistentStoreCoordinator] persistentStores]]; [fetchRequest setReturnsObjectsAsFaults:NO]; Here is where it starts misbehaving: after closing and relaunching the app, ONLY THE PARENT ENTITY is fetched. If I change the entity of the request using setEntity: to the entity for 'Note', all notes are fetched. If I change it to the entity for 'Browser', all the browsers are fetched. Let me reiterate that during the run in which an object is first inserted into the context, it will appear in the list. It is only after save and relaunch that a fetch request fails to traverse the hierarchy. Therefore, I can only conclude that it is the storage of the inheritance that is the problem. Let's recap why: - Both entities can be created, inserted into the context, and viewed, so the model is working - Both entities can be fetched with a single request, so the inheritance is working - I can confirm that the files are being stored separately and objects are going into their appropriate stores, so saving is working - Launching the app with either entity set for the request works, so retrieval from the store is working - This also means that traversing different stores with the request is working - By using a single store instead of multiple, the problem goes away completely, so creating, storing, fetching, viewing etc is working correctly. This leaves only one culprit (to my mind): the inheritance I'm setting with setSubentities: is effective only for objects creating during the session. Either objects/entities are being stored stripped of the inheritance info, or entity inheritance as defined programmatically only applies to new instances, or both. Either of these is unacceptable. Either it's a bug or I am way, way off course. I have been at this every which way for two days; any insight is greatly appreciated. The current workaround - just using a single store - works completely, except it won't be future-proof in the event that I remove one of the models from the app etc. It also boggles the mind because I can't see why you would have all this infrastructure for storing across multiple stores and for setting affected stores in fetch requests if it by core definition (of setSubentities:) doesn't work.

    Read the article

  • Intellij Idea 13.x and ASM 5.x library incompatible?

    - by Jarrod Roberson
    I can't get Intellij Idea 13.0 to compile my code against ASM 5.0.3 I have a multi-module Maven project. It compiles and installs successfully. Apparently com.google.findbugs:findbugs has a dependency on asm:asm:3.3 and I want to use org.ow2.asm:asm:5.0.3 to manipulate some bytecode. So in the parent pom.xml I exclude the asm:asm:3.3 dependencies from the classpath. This works fine when I run mvn install from the command line. I can't get the Build - Make Project menu selection to work in Intellij Idea. Here is the relevant parts of my pom.xml files. parent.pom <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm-tree</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm-util</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm-commons</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>com.google.code.findbugs</groupId> <artifactId>findbugs</artifactId> <version>2.0.3</version> <exclusions> <exclusion> <groupId>asm</groupId> <artifactId>asm</artifactId> </exclusion> <exclusion> <groupId>asm</groupId> <artifactId>asm-commons</artifactId> </exclusion> <exclusion> <groupId>asm</groupId> <artifactId>asm-tree</artifactId> </exclusion> </exclusions> </dependency> Here is the code that is failing 18 public static void main(final String[] args) throws IOException 19 { 20 final InputStream is = NotEmptyTest.class.getResourceAsStream("/com/vertigrated/annotation/NotEmptyTest.class"); 21 final ClassReader cr = new ClassReader(is); 22 final ClassNode cn = new ClassNode(); 23 cr.accept(cn, 0); 24 for (final MethodNode mn : cn.methods) 25 { 26 - 38 snipped for brevity 39 } 40 } 41 } Here is the error message: Information:Using javac 1.7.0_25 to compile java sources Information:java: Errors occurred while compiling module 'tests' Information:Compilation completed with 1 error and 2 warnings in 2 sec Information:1 error Information:2 warnings /<path to my source code>/NotEmptyTest.java Error:Error:line (24)java: incompatible types required: org.objectweb.asm.tree.MethodNode found: java.lang.Object Warning:Warning:java: /<path to my project>//NotEmptyTest.java uses unchecked or unsafe operations. Warning:Warning:java: Recompile with -Xlint:unchecked for details. As you can see in the screen capture, it reports the correct version of the libraries in the Javadoc but the AutoComplete shows the old 3.3 non-typesafe return value of List instead of List<MethodNode>: Here is what Maven knows, which is correct: [INFO] --- maven-dependency-plugin:2.8:list (default-cli) @ tests --- [INFO] [INFO] The following files have been resolved: [INFO] com.google.code.findbugs:bcel:jar:2.0.1:compile [INFO] junit:junit:jar:4.11:test [INFO] xml-apis:xml-apis:jar:1.0.b2:compile [INFO] com.apple:AppleJavaExtensions:jar:1.4:compile [INFO] javax.inject:javax.inject:jar:1:compile [INFO] jaxen:jaxen:jar:1.1.6:compile [INFO] org.ow2.asm:asm-util:jar:5.0.3:compile [INFO] com.google.inject:guice:jar:3.0:compile [INFO] dom4j:dom4j:jar:1.6.1:compile [INFO] com.google.code.findbugs:jFormatString:jar:2.0.1:compile [INFO] net.jcip:jcip-annotations:jar:1.0:compile [INFO] org.ow2.asm:asm-tree:jar:5.0.3:compile [INFO] commons-lang:commons-lang:jar:2.6:compile [INFO] com.google.code.findbugs:jsr305:jar:2.0.1:compile [INFO] org.hamcrest:hamcrest-core:jar:1.3:test [INFO] aopalliance:aopalliance:jar:1.0:compile [INFO] com.google.code.findbugs:findbugs:jar:2.0.3:compile [INFO] org.ow2.asm:asm-commons:jar:5.0.3:compile [INFO] org.ow2.asm:asm:jar:5.0.3:compile How do I get Intellij Idea to use the correct dependency internally?

    Read the article

  • Why does this XML validation via XSD fail in libxml2 (but succeed in xmllint) and how do I fix it?

    - by mtree
    If I run this XML validation via xmllint: xmllint --noout --schema schema.xsd test.xml I get this success message: .../test.xml validates However if I run the same validation via libxml2's C API: int result = xmlSchemaValidateDoc(...) I get a return value of 1845 and this failure message: Element '{http://example.com/XMLSchema/1.0}foo': No matching global declaration available for the validation root. Which I can make absolutely no sense of. :( schema.xsd: <?xml version="1.0" encoding="utf-8" ?> <!DOCTYPE xs:schema PUBLIC "-//W3C//DTD XMLSCHEMA 200102//EN" "XMLSchema.dtd" > <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns="http://example.com/XMLSchema/1.0" targetNamespace="http://example.com/XMLSchema/1.0" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xs:element name="foo"> </xs:element> </xs:schema> test.xml: <?xml version="1.0" encoding="UTF-8"?> <foo xmlns="http://example.com/XMLSchema/1.0"> </foo> main.c: #include <stdio.h> #include <sys/stat.h> #include <sys/types.h> #include <string.h> #include <libxml/parser.h> #include <libxml/valid.h> #include <libxml/xmlschemas.h> u_int32_t get_file_size(const char *file_name) { struct stat buf; if ( stat(file_name, &buf) != 0 ) return(0); return (unsigned int)buf.st_size; } void handleValidationError(void *ctx, const char *format, ...) { char *errMsg; va_list args; va_start(args, format); vasprintf(&errMsg, format, args); va_end(args); fprintf(stderr, "Validation Error: %s", errMsg); free(errMsg); } int main (int argc, const char * argv[]) { const char *xsdPath = argv[1]; const char *xmlPath = argv[2]; printf("\n"); printf("XSD File: %s\n", xsdPath); printf("XML File: %s\n", xmlPath); int xmlLength = get_file_size(xmlPath); char *xmlSource = (char *)malloc(sizeof(char) * xmlLength); FILE *p = fopen(xmlPath, "r"); char c; unsigned int i = 0; while ((c = fgetc(p)) != EOF) { xmlSource[i++] = c; } printf("\n"); printf("XML Source:\n\n%s\n", xmlSource); fclose(p); printf("\n"); int result = 42; xmlSchemaParserCtxtPtr parserCtxt = NULL; xmlSchemaPtr schema = NULL; xmlSchemaValidCtxtPtr validCtxt = NULL; xmlDocPtr xmlDocumentPointer = xmlParseMemory(xmlSource, xmlLength); parserCtxt = xmlSchemaNewParserCtxt(xsdPath); if (parserCtxt == NULL) { fprintf(stderr, "Could not create XSD schema parsing context.\n"); goto leave; } schema = xmlSchemaParse(parserCtxt); if (schema == NULL) { fprintf(stderr, "Could not parse XSD schema.\n"); goto leave; } validCtxt = xmlSchemaNewValidCtxt(schema); if (!validCtxt) { fprintf(stderr, "Could not create XSD schema validation context.\n"); goto leave; } xmlSetStructuredErrorFunc(NULL, NULL); xmlSetGenericErrorFunc(NULL, handleValidationError); xmlThrDefSetStructuredErrorFunc(NULL, NULL); xmlThrDefSetGenericErrorFunc(NULL, handleValidationError); result = xmlSchemaValidateDoc(validCtxt, xmlDocumentPointer); leave: if (parserCtxt) { xmlSchemaFreeParserCtxt(parserCtxt); } if (schema) { xmlSchemaFree(schema); } if (validCtxt) { xmlSchemaFreeValidCtxt(validCtxt); } printf("\n"); printf("Validation successful: %s (result: %d)\n", (result == 0) ? "YES" : "NO", result); return 0; } console output: XSD File: /Users/dephiniteloop/Desktop/xml_validate/schema.xsd XML File: /Users/dephiniteloop/Desktop/xml_validate/test.gkml XML Source: <?xml version="1.0" encoding="UTF-8"?> <foo xmlns="http://example.com/XMLSchema/1.0"> </foo> Validation Error: Element '{http://example.com/XMLSchema/1.0}foo': No matching global declaration available for the validation root. Validation successful: NO (result: 1845) In case it matters: I'm on OSX 10.6.7 with its default libxml2.dylib (/Developer/SDKs/MacOSX10.6.sdk/usr/lib/libxml2.2.7.3.dylib)

