Search Results

Search found 45324 results on 1813 pages for 'open source'.

Page 591/1813 | < Previous Page | 587 588 589 590 591 592 593 594 595 596 597 598  | Next Page >

  • Simplest way to automatically alter "const" value in Java during compile time

    - by Michael Mao
    Hi all: This is a question corresponds to my uni assignment so I am very sorry to say I cannot adopt any one of the following best practices in a short time -- you know -- assignment is due tomorrow :( link to Best way to alter const in Java on StackOverflow Basically the only task (I hope so) left for me is the performance tuning. I've got a bunch of predefined "const" values in my single-class agent source code like this: //static final values private static final long FT_THRESHOLD = 400; private static final long FT_THRESHOLD_MARGIN = 50; private static final long FT_SMOOTH_PRICE_IDICATOR = 20; private static final long FT_BUY_PRICE_MODIFIER = 0; private static final long FT_LAST_ROUNDS_STARTTIME = 90; private static final long FT_AMOUNT_ADJUST_MODIFIER = 5; private static final long FT_HISTORY_PIRCES_LENGTH = 10; private static final long FT_TRACK_DURATION = 5; private static final int MAX_BED_BID_NUM_PER_AUC = 12; I can definitely alter the values manually and then compile the code to give it another go around. But the execution time for a thorough "statistic analysis" usually requires over 2000 times of execution, which will typically lasts more than half an hour on my own laptop... So I hope there is a way to alter values using other ways than dig into the source code to change the "const" values there, so I can automatically distributed compiled code to other people's PC and let them run the statistic analysis instead. One other reason for a automatically value adjustment is that I can try using my own agent to defeat itself by choosing different "const" values. Although my values are derived from previous history and statistical results, they are far from the most optimized values. I hope there is a easy way so I can quickly adopt that so to have a good sleep tonight while the computer does everything for me... :) Any hints on this sort of stuff? Any suggestion is welcomed and much appreciated.

    Read the article

  • If I select from an IQueryable then the Include is lost

    - by Connor Murphy
    The include does not work after I perform a select on the IQueryable query. Is there a way arround this? My query is public IQueryable<Network> GetAllNetworks() { var query = (from n in _db.NetworkSet .Include("NetworkContacts.Contact") .Include("NetworkContacts.Contact.RelationshipSource.Target") .Include("NetworkContacts.Contact.RelationshipSource.Source") select (n)); return query;; } I then try to populate mya ViewModel in my WebUI layer using the following code var projectedNetworks = from n in GetAllNetworks() select new NetworkViewModel { Name = n.Name, Contacts = from contact in networkList .SelectMany(nc => nc.NetworkContacts) .Where(nc => nc.Member == true) .Where(nc => nc.NetworkId == n.ID) .Select(c => c.Contact) select contact, }; return projectedNetworks; The problem now occurs in my newly createdNetworkViewModel The Contacts object does include any loaded data for RelationshipSource.Target or RelationshipSource.Source The data should is there when run from the original Repository IQueryable object. However the related include data does not seem to get transferred into the new Contacts collection that is created from this IQueryable using the Select New {} code above. Is there a way to preserve this Include data when it gets passed into a new object?

    Read the article

  • First run notepad with my.cfg and only then start the service

    - by Viv Coco
    Hi all, I install along with my application: 1) a service that starts and stops my application as needed 2) a conf file that contains actually the user data and that will be shown to the user to modify as needed (I give the user the chance to change it by running notepad.exe with my conf file during installing) The problem is that in my code the service I install starts before the user had the chance to modify the conf file. What I would like is: 1) first the user gets the chance to change the conf file (run notepad.exe with the conf file) 2) only afterward start the service <Component Id="MyService.exe" Guid="GUID"> <File Id="MyService.exe" Source="MyService.exe" Name="MyService.exe" KeyPath="yes" Checksum="yes" /> <ServiceInstall Id='ServiceInstall' DisplayName='MyService' Name='MyService' ErrorControl='normal' Start='auto' Type='ownProcess' Vital='yes'/> <ServiceControl Id='ServiceControl' Name='MyService' Start='install' Stop='both' Remove='uninstall'/> </Component> <Component Id="my.conf" Guid="" NeverOverwrite="yes"> <File Id="my.cfg" Source="my.cfg_template" Name="my.cfg" KeyPath="yes" /> </Component> [...] <Property Id="NOTEPAD">Notepad.exe</Property> <CustomAction Id="LaunchConfFile" Property="NOTEPAD" ExeCommand="[INSTALLDIR]my.cfg" Return="ignore" Impersonate="no" Execute="deferred"/> <!--Run only on installs--> <InstallExecuteSequence> <Custom Action='LaunchConfFile' Before='InstallFinalize'>(NOT Installed) AND (NOT UPGRADINGPRODUCTCODE)</Custom> </InstallExecuteSequence> What am I doing wrong in the above code and how could I change it in order to achieve what I need? (first run notepad with my conf file and then start the service). TIA, Viv