    Read the article

  • Mutating the expression tree of a predicate to target another type

    - by Jon
    Intro In the application I 'm currently working on, there are two kinds of each business object: the "ActiveRecord" type, and the "DataContract" type. So for example, we have: namespace ActiveRecord { class Widget { public int Id { get; set; } } } namespace DataContracts { class Widget { public int Id { get; set; } } } The database access layer takes care of "translating" between hierarchies: you can tell it to update a DataContracts.Widget, and it will magically create an ActiveRecord.Widget with the same property values and save that. The problem I have surfaced when attempting to refactor this database access layer. The Problem I want to add methods like the following to the database access layer: // Widget is DataContract.Widget interface DbAccessLayer { IEnumerable<Widget> GetMany(Expression<Func<Widget, bool>> predicate); } The above is a simple general-use "get" method with custom predicate. The only point of interest is that I 'm not passing in an anonymous function but rather an expression tree. This is done because inside DbAccessLayer we have to query ActiveRecord.Widget efficiently (LINQ to SQL) and not have the database return all ActiveRecord.Widget instances and then filter the enumerable collection. We need to pass in an expression tree, so we ask for one as the parameter for GetMany. The snag: the parameter we have needs to be magically transformed from an Expression<Func<DataContract.Widget, bool>> to an Expression<Func<ActiveRecord.Widget, bool>>. This is where I haven't managed to pull it off... Attempted Solution What we 'd like to do inside GetMany is: IEnumerable<DataContract.Widget> GetMany( Expression<Func<DataContract.Widget, bool>> predicate) { var lambda = Expression.Lambda<Func<ActiveRecord.Widget, bool>>( predicate.Body, predicate.Parameters); // use lambda to query ActiveRecord.Widget and return some value } This won't work because in a typical scenario, for example if: predicate == w => w.Id == 0; ...the expression tree contains a MemberAccessExpression instance which has a MemberInfo property (named Member) that point to members of DataContract.Widget. There are also ParameterExpression instances both in the expression tree and in its parameter expression collection (predicate.Parameters); After searching a bit, I found System.Linq.Expressions.ExpressionVisitor (its source can be found here in the context of a how-to, very helpful) which is a convenient way to modify an expression tree. Armed with this, I implemented a visitor. This simple visitor only takes care of changing the types in member access and parameter expressions. It may not be complete, but it's fine for the expression w => w.Id == 0. internal class Visitor : ExpressionVisitor { private readonly Func<Type, Type> dataContractToActiveRecordTypeConverter; public Visitor(Func<Type, Type> dataContractToActiveRecordTypeConverter) { this.dataContractToActiveRecordTypeConverter = dataContractToActiveRecordTypeConverter; } protected override Expression VisitMember(MemberExpression node) { var dataContractType = node.Member.ReflectedType; var activeRecordType = this.dataContractToActiveRecordTypeConverter(dataContractType); var converted = Expression.MakeMemberAccess( base.Visit(node.Expression), activeRecordType.GetProperty(node.Member.Name)); return converted; } protected override Expression VisitParameter(ParameterExpression node) { var dataContractType = node.Type; var activeRecordType = this.dataContractToActiveRecordTypeConverter(dataContractType); return Expression.Parameter(activeRecordType, node.Name); } } With this visitor, GetMany becomes: IEnumerable<DataContract.Widget> GetMany( Expression<Func<DataContract.Widget, bool>> predicate) { var visitor = new Visitor(...); var lambda = Expression.Lambda<Func<ActiveRecord.Widget, bool>>( visitor.Visit(predicate.Body), predicate.Parameters.Select(p => visitor.Visit(p)); var widgets = ActiveRecord.Widget.Repository().Where(lambda); // This is just for reference, see below Expression<Func<ActiveRecord.Widget, bool>> referenceLambda = w => w.Id == 0; // Here we 'd convert the widgets to instances of DataContract.Widget and // return them -- this has nothing to do with the question though. } Results The good news is that lambda is constructed just fine. The bad news is that it isn't working; it's blowing up on me when I try to use it (the exception messages are really not helpful at all). I have examined the lambda my code produces and a hardcoded lambda with the same expression; they look exactly the same. I spent hours in the debugger trying to find some difference, but I can't. When predicate is w => w.Id == 0, lambda looks exactly like referenceLambda. But the latter works with e.g. IQueryable<T>.Where, while the former does not (I have tried this in the immediate window of the debugger). I should also mention that when predicate is w => true, it all works just fine. Therefore I am assuming that I 'm not doing enough work in Visitor, but I can't find any more leads to follow on. Can someone point me in the right direction? Thanks in advance for your help!

    Read the article

  • Implementation question involving implementing an interface

    - by Vivin Paliath
    I'm writing a set of collection classes for different types of Trees. I'm doing this as a learning exercise and I'm also hoping it turns out to be something useful. I really want to do this the right way and so I've been reading Effective Java and I've also been looking at the way Joshua Bloch implemented the collection classes by looking at the source. I seem to have a fair idea of what is being done, but I still have a few things to sort out. I have a Node<T> interface and an AbstractNode<T> class that implements the Node interface. I then created a GenericNode<T> (a node that can have 0 to n children, and that is part of an n-ary tree) class that extends AbstractNode<T> and implements Node<T>. This part was easy. Next, I created a Tree<T> interface and an AbstractTree<T> class that implements the Tree<T> interface. After that, I started writing a GenericTree<T> class that extends AbstractTree<T> and implements Tree<T>. This is where I started having problems. As far as the design is concerned, a GenericTree<T> can only consist of nodes of type GenericTreeNode<T>. This includes the root. In my Tree<T> interface I have: public interface Tree<T> { void setRoot(Node<T> root); Node<T> getRoot(); List<Node<T>> postOrder(); ... rest omitted ... } And, AbstractTree<T> implements this interface: public abstract class AbstractTree<T> implements Tree<T> { protected Node<T> root; protected AbstractTree() { } protected AbstractTree(Node<T> root) { this.root = root; } public void setRoot(Node<T> root) { this.root = root; } public Node<T> getRoot() { return this.root; } ... rest omitted ... } In GenericTree<T>, I can have: public GenericTree(Node<T> root) { super(root); } But what this means is that you can create a generic tree using any subtype of Node<T>. You can also set the root of a tree to any subtype of Node<T>. I want to be able to restrict the type of the node to the type of the tree that it can represent. To fix this, I can do this: public GenericTree(GenericNode<T> root) { super(root); } However, setRoot still accepts a parameter of type Node<T>. Which means a user can still create a tree with the wrong type of root node. How do I enforce this constraint? The only way I can think of doing is either: Do an instanceof which limits the check to runtime. I'm not a huge fan of this. Remove setRoot from the interface and have the base class implement this method. This means that it is not part of the contract and anyone who wants to make a new type of tree needs to remember to implement this method. Is there a better way? The second question I have concerns the return type of postOrder which is List<Node<T>>. This means that if a user is operating on a GenericTree<T> object and calls postOrder, he or she receives a list that consists of Node<T> objects. This means when iterating through (using a foreach construct) they would have perform an explicit cast to GenericNode<T> if they want to use methods that are only defined in that class. I don't like having to place this burden on the user. What are my options in this case? I can only think of removing the method from the interface and have the subclass implement this method making sure that it returns a list of appropriate subtype of Node<T>. However, this once again removes it from the contract and it's anyone who wants to create a new type of tree has to remember to implement this method. Is there a better way?

    Read the article

  • How to create a SOAP REQUEST using ASP.NET (VB) without using Visual

    - by user311691
    Hi all , I urgently need your help . I am new to consuming a web service using SOAP protocol. I have been given a demo webservice URL which ends in .WSDL and NOT .asml?WSDL. The problem is I cannot add a web reference using Visual studio OR Disco.exe or Wsdl.exe - This webservice has been created on a java platform and for security reasons the only way to make a invoke the webservice is at runtime using SOAP protocol IN asp.net (VB). I I have created some code but cannot seem to send the soap object to the receiving web service. If I could get a solution with step by step instructions on how I can send a SOAP REQUEST. Below is my code and all am trying to do is send a SOAP REQUEST and receive a SOAP RESPONSE which I will display in my browser. <%@ page language="vb" %> <%@ Import Namespace="System.Data"%> <%@ Import Namespace="System.Xml"%> <%@ Import Namespace="System.Net"%> <%@ Import Namespace="System.IO"%> <%@ Import Namespace="System.Text"%> <script runat=server> Private Sub Page_Load() Dim objHTTPReq As HttpWebRequest Dim WebserviceUrl As String = "http://xx.xx.xx:8084/asy/wsdl/asy.wsdl" objHTTPReq = CType(WebRequest.Create(WebserviceUrl), HttpWebRequest) Dim soapXML As String soapXML = "<?xml version='1.0' encoding='utf-8'?>" & _ " <soap:Envelope xmlns:xsi='http://www.w3.org/2001/XMLSchema-instance'" & _ " xmlns:xsd='http://www.w3.org/2001/XMLSchema'"& _ " xmlns:soap='http://schemas.xmlsoap.org/soap/envelope/' >"& _ " <soap:Body> "& _ " <validatePaymentData xmlns='http://asybanks.webservices.asycuda.org'> " & _ " <bankCode>"& bankCode &"</bankCode> " & _ " <PaymentDataType>" & _ " <paymentType>"& payment_type &"</paymentType> " & _ " <amount>"& ass_amount &"</amount> " & _ " <ReferenceType>" & _ " <year>"& year &"</year> " & _ " <customsOfficeCode>"& station &"</customsOfficeCode> " & _ " </ReferenceType>" & _ " <accountNumber>"& zra_account &"</accountNumber> " & _ " </PaymentDataType> " & _ " </validatePaymentData> " & _ " </soap:Body> " & _ " </soap:Envelope> " objHTTPReq.Headers.Add("SOAPAction", "http://asybanks.webservices.asycuda.org") objHTTPReq.ContentType = "text/xml; charset=utf-8" objHTTPReq.ContentLength = soapXML.Length objHTTPReq.Accept = "text/xml" objHTTPReq.Method = "POST" Dim objHTTPRes As HttpWebResponse = CType(objHTTPReq.GetResponse(), HttpWebResponse) Dim dataStream As Stream = objHTTPRes.GetResponseStream() Dim reader As StreamReader = new StreamReader(dataStream) Dim responseFromServer As String = reader.ReadToEnd() OurXml.text = responseFromServer End Sub </script> <html xmlns="http://www.w3.org/1999/xhtml"> <head runat="server"> <title> XML TRANSACTION SIMULATION - N@W@ TJ </title> </head> <body> <form id="form1" runat="server"> <div> <p>ZRA test Feedback:</p> <asp:label id="OurXml" runat="server"/> </div> </form> </body> </html> the demo webservice looks like this: <?xml version="1.0" encoding="UTF-8" ?> - <!-- WEB SERVICE JAVA DEMO --> - <definitions targetNamespace="http://asybanks.webservices.asycuda.org" xmlns="http://schemas.xmlsoap.org/wsdl/" xmlns:apachesoap="http://xml.apache.org/xml-soap" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns:y="http://asybanks.webservices.asycuda.org"> - <types> - <xs:schema elementFormDefault="qualified" targetNamespace="http://asybanks.webservices.asycuda.org" xmlns="http://www.w3.org/2001/XMLSchema"> SOME OTHER INFORMATION AT THE BOTTOM <soap:address location="http://xx.xx.xx:8084/asy/services/asy" /> </port> </service> </definitions> From the above excerpt of the wsdl url webservice, I am not sure which namespace to use for soapACTION - please advise.... Please if you could comment every stage of a soap request and provide a working demo - I would be most grateful as I would be learning rather than just assuming stuff :)

    Read the article

  • Reverse engineering windows mobile live search CellID location awareness protocol (yikes)...

    - by Jean-Charles
    I wasn't sure of how to form the question so I apologize if the title is misleading. Additionally, you may want to get some coffee and take a seat for this one ... It's long. Basically, I'm trying to reverse engineer the protocol used by the Windows Mobile Live Search application to get location based on cellID. Before I go on, I am aware of other open source services (such as OpenCellID) but this is more for the sake of education and a bit for redundancy. According to the packets I captured, a POST request is made to ... mobile.search.live.com/positionlookupservice_1/service.aspx ... with a few specific headers (agent, content-length, etc) and no body. Once this goes through, the server sends back a 100-Continue response. At this point, the application submits this data (I chopped off the packet header): 00 00 00 01 00 00 00 05 55 54 ........UT 46 2d 38 05 65 6e 2d 55 53 05 65 6e 2d 55 53 01 F-8.en-US.en-US. 06 44 65 76 69 63 65 05 64 75 6d 6d 79 01 06 02 .Device.dummy... 50 4c 08 0e 52 65 76 65 72 73 65 47 65 6f 63 6f PL..ReverseGeoco 64 65 01 07 0b 47 50 53 43 68 69 70 49 6e 66 6f de...GPSChipInfo 01 20 06 09 43 65 6c 6c 54 6f 77 65 72 06 03 43 . ..CellTower..C 47 49 08 03 4d 43 43 b6 02 07 03 4d 4e 43 03 34 GI..MCC....MNC.4 31 30 08 03 4c 41 43 cf 36 08 02 43 49 fd 01 00 10..LAC.6..CI... 00 00 00 ... And receives this in response (packet and HTTP response headers chopped): 00 00 00 01 00 00 00 00 01 06 02 50 4c ...........PL 06 08 4c 6f 63 61 6c 69 74 79 06 08 4c 6f 63 61 ..Locality..Loca 74 69 6f 6e 07 03 4c 61 74 09 34 32 2e 33 37 35 tion..Lat.42.375 36 32 31 07 04 4c 6f 6e 67 0a 2d 37 31 2e 31 35 621..Long.-71.15 38 39 33 38 00 07 06 52 61 64 69 75 73 09 32 30 8938...Radius.20 30 30 2e 30 30 30 30 00 42 07 0c 4c 6f 63 61 6c 00.0000.B..Local 69 74 79 4e 61 6d 65 09 57 61 74 65 72 74 6f 77 ityName.Watertow 6e 07 16 41 64 6d 69 6e 69 73 74 72 61 74 69 76 n..Administrativ 65 41 72 65 61 4e 61 6d 65 0d 4d 61 73 73 61 63 eAreaName.Massac 68 75 73 65 74 74 73 07 10 50 6f 73 74 61 6c 43 husetts..PostalC 6f 64 65 4e 75 6d 62 65 72 05 30 32 34 37 32 07 odeNumber.02472. 0b 43 6f 75 6e 74 72 79 4e 61 6d 65 0d 55 6e 69 .CountryName.Uni 74 65 64 20 53 74 61 74 65 73 00 00 00 ted States... Now, here is what I've determined so far: All strings are prepended with one byte that is the decimal equivalent of their length. There seem to be three different casts that are used throughout the request and response. They show up as one byte before the length byte. I've concluded that the three types map out as follows: 0x06 - parent element (subsequent values are children, closed with 0x00) 0x07 - string 0x08 - int? Based on these determinations, here is what the request and response look like in a more readable manner (values surrounded by brackets denote length and values surrounded by parenthesis denote a cast): \0x00\0x00\0x00\0x01\0x00\0x00\0x00 [5]UTF-8 [5]en-US [5]en-US \0x01 [6]Device [5]dummy \0x01 (6)[2]PL (8)[14]ReverseGeocode\0x01 (7)[11]GPSChipInfo[1]\0x20 (6)[9]CellTower (6)[3]CGI (8)[3]MCC\0xB6\0x02 //310 (7)[3]MNC[3]410 //410 (8)[3]LAC\0xCF\0x36 //6991 (8)[2]CI\0xFD\0x01 //259 \0x00 \0x00 \0x00 \0x00 and.. \0x00\0x00\0x00\0x01\0x00\0x00\0x00 \0x00\0x01 (6)[2]PL (6)[8]Locality (6)[8]Location (7)[3]Lat[9]42.375621 (7)[4]Long[10]-71.158938 \0x00 (7)[6]Radius[9]2000.0000 \0x00 \0x42 //"B" ... Has to do with GSM (7)[12]LocalityName[9]Watertown (7)[22]AdministrativeAreaName[13]Massachusetts (7)[16]PostalCodeNumber[5]02472 (7)[11]CountryName[13]United States \0x00 \0x00\0x00 My analysis seems to work out pretty well except for a few things: The 0x01s throughout confuse me ... At first I thought they were some sort of base level element terminators but I'm not certain. I'm not sure the 7-byte header is, in fact, a seven byte header. I wonder if it's maybe 4 bytes and that the three remaining 0x00s are of some other significance. The trailing 0x00s. Why is it that there is only one on the request but two on the response? The type 8 cast mentioned above ... I can't seem to figure out how those values are being encoded. I added comments to those lines with what the values should correspond to. Any advice on these four points will be greatly appreciated. And yes, these packets were captured in Watertown, MA. :)

    Read the article

  • linux thread synchronization

    - by johnnycrash
    I am new to linux and linux threads. I have spent some time googling to try to understand the differences between all the functions available for thread synchronization. I still have some questions. I have found all of these different types of synchronizations, each with a number of functions for locking, unlocking, testing the lock, etc. gcc atomic operations futexes mutexes spinlocks seqlocks rculocks conditions semaphores My current (but probably flawed) understanding is this: semaphores are process wide, involve the filesystem (virtually I assume), and are probably the slowest. Futexes might be the base locking mechanism used by mutexes, spinlocks, seqlocks, and rculocks. Futexes might be faster than the locking mechanisms that are based on them. Spinlocks dont block and thus avoid context swtiches. However they avoid the context switch at the expense of consuming all the cycles on a CPU until the lock is released (spinning). They should only should be used on multi processor systems for obvious reasons. Never sleep in a spinlock. The seq lock just tells you when you finished your work if a writer changed the data the work was based on. You have to go back and repeat the work in this case. Atomic operations are the fastest synch call, and probably are used in all the above locking mechanisms. You do not want to use atomic operations on all the fields in your shared data. You want to use a lock (mutex, futex, spin, seq, rcu) or a single atomic opertation on a lock flag when you are accessing multiple data fields. My questions go like this: Am I right so far with my assumptions? Does anyone know the cpu cycle cost of the various options? I am adding parallelism to the app so we can get better wall time response at the expense of running fewer app instances per box. Performances is the utmost consideration. I don't want to consume cpu with context switching, spinning, or lots of extra cpu cycles to read and write shared memory. I am absolutely concerned with number of cpu cycles consumed. Which (if any) of the locks prevent interruption of a thread by the scheduler or interrupt...or am I just an idiot and all synchonization mechanisms do this. What kinds of interruption are prevented? Can I block all threads or threads just on the locking thread's CPU? This question stems from my fear of interrupting a thread holding a lock for a very commonly used function. I expect that the scheduler might schedule any number of other workers who will likely run into this function and then block because it was locked. A lot of context switching would be wasted until the thread with the lock gets rescheduled and finishes. I can re-write this function to minimize lock time, but still it is so commonly called I would like to use a lock that prevents interruption...across all processors. I am writing user code...so I get software interrupts, not hardware ones...right? I should stay away from any functions (spin/seq locks) that have the word "irq" in them. Which locks are for writing kernel or driver code and which are meant for user mode? Does anyone think using an atomic operation to have multiple threads move through a linked list is nuts? I am thinking to atomicly change the current item pointer to the next item in the list. If the attempt works, then the thread can safely use the data the current item pointed to before it was moved. Other threads would now be moved along the list. futexes? Any reason to use them instead of mutexes? Is there a better way than using a condition to sleep a thread when there is no work? When using gcc atomic ops, specifically the test_and_set, can I get a performance increase by doing a non atomic test first and then using test_and_set to confirm? *I know this will be case specific, so here is the case. There is a large collection of work items, say thousands. Each work item has a flag that is initialized to 0. When a thread has exclusive access to the work item, the flag will be one. There will be lots of worker threads. Any time a thread is looking for work, they can non atomicly test for 1. If they read a 1, we know for certain that the work is unavailable. If they read a zero, they need to perform the atomic test_and_set to confirm. So if the atomic test_and_set is 500 cpu cycles because it is disabling pipelining, causes cpu's to communicate and L2 caches to flush/fill .... and a simple test is 1 cycle .... then as long as I had a better ratio of 500 to 1 when it came to stumbling upon already completed work items....this would be a win.* I hope to use mutexes or spinlocks to sparilngly protect sections of code that I want only one thread on the SYSTEM (not jsut the CPU) to access at a time. I hope to sparingly use gcc atomic ops to select work and minimize use of mutexes and spinlocks. For instance: a flag in a work item can be checked to see if a thread has worked it (0=no, 1=yes or in progress). A simple test_and_set tells the thread if it has work or needs to move on. I hope to use conditions to wake up threads when there is work. Thanks!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • C# Reading and Writing a Char[] to and from a Byte[] - Updated with Solution

    - by Simon G
    Hi, I have a byte array of around 10,000 bytes which is basically a blob from delphi that contains char, string, double and arrays of various types. This need to be read in and updated via C#. I've created a very basic reader that gets the byte array from the db and converts the bytes to the relevant object type when accessing the property which works fine. My problem is when I try to write to a specific char[] item, it doesn't seem to update the byte array. I've created the following extensions for reading and writing: public static class CharExtension { public static byte ToByte( this char c ) { return Convert.ToByte( c ); } public static byte ToByte( this char c, int position, byte[] blob ) { byte b = c.ToByte(); blob[position] = b; return b; } } public static class CharArrayExtension { public static byte[] ToByteArray( this char[] c ) { byte[] b = new byte[c.Length]; for ( int i = 1; i < c.Length; i++ ) { b[i] = c[i].ToByte(); } return b; } public static byte[] ToByteArray( this char[] c, int positon, int length, byte[] blob ) { byte[] b = c.ToByteArray(); Array.Copy( b, 0, blob, positon, length ); return b; } } public static class ByteExtension { public static char ToChar( this byte[] b, int position ) { return Convert.ToChar( b[position] ); } } public static class ByteArrayExtension { public static char[] ToCharArray( this byte[] b, int position, int length ) { char[] c = new char[length]; for ( int i = 0; i < length; i++ ) { c[i] = b.ToChar( position ); position += 1; } return c; } } to read and write chars and char arrays my code looks like: Byte[] _Blob; // set from a db field public char ubin { get { return _tariffBlob.ToChar( 14 ); } set { value.ToByte( 14, _Blob ); } } public char[] usercaplas { get { return _tariffBlob.ToCharArray( 2035, 10 ); } set { value.ToByteArray( 2035, 10, _Blob ); } } So to write to the objects I can do: ubin = 'C'; // this will update the byte[] usercaplas = new char[10] { 'A', 'B', etc. }; // this will update the byte[] usercaplas[3] = 'C'; // this does not update the byte[] I know the reason is that the setter property is not being called but I want to know is there a way around this using code similar to what I already have? I know a possible solution is to use a private variable called _usercaplas that I set and update as needed however as the byte array is nearly 10,000 bytes in length the class is already long and I would like a simpler approach as to reduce the overall code length and complexity. Thank Solution Here's my solution should anyone want it. If you have a better way of doing then let me know please. First I created a new class for the array: public class CharArrayList : ArrayList { char[] arr; private byte[] blob; private int length = 0; private int position = 0; public CharArrayList( byte[] blob, int position, int length ) { this.blob = blob; this.length = length; this.position = position; PopulateInternalArray(); SetArray(); } private void PopulateInternalArray() { arr = blob.ToCharArray( position, length ); } private void SetArray() { foreach ( char c in arr ) { this.Add( c ); } } private void UpdateInternalArray() { this.Clear(); SetArray(); } public char this[int i] { get { return arr[i]; } set { arr[i] = value; UpdateInternalArray(); } } } Then I created a couple of extension methods to help with converting to a byte[] public static byte[] ToByteArray( this CharArrayList c ) { byte[] b = new byte[c.Count]; for ( int i = 0; i < c.Count; i++ ) { b[i] = Convert.ToChar( c[i] ).ToByte(); } return b; } public static byte[] ToByteArray( this CharArrayList c, byte[] blob, int position, int length ) { byte[] b = c.ToByteArray(); Array.Copy( b, 0, blob, position, length ); return b; } So to read and write to the object: private CharArrayList _usercaplass; public CharArrayList usercaplas { get { if ( _usercaplass == null ) _usercaplass = new CharArrayList( _tariffBlob, 2035, 100 ); return _usercaplass; } set { _usercaplass = value; _usercaplass.ToByteArray( _tariffBlob, 2035, 100 ); } } As mentioned before its not an ideal solutions as I have to have private variables and extra code in the setter but I couldnt see a way around it.