    Read the article

  • IE 8 dialog windows not decompressing files

    - by Mike
    Hi, I've got a website where we have pre-compressed all of our HTML files. In general this works fine, but since IE 8 has come out some people are finding that they can not use some parts of the website. We've used the showModalDialog command to open a dialog window and pointing to one of our pre-compressed files but it displays it just show up as strange characters (ie not decompressed). Now it only happens in the dialog. I'm pretty sure our compression is all fine because the page they are viewing to open the dialog is also compressed. Has anyone else come across this or got any suggestions cuz i'm stumped??? Thanks, Mike

    Read the article

  • Better way to call superclass method in ExtJS

    - by Rene Saarsoo
    All the ExtJS documentation and examples I have read suggest calling superclass methods like this: MyApp.MyPanel = Ext.extend(Ext.Panel, { initComponent: function() { // do something MyPanel specific here... MyApp.MyPanel.superclass.initComponent.call(this); } }); I have been using this pattern for quite some time and the main problem is, that when you rename your class then you also have to change all the calls to superclass methods. That's quite inconvenient, often I will forget and then I have to track down strange errors. But reading the source of Ext.extend() I discovered, that instead I could use the superclass() or super() methods that Ext.extend() adds to the prototype: MyApp.MyPanel = Ext.extend(Ext.Panel, { initComponent: function() { // do something MyPanel specific here... this.superclass().initComponent.call(this); } }); In this code renaming MyPanel to something else is simple - I just have to change the one line. But I have doubts... I haven't seen this documented anywhere and the old wisdom says, I shouldn't rely on undocumented behaviour. I didn't found a single use of these superclass() and supr() methods in ExtJS source code. Why create them when you aren't going to use them? Maybe these methods were used in some older version of ExtJS but are deprecated now? But it seems such a useful feature, why would you deprecate it? So, should I use these methods or not?

    Read the article

  • Jqm is not a function

    - by kris
    Hi all, I'm having some trouble with Jquery and JqModal, and I hope you are able to help, since I've been struggling for hours.. Having a single button element with an onclick action running my method "test" (shown below): $('#picture_form').jqm({ajax: '/test.php'}); $('#picture_form').jqmShow(); This will load the ajax content of test.php into my div element picture_form, shown using JqModal as its supposed to! Though when I close this window, and re-clicks the button I'm getting the error: $("#picture_form").jqm is not a function. As a solution I've tried to use the JqModal trigger function, and this leaves me able to open and close the JqModal windows as many times as I want to. Sadly I can only call the 'trigger' using test environment, in my production code I have to open the JqModal window using a function.. Does anyone have a clue why this 'bug' appears when calling the opening when using a function? Thanks in advance

    Read the article

  • Castle Active Record - Working with the cache

    - by David
    Hi All, im new to the Castle Active Record Pattern and Im trying to get my head around how to effectivley use cache. So what im trying to do (or want to do) is when calling the GetAll, find out if I have called it before and check the cache, else load it, but I also want to pass a bool paramter that will force the cache to clear and requery the db. So Im just looking for the final bits. thanks public static List<Model.Resource> GetAll(bool forceReload) { List<Model.Resource> resources = new List<Model.Resource>(); //Request to force reload if (forceReload) { //need to specify to force a reload (how?) XmlConfigurationSource source = new XmlConfigurationSource("appconfig.xml"); ActiveRecordStarter.Initialize(source, typeof(Model.Resource)); resources = Model.Resource.FindAll().ToList(); } else { //Check the cache somehow and return the cache? } return resources; } public static List<Model.Resource> GetAll() { return GetAll(false); }