    Read the article

  • What arguments do I send a function being called by a button in python?

    - by Jared
    I have a UI, in that UI is 4 text fields and 1 int field, then I have a function that calls to another function based on what's inside of the text fields, this function has (self, *args). My function that is being called to takes five arguments and I don't know what to put in it to make it actually work with my UI because python button's send an argument of their own. I have tried self and *args, but it doesn't work. Here is my code, didn't include most of the UI code since it is self explanatory: def crBC(self, IKJoint, FKJoint, bindJoint, xQuan, switch): ''' You should have a controller with an attribute 'ikFkBlend' - The name can be changed after the script executes. Controller should contain an enum - FK/DYN(0), IK(1). Specify the IK joint, then either the dynamic or FK joint, then the bind joint. Then a quantity of joints to pass through and connect. Tested currently on 600 joints (200 x 3), executed in less than a second. Returns nothing. Please open your script editor for details. ''' import itertools # gets children joints of the selected joint chHipIK = cmds.listRelatives(IKJoint, ad = True, type = 'joint') chHipFK = cmds.listRelatives(FKJoint, ad = True, type = 'joint') chHipBind = cmds.listRelatives(bindJoint, ad = True, type = 'joint') # list is built backwards, this reverses the list chHipIK.reverse() chHipFK.reverse() chHipBind.reverse() # appends the initial joint to the list chHipIK.append(IKJoint) chHipFK.append(FKJoint) chHipBind.append(bindJoint) # puts the last joint at the start of the list because the initial joint # was added to the end chHipIK.insert(0, chHipIK.pop()) chHipFK.insert(0, chHipFK.pop()) chHipBind.insert(0, chHipBind.pop()) # pops off the remaining joints in the list the user does not wish to be blended chHipBind[xQuan:] = [] chHipIK[xQuan:] = [] chHipFK[xQuan:] = [] # goes through the bind joints, makes a blend colors for each one, connects # the switch to the blender for a, b, c in itertools.izip(chHipBind, chHipIK, chHipFK): rotBC = cmds.shadingNode('blendColors', asUtility = True, n = a + 'rotate_BC') tranBC = cmds.shadingNode('blendColors', asUtility = True, n = a + 'tran_BC') scaleBC = cmds.shadingNode('blendColors', asUtility = True, n = a + 'scale_BC') cmds.connectAttr(switch + '.ikFkSwitch', rotBC + '.blender') cmds.connectAttr(switch + '.ikFkSwitch', tranBC + '.blender') cmds.connectAttr(switch + '.ikFkSwitch', scaleBC + '.blender') # goes through the ik joints, connects to the blend colors cmds.connectAttr(b + '.rotate', rotBC + '.color1', force = True) cmds.connectAttr(b + '.translate', tranBC + '.color1', force = True) cmds.connectAttr(b + '.scale', scaleBC + '.color1', force = True) # connects FK joints to the blend colors cmds.connectAttr(c + '.rotate', rotBC + '.color2') cmds.connectAttr(c + '.translate', tranBC + '.color2') cmds.connectAttr(c + '.scale', scaleBC + '.color2') # connects blend colors to bind joints cmds.connectAttr(rotBC + '.output', a + '.rotate') cmds.connectAttr(tranBC + '.output', a + '.translate') cmds.connectAttr(scaleBC + '.output', a + '.scale') ------------------- def execCrBC(self, *args): g.crBC(cmds.textField(self.ikJBC, q = True, tx = True), cmds.textField(self.fkJBC, q = True, tx = True), cmds.textField(self.bindJBC, q = True, tx = True), cmds.intField(self.bQBC, q = True, v = True), cmds.textField(self.sCBC, q = True, tx = True)) ------------------- self.bQBC = cmds.intField() cmds.text(l = '') self.sCBC = cmds.textField() cmds.text(l = '') cmds.button(l = 'Help Docs', c = self.crBC.__doc__) cmds.setParent('..') cmds.button(l = 'Create', c = self.execCrBC) Here is the code causing the problem as requested: import maya.cmds as cmds import jtRigUI.createDummyRig as dum import jtRigUI.createSkeleton as sk import jtRigUI.generalUtilities as gu import jtRigUI.createLegRig as lr import jtRigUI.createArmRig as ar class RUI(dum.Dict, dum.Dummy, sk.Skel, sk.FiSkel, lr.LeanLocs, lr.LegRig, ar.ArmRig, gu.Gutils): def __init__(self, charNameUI, gScaleUI, fingButtonGrp, thumbCheckBox, spineButtonGrp, neckButtonGrp, ikJBC, fkJBC, bindJBC, bQBC, sCBC): rigUI = 'rigUI' if cmds.window(rigUI, exists = True): cmds.deleteUI(rigUI) rigUI = cmds.window(rigUI, t = 'JT Rigging UI', sizeable = False, tb = True, mnb = False, mxb = False, menuBar = True, tlb = True, nm = 5) form = cmds.formLayout() tabs = cmds.tabLayout(innerMarginWidth = 1, innerMarginHeight = 1) rigUIMenu = cmds.menu('Help', hm = True) aboutMenu = cmds.menuItem('about') cmds.popupMenu('about', button = 1) deleteUIMenu = cmds.menu('Delete', hm = True) cmds.menuItem('dummySkeleton') cmds.formLayout(form, edit = True, attachForm = ((tabs, 'top', 0), (tabs, 'left', 0), (tabs, 'bottom', 0), (tabs, 'right', 0)), w = 30) tab1 = cmds.rowColumnLayout('Dummy') #cmds.columnLayout(rowSpacing = 10) #cmds.setParent('..') cmds.frameLayout(l = 'A: Dummy Skeleton Setup', w = 400) self.charNameUI = cmds.textFieldGrp (label="Optional Character Name:", ann="Insert a name for the character or leave empty.", tx = '', w = 1) fingJUI = cmds.frameLayout(l = 'B: Number of Fingers', w = 10) cmds.text('\n', h = 5) self.fingButtonGrp = cmds.radioButtonGrp('fingRadio', p = fingJUI, l = 'Fingers: ', sl = 4, w = 1, numberOfRadioButtons = 4, labelArray4 = ['One', 'Two', 'Three', 'Four'], ct2 = ('left', 'left'), cw5 = [60,60,60,60,60]) self.thumbCheckBox = cmds.checkBoxGrp(l = 'Thumb: ', v1 = True) cmds.text('\n', h = 5) spineJUI = cmds.frameLayout(l = 'C: Number of Spine Joints') cmds.text('\n', h = 5) self.spineButtonGrp = cmds.radioButtonGrp('spineRadio', p = spineJUI, l = 'Spine Joints: ', sl = 2, w = 1, numberOfRadioButtons = 3, labelArray3 = ['Three', 'Five', 'Ten'], ct2 = ('left', 'left'), cw4 = [95,95,95,95]) cmds.text('\n', h = 5) neckJUI = cmds.frameLayout(l = 'D: Number of Neck Joints') cmds.text('\n', h = 5) self.neckButtonGrp = cmds.radioButtonGrp('neckRadio', p = neckJUI, l = 'Neck Joints: ', sl = 0, w = 1, numberOfRadioButtons = 3, labelArray3 = ['Two', 'Three', 'Four'], ct2 = ('left', 'left'), cw4 = [95,95,95,95]) cmds.text('\n', h = 5) cmds.setParent('..') cmds.setParent('..') cmds.setParent('..') cmds.frameLayout('E: Creation') cmds.text('SAVE FIRST: CAN NOT UNDO', bgc = (0.2,0.2,0.2)) cmds.button(l = '\nCreate Dummy Skeleton\n', c = self.build) # also have it make char name field grey cmds.text('Elbows and Knees must have bend.', bgc = (0.2,0.2,0.2)) cmds.columnLayout() cmds.setParent('..') cmds.setParent('..') cmds.setParent('..') cmds.setParent('..') tab2 = cmds.rowColumnLayout('Skeleton') cmds.columnLayout(columnAttach = ('both', 5), rowSpacing = 10, columnWidth = 150) cmds.setParent('..') cmds.frameLayout(l = 'A: Skeleton Setup') cmds.text('SAVE FIRST: CAN NOT UNDO', bgc = (0.2,0.2,0.2)) cmds.button(l = '\nConvert to Skeleton - Orient - Set LRA\n', c = self.buildSkel) self.gScaleUI = cmds.textFieldGrp (label="Scale Multiplier:", ann="Scale multipler of Character: basis for all further base controllers", tx = '1.0', w = 1, ed = False, en = False, visible = True) cmds.frameLayout('B: Manual Orientation') cmds.text('You must manually check finger, thumb, leg, foot orientation specifically.\nConfirm rest of joints.\nSpine: X aim, Y point backwards from spine, Z to the side.\nFingers: X is aim, Y points upwards, Z to the side - Spread on Y, curl on Z.\nFoot: Pivots on Y, rolls on Z, leans on X.') cmds.columnLayout() cmds.setParent('..') cmds.frameLayout('C: Finalize Creation of Skeleton') cmds.button(l = '\nFinalize Skeleton\n', c = self.finishS) cmds.setParent('..') cmds.setParent('..') cmds.setParent('..') cmds.setParent('..') tab3 = cmds.rowColumnLayout('Legs') cmds.columnLayout(columnAttach = ('both', 5), rowSpacing = 10, columnWidth = 150) cmds.setParent('..') cmds.frameLayout(l = 'A: Leg Rig Setup') cmds.button(l = '\nGenerate Foot Lean Locators\n', c = self.makeLean) cmds.text('Place on either side of the foot.\nDo not rotate: Automatic orientation in place.') cmds.frameLayout(l = 'B: Rig Legs') cmds.button(l = '\nRig Legs\n', c = self.makeLegs) cmds.setParent('..') cmds.setParent('..') cmds.setParent('..') tab4 = cmds.rowColumnLayout('Arms') cmds.columnLayout(columnAttach = ('both', 5), rowSpacing = 10, columnWidth = 150) cmds.setParent('..') cmds.frameLayout(l = 'A: Arm Rig Setup') cmds.button(l = '\nA: Rig Arms\n', c = self.makeArms) cmds.setParent('..') cmds.setParent('..') tab5 = cmds.rowColumnLayout('Spine and Head') cmds.columnLayout(columnAttach = ('both', 5), rowSpacing = 10, columnWidth = 150) cmds.setParent('..') cmds.frameLayout(l = 'Spine Rig Setup') cmds.setParent('..') cmds.setParent('..') tab6 = cmds.rowColumnLayout('Stretchy IK') cmds.columnLayout(columnAttach = ('both', 5), rowSpacing = 10, columnWidth = 150) cmds.setParent('..') cmds.frameLayout(l = 'Stretchy Setup') cmds.setParent('..') cmds.setParent('..') tab6 = cmds.rowColumnLayout('Extras') cmds.scrollLayout(saw = 600, sah = 600, cr = True) cmds.columnLayout(columnAttach = ('both', 5), rowSpacing = 10, columnWidth = 150) cmds.setParent('..') cmds.frameLayout(l = 'General Utitlities') cmds.text('\nHere are all my general utilities for various things') cmds.frameLayout(l = 'Automatic Blend Colors Creation and Connection') cmds.rowColumnLayout(nc = 5, w = 10) cmds.text('IK Joint:') cmds.text(l = '') cmds.text('FK/Dyn Joint:') cmds.text(l = '') cmds.text('Bind Joint:') self.ikJBC = cmds.textField() cmds.text(l = '') self.fkJBC = cmds.textField() cmds.text(l = '') self.bindJBC = cmds.textField() cmds.text(' \nBlend Quantity:') cmds.text(l = '') cmds.text(' \nSwitch Control:') cmds.text(l = '') cmds.text(l = '') self.bQBC = cmds.intField() cmds.text(l = '') self.sCBC = cmds.textField() cmds.text(l = '') cmds.button(l = 'Help Docs', c = self.crBC.__doc__) cmds.setParent('..') cmds.button(l = 'Create', c = self.execCrBC) cmds.text(l = '') cmds.setParent('..') cmds.frameLayout(l = 'Make Spline IK Curve Stretch And Squash') cmds.rowColumnLayout(nc = 5, w = 10) cmds.text('Curve Name:') cmds.text(l = '') cmds.text('Setup Name:') cmds.text(l = '') cmds.text('Joint Quantity:') self.ikJBC = cmds.textField() cmds.text(l = '') self.fkJBC = cmds.textField() cmds.text(l = '') self.bindJBC = cmds.textField() cmds.text(' \nSwitch Control:') cmds.text(l = '') cmds.text(' \nGlobal Control:') cmds.text(l = '') cmds.text(l = '') self.bQBC = cmds.intField() cmds.text(l = '') self.sCBC = cmds.textField() cmds.text(l = '') cmds.button(l = 'Help Docs', c = self.crBC.__doc__) cmds.setParent('..') cmds.button(l = 'Create', c = self.execCrBC) cmds.setParent('..') cmds.showWindow(rigUI) r = RUI('charNameUI', 'gScaleUI', 'fingButtonGrp', 'thumbCheckBox', 'spineButtonGrp', 'neckButtonGrp', 'ikJBC', 'fkJBC', 'bindJBC', 'bQBC', 'sCBC') # last modified at 6.20 pm 29th June 2011

    Read the article

  • Help required in adding new methods, properties into existing classes dynamically

    - by Bepenfriends
    Hi All, I am not sure whether it is possible to achieve this kind of implementation in Dot Net. Below are the information Currently we are on an application which is done in COM+, ASP, XSL, XML technologies. It is a multi tier architecture application in which COM+ acts as the BAL. The execution steps for any CRUD operation will be defined using a seperate UI which uses XML to store the information. BAL reads the XML and understands the execution steps which are defined and executes corresponding methods in DLL. Much like EDM we have our custom model (using XML) which determines which property of object is searchable, retrievable etc. Based on this information BAL constructs queries and calls procedures to get the data. In the current application both BAL and DAL are heavily customizable without doing any code change. the results will be transmitted to presentation layer in XML format which constructs the UI based on the data recieved. Now I am creating a migration project which deals with employee information. It is also going to follow the N Tier architecture in which the presentation layer communicates with BAL which connects to DAL to return the Data. Here is the problem, In our existing version we are handling every information as XML in its native form (no converstion of object etc), but in the migration project, Team is really interested in utilizing the OOP model of development where every information which is sent from BAL need to be converted to objects of its respective types (example employeeCollection, Address Collection etc). If we have the static number of data returned from BAL we can have a class which contains those nodes as properties and we can access the same. But in our case the data returned from our BAL need to be customized. How can we handle the customization in presentation layer which is converting the result to an Object. Below is an example of the XML returned <employees> <employee> <firstName>Employee 1 First Name</firstName> <lastName>Employee 1 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>3</addressType> <StreetName>Street name3</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> <employee> <firstName>Employee 2 First Name</firstName> <lastName>Employee 2 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> </employees> If these are the only columns then i can write a class which is like public class Address{ public int AddressType {get;set;}; public string StreetName {get;set;}; public string RegionName {get;set;}; } public class Employee{ public string FirstName {get; set;} public string LastName {get; set;} public string AddressCollection {get; set;} } public class EmployeeCollection : List<Employee>{ public bool Add (Employee Data){ .... } } public class AddressCollection : List<Address>{ public bool Add (Address Data){ .... } } This class will be provided to customers and consultants as DLLs. We will not provide the source code for the same. Now when the consultants or customers does customization(example adding country to address and adding passport information object with employee object) they must be able to access those properties in these classes, but without source code they will not be able to do those modifications.which makes the application useless. Is there is any way to acomplish this in DotNet. I thought of using Anonymous classes but, the problem with Anonymous classes are we can not have methods in it. I am not sure how can i fit the collection objects (which will be inturn an anonymous class) Not sure about datagrid / user control binding etc. I also thought of using CODEDom to create classes runtime but not sure about the meory, performance issues. also the classes must be created only once and must use the same till there is another change. Kindly help me out in this problem. Any kind of help meterial/ cryptic code/ links will be helpful.

    Read the article

  • php - upload script mkdir saying file already exists when same directory even though different filename

    - by neeko
    my upload script says my file already exists when i try upload even though different filename <?php // Start a session for error reporting session_start(); ?> <?php // Check, if username session is NOT set then this page will jump to login page if (!isset($_SESSION['username'])) { header('Location: index.html'); } // Call our connection file include('config.php'); // Check to see if the type of file uploaded is a valid image type function is_valid_type($file) { // This is an array that holds all the valid image MIME types $valid_types = array("image/jpg", "image/JPG", "image/jpeg", "image/bmp", "image/gif", "image/png"); if (in_array($file['type'], $valid_types)) return 1; return 0; } // Just a short function that prints out the contents of an array in a manner that's easy to read // I used this function during debugging but it serves no purpose at run time for this example function showContents($array) { echo "<pre>"; print_r($array); echo "</pre>"; } // Set some constants // Grab the User ID we sent from our form $user_id = $_SESSION['username']; $category = $_POST['category']; // This variable is the path to the image folder where all the images are going to be stored // Note that there is a trailing forward slash $TARGET_PATH = "img/users/$category/$user_id/"; mkdir($TARGET_PATH, 0755, true); // Get our POSTed variables $fname = $_POST['fname']; $lname = $_POST['lname']; $contact = $_POST['contact']; $price = $_POST['price']; $image = $_FILES['image']; // Build our target path full string. This is where the file will be moved do // i.e. images/picture.jpg $TARGET_PATH .= $image['name']; // Make sure all the fields from the form have inputs if ( $fname == "" || $lname == "" || $image['name'] == "" ) { $_SESSION['error'] = "All fields are required"; header("Location: error.php"); exit; } // Check to make sure that our file is actually an image // You check the file type instead of the extension because the extension can easily be faked if (!is_valid_type($image)) { $_SESSION['error'] = "You must upload a jpeg, gif, or bmp"; header("Location: error.php"); exit; } // Here we check to see if a file with that name already exists // You could get past filename problems by appending a timestamp to the filename and then continuing if (file_exists($TARGET_PATH)) { $_SESSION['error'] = "A file with that name already exists"; header("Location: error.php"); exit; } // Lets attempt to move the file from its temporary directory to its new home if (move_uploaded_file($image['tmp_name'], $TARGET_PATH)) { // NOTE: This is where a lot of people make mistakes. // We are *not* putting the image into the database; we are putting a reference to the file's location on the server $imagename = $image['name']; $sql = "insert into people (price, contact, category, username, fname, lname, expire, filename) values (:price, :contact, :category, :user_id, :fname, :lname, now() + INTERVAL 1 MONTH, :imagename)"; $q = $conn->prepare($sql) or die("failed!"); $q->bindParam(':price', $price, PDO::PARAM_STR); $q->bindParam(':contact', $contact, PDO::PARAM_STR); $q->bindParam(':category', $category, PDO::PARAM_STR); $q->bindParam(':user_id', $user_id, PDO::PARAM_STR); $q->bindParam(':fname', $fname, PDO::PARAM_STR); $q->bindParam(':lname', $lname, PDO::PARAM_STR); $q->bindParam(':imagename', $imagename, PDO::PARAM_STR); $q->execute(); $sql1 = "UPDATE people SET firstname = (SELECT firstname FROM user WHERE username=:user_id1) WHERE username=:user_id2"; $q = $conn->prepare($sql1) or die("failed!"); $q->bindParam(':user_id1', $user_id, PDO::PARAM_STR); $q->bindParam(':user_id2', $user_id, PDO::PARAM_STR); $q->execute(); $sql2 = "UPDATE people SET surname = (SELECT surname FROM user WHERE username=:user_id1) WHERE username=:user_id2"; $q = $conn->prepare($sql2) or die("failed!"); $q->bindParam(':user_id1', $user_id, PDO::PARAM_STR); $q->bindParam(':user_id2', $user_id, PDO::PARAM_STR); $q->execute(); header("Location: search.php"); exit; } else { // A common cause of file moving failures is because of bad permissions on the directory attempting to be written to // Make sure you chmod the directory to be writeable $_SESSION['error'] = "Could not upload file. Check read/write persmissions on the directory"; header("Location: error.php"); exit; } ?>