    Read the article

  • slow SQL command

    - by Retrocoder
    I need to take some data from one table (and expand some XML on the way) and put it in another table. As the source table can have thousands or records which caused a timeout I decided to do it in batches of 100 records. The code is run on a schedule so doing it in batches works ok for the customer. If I have say 200 records in the source database the sproc runs very fast but if there are thousands it takes several minutes. I'm guessing that the "TOP 100" only takes the top 100 after it has gone through all the records. I need to change the whole code and sproc at some point as it doesn't scale but for now is there a quick fix to make this run quicker ? INSERT INTO [deviceManager].[TransactionLogStores] SELECT TOP 100 [EventId], [message].value('(/interface/mac)[1]', 'nvarchar(100)') AS mac, [message].value('(/interface/device) [1]', 'nvarchar(100)') AS device_type, [message].value('(/interface/id) [1]', 'nvarchar(100)') AS device_id, [message].value('substring(string((/interface/id)[1]), 1, 6)', 'nvarchar(100)') AS store_id, [message].value('(/interface/terminal/unit)[1]', 'nvarchar(100)') AS unit, [message].value('(/interface/terminal/trans/event)[1]', 'nvarchar(100)') AS event_id, [message].value('(/interface/terminal/trans/data)[1]', 'nvarchar(100)') AS event_data, [message].value('substring(string((/interface/terminal/trans/data)[1]), 9, 11)', 'nvarchar(100)') AS badge, [message].value('(/interface/terminal/trans/time)[1]', 'nvarchar(100)') AS terminal_time, MessageRecievedAt_UTC AS db_time FROM [deviceManager].[TransactionLog] WHERE EventId > @EventId --WHERE MessageRecievedAt_UTC > @StartTime AND MessageRecievedAt_UTC < @EndTime ORDER BY terminal_time DESC

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • SharePoint 2010 is forcing me to safe PDF when opening from doc library

    - by Tobias Funke
    I have a document library with a PDF file. Whenever I click on the PDF file, I am prompted to save the file. I do not get the option of opening the file, I am forced to save it. What I want is for the PDF file to open, either in the browser or in a separate Adobe Reader window, depending on the Adobe Reader settings. I'm pretty sure SharePoint is responsible for this behavior, because if I put the PDF on my hard drive, then create a HTML file with a link to the file, it opens in the browser when I click on it. Please note: I looked at this question and did not help. I don't care if the PDF opens in the browser or in a separate Adobe Reader window, I just want it to open.

    Read the article

  • SSL confirmation dialog popup auto closes in IE8 when re-accessing a JNLP file

    - by haylem
    I'm having this very annoying problem to troubleshoot and have been going at it for way too many days now, so have a go at it. The Environment We have 2 app-servers, which can be located on either the same machine or 2 different machines, and use the same signing certificate, and host 2 different web-apps. Though let's say, for the sake of our study case here, that they are on the same physical machine. So, we have: https://company.com/webapp1/ https://company.com/webapp2/ webapp1 is GWT-based rich-client which contains on one of its screens a menu with an item that is used to invoke a Java WebStart Client located on webapp2. It does so by performing a simple window.open call via this GWT call: Window.open("https://company.com/webapp2/app.jnlp", "_blank", null); Expected Behavior User merrilly goes to webapp1 User navigates to menu entry to start the WebStart app and clicks on it browser fires off a separate window/dialog which, depending on the browser and its security settings, will: request confirmation to navigate to this secure site, directly download the file, and possibly auto-execute a javaws process if there's a file association, otherwise the user can simply click on the file and start the app (or go about doing whatever it takes here). If you close the app, close the dialog, and re-click the menu entry, the same thing should happen again. Actual Behavior On Anything but God-forsaken IE 8 (Though I admit there's also all the god-forsaken pre-IE8 stuff, but the Requirements Lords being merciful we have already recently managed to make them drop these suckers. That was close. Let's hold hands and say a prayer of gratitude.) Stuff just works. JNLP gets downloaded, app executes just fine, you can close the app and re-do all the steps and it will restart happily. People rejoice. Puppies are safe and play on green hills in the sunshine. Developers can go grab a coffee and move on to more meaningful and rewarding tasks, like checking out on SO questions. Chrome doesn't want to execute the JNLP, but who cares? Customers won't get RSI from clicking a file every other week. On God-forsaken IE8 On the first visit, the dialog opens and requests confirmation for the user to continue to webapp2, though it could be unsafe (here be dragons, I tell you). The JNLP downloads and auto-opens, the app start. Your breathing is steady and slow. You close the app, close that SSL confirmation dialog, and re-click the menu entry. The dialog opens and auto-closes. Nothing starts, the file wasn't downloaded to any known location and Fiddler just reports the connection was closed. If you close IE and reach that menu item to click it again, it is now back to working correctly. Until you try again during the same session, of course. Your heart-rate goes up, you get some more coffee to make matters worse, and start looking for plain tickets online and a cheap but heavy golf-club on an online auction site to go clubbing baby polar seals to avenge your bloodthirst, as the gates to the IE team in Redmond are probably more secured than an ice block, as one would assume they get death threats often. Plus, the IE9 and IE10 teams are already hard at work fxing the crap left by their predecessors, so maybe you don't want to be too hard on them, and you don't have money to waste on a PI to track down the former devs responsible for this mess. Added Details I have come across many problems with IE8 not downloading files over SSL when it uses a no-cache header. This was indeed one of our problems, which seems to be worked out now. It downloads files fine, webapp2 uses the following headers to serve the JNLP file: response.setHeader("Cache-Control", "private, must-revalidate"); // IE8 happy response.setHeader("Pragma", "private"); // IE8 happy response.setHeader("Expires", "0"); // IE8 happy response.setHeader("Access-Control-Allow-Origin", "*"); // allow to request via cross-origin AJAX response.setContentType("application/x-java-jnlp-file"); // please exec me As you might have inferred, we get some confirmation dialog because there's something odd with the SSL certificate. Unfortunately I have no control over that. Assuming that's only temporary and for development purposes as we usually don't get our hands on the production certs. So the SSL cert is expired and doesn't specify the server. And the confirmation dialog. Wouldn't be that bad if it weren't for IE, as other browsers don't care, just ask for confirmation, and execute as expected and consistantly. Please, pretty please, help me, or I might consider sacrificial killings as an option. And I think I just found a decently prized stainless steel golf-club, so I'm right on the edge of gore. Side Notes Might actually be related to IE8 window.open SSL Certificate issue. Though it doesn't explain why the dialog would auto-close (that really is beyong me...), it could help to not have the confirmation dialog and not need the dialog at all. For instance, I was thinking that just having a simple URL in that menu instead of have it entirely managed by GWT code to invoke a Window.open would solve the problem. But I don't have control on that menu, and also I'm very curious how this could be fixed otherwise and why the hell it happens in the first place...

    Read the article

  • Extract a C/C++ header file from a C# class exposed to COM

    - by isorfir
    I'm not sure I've setup everything I've needed to in my C# class to properly, but it does work in COM. I've been looking for an example of a C# class that was successfully used in a C/C++ project, but haven't come across anything. I've tried using the OLE/COM Object View app to open the .tlb file and save as .h, but it gives some errors: MIDL1009: unknown argument ignored; MIDL1001: cannot open input file Studio "Studio" isn't the name of the file, it's Syslog, so that raises a red flag to me. Any ideas?

    Read the article

  • ASP.NET membership db using integrated security problem

    - by rem
    I published ASP.NET MVC web site to a server on a virtual machine (Hyper-V). SQL Server Express installed on the same server. The problem is that ASP.Net Membership system doesn't work in integrated mode. When Web.config file contains records as follows: <connectionStrings> <remove name="LocalSqlServer" /> <add name="MyDBConnectionString" connectionString="data source=vm-1\SQLEXPRESS;Initial Catalog=testdb;Integrated Security=SSPI;" providerName="System.Data.SqlClient"/> </connectionStrings> I get an error when trying to register and login to the site. If I change connection string this way: <connectionStrings> <remove name="LocalSqlServer" /> <add name="MyDBConnectionString" connectionString="data source=vm-1\SQLEXPRESS;Initial Catalog=testdb;User ID=XX;Password=XXXXXXX;" providerName="System.Data.SqlClient"/> </connectionStrings> I could register and login without any problem. What could cause the problem with using ASP.NET membership database in integrated security mode?