    Read the article

  • Pointers to Derived Class Objects Losing vfptr

    - by duckworthd
    To begin, I am trying to write a run-of-the-mill, simple Ray Tracer. In my Ray Tracer, I have multiple types of geometries in the world, all derived from a base class called "SceneObject". I've included the header for it here. /** Interface for all objects that will appear in a scene */ class SceneObject { public: mat4 M, M_inv; Color c; SceneObject(); ~SceneObject(); /** The transformation matrix to be applied to all points of this object. Identity leaves the object in world frame. */ void setMatrix(mat4 M); void setMatrix(MatrixStack mStack); void getMatrix(mat4& M); /** The color of the object */ void setColor(Color c); void getColor(Color& c); /** Alter one portion of the color, leaving the rest as they were. */ void setDiffuse(vec3 rgb); void setSpecular(vec3 rgb); void setEmission(vec3 rgb); void setAmbient(vec3 rgb); void setShininess(double s); /** Fills 'inter' with information regarding an intersection between this object and 'ray'. Ray should be in world frame. */ virtual void intersect(Intersection& inter, Ray ray) = 0; /** Returns a copy of this SceneObject */ virtual SceneObject* clone() = 0; /** Print information regarding this SceneObject for debugging */ virtual void print() = 0; }; As you can see, I've included a couple virtual functions to be implemented elsewhere. In this case, I have only two derived class -- Sphere and Triangle, both of which implement the missing member functions. Finally, I have a Parser class, which is full of static methods that do the actual "Ray Tracing" part. Here's a couple snippets for relevant portions void Parser::trace(Camera cam, Scene scene, string outputFile, int maxDepth) { int width = cam.getNumXPixels(); int height = cam.getNumYPixels(); vector<vector<vec3>> colors; colors.clear(); for (int i = 0; i< width; i++) { vector<vec3> ys; for (int j = 0; j<height; j++) { Intersection intrsct; Ray ray; cam.getRay(ray, i, j); vec3 color; printf("Obtaining color for Ray[%d,%d]\n", i,j); getColor(color, scene, ray, maxDepth); ys.push_back(color); } colors.push_back(ys); } printImage(colors, width, height, outputFile); } void Parser::getColor(vec3& color, Scene scene, Ray ray, int numBounces) { Intersection inter; scene.intersect(inter,ray); if(inter.isIntersecting()){ Color c; inter.getColor(c); c.getAmbient(color); } else { color = vec3(0,0,0); } } Right now, I've forgone the true Ray Tracing part and instead simply return the color of the first object hit, if any. As you have no doubt noticed, the only way the computer knows that a ray has intersected an object is through Scene.intersect(), which I also include. void Scene::intersect(Intersection& i, Ray r) { Intersection result; result.setDistance(numeric_limits<double>::infinity()); result.setIsIntersecting(false); double oldDist; result.getDistance(oldDist); /* Cycle through all objects, making result the closest one */ for(int ind=0; ind<objects.size(); ind++){ SceneObject* thisObj = objects[ind]; Intersection betterIntersect; thisObj->intersect(betterIntersect, r); double newDist; betterIntersect.getDistance(newDist); if (newDist < oldDist){ result = betterIntersect; oldDist = newDist; } } i = result; } Alright, now for the problem. I begin by creating a scene and filling it with objects outside of the Parser::trace() method. Now for some odd reason, I cast Ray for i=j=0 and everything works wonderfully. However, by the time the second ray is cast all of the objects stored in my Scene no longer recognize their vfptr's! I stepped through the code with a debugger and found that the information to all the vfptr's are lost somewhere between the end of getColor() and the continuation of the loop. However, if I change the arguments of getColor() to use a Scene& instead of a Scene, then no loss occurs. What crazy voodoo is this?

    Read the article

  • What's wrong with Bundler working with RubyGems to push a Git repo to Heroku?

    - by stanigator
    I've made sure that all the files are in the root of the repository as recommended in this discussion. However, as I follow the instructions in this section of the book, I can't get through the section without the problems. What do you think is happening with my system that's causing the error? I have no clue at the moment of what the problem means despite reading the following in the log. Thanks in advance for your help! stanley@ubuntu:~/rails_sample/first_app$ git push heroku master Warning: Permanently added the RSA host key for IP address '50.19.85.156' to the list of known hosts. Counting objects: 96, done. Compressing objects: 100% (79/79), done. Writing objects: 100% (96/96), 28.81 KiB, done. Total 96 (delta 22), reused 0 (delta 0) -----> Heroku receiving push -----> Ruby/Rails app detected -----> Installing dependencies using Bundler version 1.2.0.pre Running: bundle install --without development:test --path vendor/bundle --binstubs bin/ --deployment Fetching gem metadata from https://rubygems.org/....... Installing rake (0.9.2.2) Installing i18n (0.6.0) Installing multi_json (1.3.5) Installing activesupport (3.2.3) Installing builder (3.0.0) Installing activemodel (3.2.3) Installing erubis (2.7.0) Installing journey (1.0.3) Installing rack (1.4.1) Installing rack-cache (1.2) Installing rack-test (0.6.1) Installing hike (1.2.1) Installing tilt (1.3.3) Installing sprockets (2.1.3) Installing actionpack (3.2.3) Installing mime-types (1.18) Installing polyglot (0.3.3) Installing treetop (1.4.10) Installing mail (2.4.4) Installing actionmailer (3.2.3) Installing arel (3.0.2) Installing tzinfo (0.3.33) Installing activerecord (3.2.3) Installing activeresource (3.2.3) Installing coffee-script-source (1.3.3) Installing execjs (1.3.2) Installing coffee-script (2.2.0) Installing rack-ssl (1.3.2) Installing json (1.7.3) with native extensions Installing rdoc (3.12) Installing thor (0.14.6) Installing railties (3.2.3) Installing coffee-rails (3.2.2) Installing jquery-rails (2.0.2) Using bundler (1.2.0.pre) Installing rails (3.2.3) Installing sass (3.1.18) Installing sass-rails (3.2.5) Installing sqlite3 (1.3.6) with native extensions Gem::Installer::ExtensionBuildError: ERROR: Failed to build gem native extension. /usr/local/bin/ruby extconf.rb checking for sqlite3.h... no sqlite3.h is missing. Try 'port install sqlite3 +universal' or 'yum install sqlite-devel' and check your shared library search path (the location where your sqlite3 shared library is located). *** extconf.rb failed *** Could not create Makefile due to some reason, probably lack of necessary libraries and/or headers. Check the mkmf.log file for more details. You may need configuration options. Provided configuration options: --with-opt-dir --without-opt-dir --with-opt-include --without-opt-include=${opt-dir}/include --with-opt-lib --without-opt-lib=${opt-dir}/lib --with-make-prog --without-make-prog --srcdir=. --curdir --ruby=/usr/local/bin/ruby --with-sqlite3-dir --without-sqlite3-dir --with-sqlite3-include --without-sqlite3-include=${sqlite3-dir}/include --with-sqlite3-lib --without-sqlite3-lib=${sqlite3-dir}/lib --enable-local --disable-local Gem files will remain installed in /tmp/build_3tplrxvj7qa81/vendor/bundle/ruby/1.9.1/gems/sqlite3-1.3.6 for inspection. Results logged to /tmp/build_3tplrxvj7qa81/vendor/bundle/ruby/1.9.1/gems/sqlite3-1.3.6/ext/sqlite3/gem_make.out An error occurred while installing sqlite3 (1.3.6), and Bundler cannot continue. Make sure that `gem install sqlite3 -v '1.3.6'` succeeds before bundling. ! ! Failed to install gems via Bundler. ! ! Heroku push rejected, failed to compile Ruby/rails app To [email protected]:growing-mountain-2788.git ! [remote rejected] master -> master (pre-receive hook declined) error: failed to push some refs to '[email protected]:growing-mountain-2788.git' ------Gemfile------------------------ As requested, here's the auto-generated gemfile: source 'https://rubygems.org' gem 'rails', '3.2.3' # Bundle edge Rails instead: # gem 'rails', :git => 'git://github.com/rails/rails.git' gem 'sqlite3' gem 'json' # Gems used only for assets and not required # in production environments by default. group :assets do gem 'sass-rails', '~> 3.2.3' gem 'coffee-rails', '~> 3.2.1' # See https://github.com/sstephenson/execjs#readme for more supported runtimes # gem 'therubyracer', :platform => :ruby gem 'uglifier', '>= 1.0.3' end gem 'jquery-rails' # To use ActiveModel has_secure_password # gem 'bcrypt-ruby', '~> 3.0.0' # To use Jbuilder templates for JSON # gem 'jbuilder' # Use unicorn as the app server # gem 'unicorn' # Deploy with Capistrano # gem 'capistrano' # To use debugger # gem 'ruby-debug'

    Read the article

  • asp .net MVC 2.0 Validation

    - by ANDyW
    Hi I’m trying to do some validation in asp .net MVC 2.0 for my application. I want to have some nice client side validation. Validation should be done most time on model side with DataAnnotations with custom attributes( like CompareTo, StringLenght, MinPasswordLenght (from Membership.MinimumumpassworkdLenght value). For that purpose I tried to use xval with jquery.validation. Some specific thing is that most of forms will be working with ajax and most problems are when I want to validate form with ajax. Here is link for sample project http://www.sendspace.com/file/m9gl54 . I got two forms as controls ValidFormControl1.ascx, ValidFormControl2.ascx <% using (Ajax.BeginForm("CreateValidForm", "Test", new AjaxOptions { HttpMethod = "Post" })) {%> <div id="validationSummary1"> <%= Html.ValidationSummary(true)%> </div> <fieldset> <legend>Fields</legend> <div class="editor-label"> <%= Html.LabelFor(model => model.Name)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Name)%> <%= Html.ValidationMessageFor(model => model.Name)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Email)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Email)%> <%= Html.ValidationMessageFor(model => model.Email)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Password)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Password)%> <%= Html.ValidationMessageFor(model => model.Password)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.ConfirmPassword)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.ConfirmPassword)%> <%= Html.ValidationMessageFor(model => model.ConfirmPassword)%> </div> <p> <input type="submit" value="Create" /> </p> </fieldset> <% } %> <%= Html.ClientSideValidation<ValidModel>() .UseValidationSummary("validationSummary1", "Please fix the following problems:") %> Both look same the difference is only validation summaryID (validationSummary1, validationSummary2). Both controls are rendered on one page : Form2 <%Html.RenderPartial("~/Views/Test/ValidFormControl2.ascx", null); %> Form1 <%Html.RenderPartial("~/Views/Test/ValidFormControl.ascx", null); %> Validation property First problem, when we have two controls with same type to validate it don’t work becosue html elements are rendered by field name ( so we have two element with same name “Password” ). Only first form will be validated by client side. The worst thing is that even if we have different types and their fields name is same validation won’t work too ( this thing is what I need to repair it will be stupid to name some unique properites for validation ). Is there any solution for this ? Custom attributes validation Next thing custom attributes validation ( All those error are when I use Ajax for on normal form validation is working without problem. ): CompareTo - Simple compare to that is done in mvc template for account model ( class attribute saying with two property will be compared ) , and it wasn’t show on page. To do it I created own CachingRulesProvider with compareRule and my Attribute. Maybe there is more easy way to do it? StringLenght with minimum and maximum value, I won’t describe how I done it but is there any easy whey to do it? Validation summary When I have two two control on page all summary validation information goes to first control validation summary element, even xval generated script say that elementID are different for summary. Any one know how to repair it? Validation Information Is there any option to turn on messages on place where is Html.ValidationMessageFor(model = model.ConfirmPassword). Becsoue for me it isn’t show up. I would like to have summary and near field information too not only red border. Any one know how to do it? Ajax submit Anyone know how to do easy without massive code in javascript to do submit via javascript. This will be used to change input submit to href element (a). Both look same the difference is only validation summaryID

    Read the article

  • Why is phpseclib producing incompatible certs?

    - by chacham15
    Why is it that when I try to use a certificate/key pair generated from phpseclib, the OpenSSL server code errors out? Certs/Keys generated from OpenSSL work fine. How do I fix this? Certificate/Key Generation taken straight from phpseclib documentation: <?php include('File/X509.php'); include('Crypt/RSA.php'); // create private key / x.509 cert for stunnel / website $privKey = new Crypt_RSA(); extract($privKey-createKey()); $privKey-loadKey($privatekey); $pubKey = new Crypt_RSA(); $pubKey-loadKey($publickey); $pubKey-setPublicKey(); $subject = new File_X509(); $subject-setDNProp('id-at-organizationName', 'phpseclib demo cert'); //$subject-removeDNProp('id-at-organizationName'); $subject-setPublicKey($pubKey); $issuer = new File_X509(); $issuer-setPrivateKey($privKey); $issuer-setDN($subject-getDN()); $x509 = new File_X509(); //$x509-setStartDate('-1 month'); // default: now //$x509-setEndDate('+1 year'); // default: +1 year $result = $x509-sign($issuer, $subject); echo "the stunnel.pem contents are as follows:\r\n\r\n"; echo $privKey-getPrivateKey(); echo "\r\n"; echo $x509-saveX509($result); echo "\r\n"; ? OpenSSL sample SSL server taken straight from OpenSSL example code: #include <stdio.h #include <unistd.h #include <stdlib.h #include <memory.h #include <errno.h #include <sys/types.h #include <sys/socket.h #include <netinet/in.h #include <arpa/inet.h #include <netdb.h #include <openssl/rsa.h /* SSLeay stuff */ #include <openssl/crypto.h #include <openssl/x509.h #include <openssl/pem.h #include <openssl/ssl.h #include <openssl/err.h #define CHK_NULL(x) if ((x)==NULL) exit (1) #define CHK_ERR(err,s) if ((err)==-1) { perror(s); exit(1); } #define CHK_SSL(err) if ((err)==-1) { ERR_print_errors_fp(stderr); exit(2); } int main (int argc, char *argv[]) { int err; int listen_sd; int sd; struct sockaddr_in sa_serv; struct sockaddr_in sa_cli; size_t client_len; SSL_CTX* ctx; SSL* ssl; X509* client_cert; char* str; char buf [4096]; SSL_METHOD *meth; /* SSL preliminaries. We keep the certificate and key with the context. */ SSL_load_error_strings(); SSLeay_add_ssl_algorithms(); meth = SSLv23_server_method(); ctx = SSL_CTX_new (meth); if (!ctx) { ERR_print_errors_fp(stderr); exit(2); } if (SSL_CTX_use_certificate_file(ctx, argv[1], SSL_FILETYPE_PEM) <= 0) { ERR_print_errors_fp(stderr); exit(3); } if (SSL_CTX_use_PrivateKey_file(ctx, argv[2], SSL_FILETYPE_PEM) <= 0) { ERR_print_errors_fp(stderr); exit(4); } if (!SSL_CTX_check_private_key(ctx)) { fprintf(stderr,"Private key does not match the certificate public key\n"); exit(5); } /* ----------------------------------------------- */ /* Prepare TCP socket for receiving connections */ listen_sd = socket (AF_INET, SOCK_STREAM, 0); CHK_ERR(listen_sd, "socket"); memset (&sa_serv, '\0', sizeof(sa_serv)); sa_serv.sin_family = AF_INET; sa_serv.sin_addr.s_addr = INADDR_ANY; sa_serv.sin_port = htons (1111); /* Server Port number */ err = bind(listen_sd, (struct sockaddr*) &sa_serv, sizeof (sa_serv)); CHK_ERR(err, "bind"); /* Receive a TCP connection. */ err = listen (listen_sd, 5); CHK_ERR(err, "listen"); client_len = sizeof(sa_cli); sd = accept (listen_sd, (struct sockaddr*) &sa_cli, (unsigned int*)&client_len); CHK_ERR(sd, "accept"); close (listen_sd); printf ("Connection from %lx, port %x\n", sa_cli.sin_addr.s_addr, sa_cli.sin_port); /* ----------------------------------------------- */ /* TCP connection is ready. Do server side SSL. */ ssl = SSL_new (ctx); CHK_NULL(ssl); SSL_set_fd (ssl, sd); err = SSL_accept (ssl); CHK_SSL(err); /* Get the cipher - opt */ printf ("SSL connection using %s\n", SSL_get_cipher (ssl)); /* Get client's certificate (note: beware of dynamic allocation) - opt */ client_cert = SSL_get_peer_certificate (ssl); if (client_cert != NULL) { printf ("Client certificate:\n"); str = X509_NAME_oneline (X509_get_subject_name (client_cert), 0, 0); CHK_NULL(str); printf ("\t subject: %s\n", str); OPENSSL_free (str); str = X509_NAME_oneline (X509_get_issuer_name (client_cert), 0, 0); CHK_NULL(str); printf ("\t issuer: %s\n", str); OPENSSL_free (str); /* We could do all sorts of certificate verification stuff here before deallocating the certificate. */ X509_free (client_cert); } else printf ("Client does not have certificate.\n"); /* DATA EXCHANGE - Receive message and send reply. */ err = SSL_read (ssl, buf, sizeof(buf) - 1); CHK_SSL(err); buf[err] = '\0'; printf ("Got %d chars:'%s'\n", err, buf); err = SSL_write (ssl, "I hear you.", strlen("I hear you.")); CHK_SSL(err); /* Clean up. */ close (sd); SSL_free (ssl); SSL_CTX_free (ctx); return 1; } /* EOF - serv.cpp */ This program errors with: (the error is printed out on the call to SSL_write) Connection from 100007f, port a7ff SSL connection using (NONE) Client does not have certificate. Got 0 chars:'' 82673:error:1409E0E5:SSL routines:SSL3_WRITE_BYTES:ssl handshake failure:/SourceCache/OpenSSL098/OpenSSL098-44/src/ssl/s3_pkt.c:539: Here is the relevant code referenced by the error: int ssl3_write_bytes(SSL *s, int type, const void *buf_, int len) { const unsigned char *buf=buf_; unsigned int tot,n,nw; int i; s-rwstate=SSL_NOTHING; tot=s-s3-wnum; s-s3-wnum=0; if (SSL_in_init(s) && !s-in_handshake) { i=s-handshake_func(s); if (i < 0) return(i); if (i == 0) { SSLerr(SSL_F_SSL3_WRITE_BYTES,SSL_R_SSL_HANDSHAKE_FAILURE); return -1; } } ...etc

    Read the article

  • how to count checked checkboxes in different divs

    - by KMKMAHESH
    <head><title>STUDENT WISE EXAM BACKLOGS DISPLAY FOR EXAM REGISTRATION</title> <style type="text/css"> th { font-family:Arial; color:black; border:1px solid #000; } thead { display:table-header-group; } tbody { display:table-row-group; } td { border:1px solid #000; } </style> <script type="text/javascript" > function check_value(year,sem){ ysem="ys"+year+sem; var reg=document.registration.regulation.value; subjectsys="subjects"+year+sem; amountsys="amount"+year+sem; if(year==1){ if(sem==1){ var value_list = document.getElementById("ys11").getElementsByTagName('input'); } if(sem==2){ var value_list = document.getElementById("ys12").getElementsByTagName('input'); } }elseif(year==2){ if(sem==1){ var value_list = document.getElementById("ys21").getElementsByTagName('input'); } if(sem==2){ var value_list = document.getElementById("ys22").getElementsByTagName('input'); } }elseif(year==3){ if(sem==1){ var value_list = document.getElementById("ys31").getElementsByTagName('input'); } if(sem==2){ var value_list = document.getElementById("ys32").getElementsByTagName('input'); } }elseif(year==4){ if(sem==1){ var value_list = document.getElementById("ys41").getElementsByTagName('input'); } if(sem==2){ var value_list = document.getElementById("ys42").getElementsByTagName('input'); } } values = 0; for (var i=0; i<value_list.length; i++){ if (value_list[i].checked) { values=values+1; } } document.getElementById(subjectsys).value=values; if (values=="0") { document.getElementById(amountsys).innerHTML=""; return; } if (window.XMLHttpRequest) {// code for IE7+, Firefox, Chrome, Opera, Safari xmlhttp=new XMLHttpRequest(); } else {// code for IE6, IE5 xmlhttp=new ActiveXObject("Microsoft.XMLHTTP"); } xmlhttp.onreadystatechange=function() { if (xmlhttp.readyState==4 && xmlhttp.status==200) { document.getElementById(amountsys).innerHTML=xmlhttp.responseText; } } xmlhttp.open("GET","fee.php?year="+year+"&reg="+reg+"&sem="+sem+"&sub="+values,true); xmlhttp.send(); } </script> </head> <form id="registration" name="registration" action=subverify.php method=POST></br></br> <center> Backlog Subjects for <b>08KN1A1219</b> </br></br> <table border='1'><tr> <th width='40'>&nbsp;</th><th width='90'>Regulation</th><th width='40'>Year</th> <th width='40'>Sem</th><th width='350'>Subname</th> <th width='70'>Internals</th><th width='70'>Externals</th> </tr><div id="ys41"><tr> <td width='40'><center><input type="checkbox" name="sub[]" value="344" onclick="check_value(4,1)"></center></td> <td width='90'><center>R07</center></td><td width='40'><center>4</center></td><td width='40'><center>1</center></td> <td width='350'>EMBEDDED SYSTEMS</td><td width='70'><center>18</center></td> <td width='70'><center>17</center></td></tr><tr><td colspan=5 align=right><b>Subjects: </b><input size=2 type=textbox id=subjects41 name=subjects41 value=0 maxlength=2 readonly=readonly></td> <td align=right><b>Amount :</b></td> <input type='hidden' name='regulation' id=regulationsubjects41 value='R07'> <td><div id="amount41"><input type="textbox" name="amountval41" value="0" size="5" maxlength="5" readonly="readonly"></div></td></tr></div><div id="ys42"><tr> <td width='40'><center><input type="checkbox" name="sub[]" value="527" onclick="check_value(4,2)"></center></td> <td width='90'><center>R07</center></td><td width='40'><center>4</center></td><td width='40'><center>2</center></td> <td width='350'>DESIGN PATTERNS</td><td width='70'><center>12</center></td> <td width='70'><center>14</center></td></tr><tr><td colspan=5 align=right><b>Subjects: </b><input size=2 type=textbox id=subjects42 name=subjects42 value=0 maxlength=2 readonly=readonly></td> <td align=right><b>Amount :</b></td> <input type='hidden' name='regulation' id=regulationsubjects42 value='R07'> <td><div id="amount42"><input type="textbox" name="amountval42" value="0" size="5" maxlength="5" readonly="readonly"></div></td></tr></div><tr><td colspan=7><center><b><div id="maintotal"><input type="textbox" name="maintotal" value="0" size="5" maxlength="5" readonly="readonly"></div></center></b></td></tr><tr></tr></table></br></br> <center><input type='hidden' name='htno' value='08KN1A1219'> <input type='submit' value='Register'></center></form></br> this is a output of a php file with using dynamic data in the form i want to count only the checkboxes in the div and it has to display in that subjectsdiv like subjects41 and subjects42 can any one please help me to update this javascript it passes some ajax request for displaying the fee

    Read the article

  • MVC4 Model in View has nested data - cannot get data in model

    - by Taersious
    I have a Model defined that gets me a View with a list of RadioButtons, per IEnumerable. Within that Model, I want to display a list of checkboxes that will vary based on the item selected. Finally, there will be a Textarea in the same view once the user has selected from the available checkboxes, with some dynamic text there based on the CheckBoxes that are selected. What we should end up with is a Table-per-hierarchy. The layout is such that the RadioButtonList is in the first table cell, the CheckBoxList is in the middle table cell, and the Textarea is ini the right table cell. If anyone can guide me to what my model-view should be to achieve this result, I'll be most pleased... Here are my codes: // // View Model for implementing radio button list public class RadioButtonViewModel { // objects public List<RadioButtonItem> RadioButtonList { get; set; } public string SelectedRadioButton { get; set; } } // // Object for handling each radio button public class RadioButtonItem { // this object public string Name { get; set; } public bool Selected { get; set; } public int ObjectId { get; set; } // columns public virtual IEnumerable<CheckBoxItem> CheckBoxItems { get; set; } } // // Object for handling each checkbox public class CheckBoxViewModel { public List<CheckBoxItem> CheckBoxList { get; set; } } // // Object for handling each check box public class CheckBoxItem { public string Name { get; set; } public bool Selected { get; set; } public int ObjectId { get; set; } public virtual RadioButtonItem RadioButtonItem { get; set; } } and the view @model IEnumerable<EF_Utility.Models.RadioButtonItem> @{ ViewBag.Title = "Connect"; ViewBag.Selected = Request["name"] != null ? Request["name"].ToString() : ""; } @using (Html.BeginForm("Objects" , "Home", FormMethod.Post) ){ @Html.ValidationSummary(true) <table> <tbody> <tr> <td style="border: 1px solid grey; vertical-align:top;"> <table> <tbody> <tr> <th style="text-align:left; width: 50px;">Select</th> <th style="text-align:left;">View or Table Name</th> </tr> @{ foreach (EF_Utility.Models.RadioButtonItem item in @Model ) { <tr> <td> @Html.RadioButton("RadioButtonViewModel.SelectedRadioButton", item.Name, ViewBag.Selected == item.Name ? true : item.Selected, new { @onclick = "this.form.action='/Home/Connect?name=" + item.Name + "'; this.form.submit(); " }) </td> <td> @Html.DisplayFor(i => item.Name) </td> </tr> } } </tbody> </table> </td> <td style="border: 1px solid grey; width: 220px; vertical-align:top; @(ViewBag.Selected == "" ? "display:none;" : "")"> <table> <tbody> <tr> <th>Column </th> </tr> <tr> <td><!-- checkboxes will go here --> </td> </tr> </tbody> </table> </td> <td style="border: 1px solid grey; vertical-align:top; @(ViewBag.Selected == "" ? "display:none;" : "")"> <textarea name="output" id="output" rows="24" cols="48"></textarea> </td> </tr> </tbody> </table> } and the relevant controller public ActionResult Connect() { /* TEST SESSION FIRST*/ if( Session["connstr"] == null) return RedirectToAction("Index"); else { ViewBag.Message = ""; ViewBag.ConnectionString = Server.UrlDecode( Session["connstr"].ToString() ); ViewBag.Server = ParseConnectionString( ViewBag.ConnectionString, "Data Source" ); ViewBag.Database = ParseConnectionString( ViewBag.ConnectionString, "Initial Catalog" ); using( var db = new SysDbContext(ViewBag.ConnectionString)) { var objects = db.Set<SqlObject>().ToArray(); var model = objects .Select( o => new RadioButtonItem { Name = o.Name, Selected = false, ObjectId = o.Object_Id, CheckBoxItems = Enumerable.Empty<EF_Utility.Models.CheckBoxItem>() } ) .OrderBy( rb => rb.Name ); return View( model ); } } } What I am missing it seems, is the code in my Connect() method that will bring the data context forward; at that point, it should be fairly straight-forward to set up the Html for the View. EDIT ** So I am going to need to bind the RadioButtonItem to the view with something like the following, except my CheckBoxList will NOT be an empty set. // // POST: /Home/Connect/ [HttpPost] public ActionResult Connect( RadioButtonItem rbl ) { /* TEST SESSION FIRST*/ if ( Session["connstr"] == null ) return RedirectToAction( "Index" ); else { ViewBag.Message = ""; ViewBag.ConnectionString = Server.UrlDecode( Session["connstr"].ToString() ); ViewBag.Server = ParseConnectionString( ViewBag.ConnectionString, "Data Source" ); ViewBag.Database = ParseConnectionString( ViewBag.ConnectionString, "Initial Catalog" ); using ( var db = new SysDbContext( ViewBag.ConnectionString ) ) { var objects = db.Set<SqlObject>().ToArray(); var model = objects .Select( o => new RadioButtonItem { Name = o.Name, Selected = false, ObjectId = o.Object_Id, CheckBoxItems = Enumerable.Empty<EF_Utility.Models.CheckBoxItem>() } ) .OrderBy( rb => rb.Name ); return View( model ); } } }

    Read the article

  • xs:choice unbounded list

    - by Matt
    I want to define an XSD schema for an XML document, example below: <?xml version="1.0" encoding="utf-8"?> <view xmlns="http://localhost/model_data" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://localhost/model_data XMLSchemaView.xsd" path="wibble" id="wibble"> <text name="PageTitle">Homepage</text> <text name="Keywords">home foo bar</text> <image name="MainImage"> <description>lolem ipsum</description> <title>i haz it</title> <url>/images/main-image.jpg</url> <type>image/jpeg</type> <alt>alt text for image</alt> <width>400</width> <height>300</height> </image> <link name="TermsAndConditionsLink"> <url>/tnc.html</url> <title>Terms and Conditions</title> <target>_blank</target> </link> </view> There's a view root element and then an unknown number of field elements (of various types). I'm using the following XSD schema: <?xml version="1.0" encoding="utf-8"?> <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns="http://localhost/model_data" targetNamespace="http://localhost/model_data" id="XMLSchema1"> <xs:element name="text" type="text_field"/> <xs:element name="view" type="model_data"/> <xs:complexType name="model_data"> <xs:choice maxOccurs="unbounded"> <xs:element name="text" type="text_field"/> <xs:element name="image" type="image_field"/> <xs:element name="link" type="link_field"/> </xs:choice> <xs:attribute name="path" type="xs:string"/> <xs:attribute name="id" type="xs:string"/> </xs:complexType> <xs:complexType name="image_field"> <xs:all> <xs:element name="description" type="xs:string"/> <xs:element name="title" type="xs:string"/> <xs:element name="type" type="xs:string"/> <xs:element name="url" type="xs:string"/> <xs:element name="alt" type="xs:string"/> <xs:element name="height" type="xs:int"/> <xs:element name="width" type="xs:int"/> </xs:all> <xs:attribute name="name" type="xs:string"/> </xs:complexType> <xs:complexType name="text_field"> <xs:simpleContent> <xs:extension base="xs:string"> <xs:attribute name="name" type="xs:string"/> </xs:extension> </xs:simpleContent> </xs:complexType> <xs:complexType name="link_field"> <xs:all> <xs:element name="target" type="xs:string"/> <xs:element name="title" type="xs:string"/> <xs:element name="url" type="xs:string"/> </xs:all> <xs:attribute name="name" type="xs:string"/> </xs:complexType> </xs:schema> This looks like it should work to me, but it doesn't and I always get the following error: Element <text> is not allowed under element <view>. Reason: The following elements are expected at this location (see below) <text> <image> <link> Error location: view / text Details cvc-model-group: Element <text> unexpected by type 'model_data' of element <view>. cvc-elt.5.2.1: The element <view> is not valid with respect to the actual type definition 'model_data'. I've never really used XSD schemas before, so I'd really appreciate it if someone could point out where I'm going wrong.

    Read the article

  • Condition Variable in Shared Memory - is this code POSIX-conformant?

    - by GrahamS
    We've been trying to use a mutex and condition variable to synchronise access to named shared memory on a LynuxWorks LynxOS-SE system (POSIX-conformant). One shared memory block is called "/sync" and contains the mutex and condition variable, the other is "/data" and contains the actual data we are syncing access to. We're seeing failures from pthread_cond_signal() if both processes don't perform the mmap() calls in exactly the same order, or if one process mmaps in some other piece of shared memory before it mmaps the sync memory. This example code is about as short as I can make it: #include <sys/types.h> #include <sys/stat.h> #include <sys/mman.h> #include <sys/file.h> #include <stdlib.h> #include <pthread.h> #include <errno.h> #include <iostream> #include <string> using namespace std; static const string shm_name_sync("/sync"); static const string shm_name_data("/data"); struct shared_memory_sync { pthread_mutex_t mutex; pthread_cond_t condition; }; struct shared_memory_data { int a; int b; }; //Create 2 shared memory objects // - sync contains 2 shared synchronisation objects (mutex and condition) // - data not important void create() { // Create and map 'sync' shared memory int fd_sync = shm_open(shm_name_sync.c_str(), O_CREAT|O_RDWR, S_IRUSR|S_IWUSR); ftruncate(fd_sync, sizeof(shared_memory_sync)); void* addr_sync = mmap(0, sizeof(shared_memory_sync), PROT_READ|PROT_WRITE, MAP_SHARED, fd_sync, 0); shared_memory_sync* p_sync = static_cast<shared_memory_sync*> (addr_sync); // init the cond and mutex pthread_condattr_t cond_attr; pthread_condattr_init(&cond_attr); pthread_condattr_setpshared(&cond_attr, PTHREAD_PROCESS_SHARED); pthread_cond_init(&(p_sync->condition), &cond_attr); pthread_condattr_destroy(&cond_attr); pthread_mutexattr_t m_attr; pthread_mutexattr_init(&m_attr); pthread_mutexattr_setpshared(&m_attr, PTHREAD_PROCESS_SHARED); pthread_mutex_init(&(p_sync->mutex), &m_attr); pthread_mutexattr_destroy(&m_attr); // Create the 'data' shared memory int fd_data = shm_open(shm_name_data.c_str(), O_CREAT|O_RDWR, S_IRUSR|S_IWUSR); ftruncate(fd_data, sizeof(shared_memory_data)); void* addr_data = mmap(0, sizeof(shared_memory_data), PROT_READ|PROT_WRITE, MAP_SHARED, fd_data, 0); shared_memory_data* p_data = static_cast<shared_memory_data*> (addr_data); // Run the second process while it sleeps here. sleep(10); int res = pthread_cond_signal(&(p_sync->condition)); assert(res==0); // <--- !!!THIS ASSERT WILL FAIL ON LYNXOS!!! munmap(addr_sync, sizeof(shared_memory_sync)); shm_unlink(shm_name_sync.c_str()); munmap(addr_data, sizeof(shared_memory_data)); shm_unlink(shm_name_data.c_str()); } //Open the same 2 shared memory objects but in reverse order // - data // - sync void open() { sleep(2); int fd_data = shm_open(shm_name_data.c_str(), O_RDWR, S_IRUSR|S_IWUSR); void* addr_data = mmap(0, sizeof(shared_memory_data), PROT_READ|PROT_WRITE, MAP_SHARED, fd_data, 0); shared_memory_data* p_data = static_cast<shared_memory_data*> (addr_data); int fd_sync = shm_open(shm_name_sync.c_str(), O_RDWR, S_IRUSR|S_IWUSR); void* addr_sync = mmap(0, sizeof(shared_memory_sync), PROT_READ|PROT_WRITE, MAP_SHARED, fd_sync, 0); shared_memory_sync* p_sync = static_cast<shared_memory_sync*> (addr_sync); // Wait on the condvar pthread_mutex_lock(&(p_sync->mutex)); pthread_cond_wait(&(p_sync->condition), &(p_sync->mutex)); pthread_mutex_unlock(&(p_sync->mutex)); munmap(addr_sync, sizeof(shared_memory_sync)); munmap(addr_data, sizeof(shared_memory_data)); } int main(int argc, char** argv) { if(argc>1) { open(); } else { create(); } return (0); } Run this program with no args, then another copy with args, and the first one will fail at the assert checking the pthread_cond_signal(). But change the open() function to mmap() the "/sync" memory first and it will all work fine. This seems like a major bug in LynxOS but LynuxWorks claim that using mutex and condition variable in this way is not covered by the POSIX standard, so they are not interested. Can anyone determine if this code does violate POSIX? Or does anyone have any convincing documentation that it is POSIX compliant?

    Read the article

< Previous Page | 569 570 571 572 573 574 575 576 577 578 579 580  | Next Page >