    Read the article

  • How can I place zeroes to the left of a given number to a maximum of 6 digits including the given nu

    - by Sergio Tapia
    I have this method that receives an ID number and downloads an HTML website according to that ID. Typically, an IMDB link is like this: http://www.imdb.com/title/tt0892791/ http://www.imdb.com/title/tt1226229/ http://www.imdb.com/title/tt0000429/ They all follow the 'tt' then 7 digits, with lack of digits turning into zeroes to fill out the left spaces. How can I accomplish this using C#? I'm kind of stumped. Here's my method: /// <summary> /// Find a movie page using its precise IMDB id. /// </summary> /// <param name="id">IMDB Movie ID</param> /// <returns>Returns an HtmlDocument with the source code included.</returns> public HtmlDocument ByID(string id) { string url = String.Format("http://www.imdb.com/title/tt{0}/", id); HtmlDocument page = downloader.Load(url); return page; } Thank you very much for your time, and if you are interested in helping out, you can check out the complete source code of TheFreeIMDB here: http://thefreeimdb.codeplex.com/

    Read the article

  • Django internationalization for admin pages - translate model name and attributes

    - by geekQ
    Django's internationalization is very nice (gettext based, LocaleMiddleware), but what is the proper way to translate the model name and the attributes for admin pages? I did not find anything about this in the documentation: http://docs.djangoproject.com/en/dev/topics/i18n/internationalization/ http://www.djangobook.com/en/2.0/chapter19/ I would like to have "???????? ????? ??? ?????????" instead of "???????? order ??? ?????????". Note, the 'order' is not translated. First, I defined a model, activated USE_I18N = True in settings.py, run django-admin makemessages -l ru. No entries are created by default for model names and attributes. Grepping in the Django source code I found: $ ack "Select %s to change" contrib/admin/views/main.py 70: self.title = (self.is_popup and ugettext('Select %s') % force_unicode(self.opts.verbose_name) or ugettext('Select %s to change') % force_unicode(self.opts.verbose_name)) So the verbose_name meta property seems to play some role here. Tried to use it: class Order(models.Model): subject = models.CharField(max_length=150) description = models.TextField() class Meta: verbose_name = _('order') Now the updated po file contains msgid 'order' that can be translated. So I put the translation in. Unfortunately running the admin pages show the same mix of "???????? order ??? ?????????". I'm currently using Django 1.1.1. Could somebody point me to the relevant documentation? Because google can not. ;-) In the mean time I'll dig deeper into the django source code...

    Read the article

  • Streaming Media Player Tutorial Stops Unexpectedly. How Should I Debug (And Other Questions From A

    - by Danny
    Hello! I'm a fledgling in the Android and Eclipse ways. I was reading and downloaded the source code for a Streaming Media Player tutorial from Pocket Journey, here. However, when I try to run it through the "Run As..." or "Debug As..." features in Eclipse, the emulator reports: "Sorry! The application Android Tutorials (process com.pocketjourney.tutorials) has stopped unexpectedly. Please try again." Now, from stepping through the Tutorial 1 activity (for those of you that may be familiar with it), it seems something funky happens here: button.setOnClickListener(new View.OnClickListener() { public void onClick(View view) { Toast.makeText(Tutorial1.this, "Button Clicked",Toast.LENGTH_SHORT).show(); }}); My questions are: What's up with that line? Apparently, other comments haven't had this problem; am I missing some library that I should be downloading from someplace? How should I go about debugging this other than/in addition to stepping through code? I'm used to Visual Studio, which has a nice box with exception details for me to sift through and copy/paste to google with. Eclipse debugging showed a "No Source Code" page, or a list of exceptions. I've heard of something called LogCat; is that relevant here? Thanks in advance!

    Read the article

  • Javascript/iframe/embed/object question

    - by thinkfuture
    OK, so here is my issue. I'm building a system which will allow people to embed lists of links on their pages. When the link is clicked, i'd like to use something like Lightview or Lightwindow to open it up over the whole window, not just in the iframe. I don't have access to the page that the user will be embedding this object into. Everything I've tried so far tells me that I can't open anything over the parent window, since I don't have access to it from the iframe or object, javacript security issue. However, I've seen sites that do that kind of overlay. so it must be possible. If anyone can point me to any resources that could help, that would be great. if it matters, i'm using Ruby on Rails... Thanks...chris

    Read the article

  • XSLT: How to escape square brackets in Urls

    - by ilariac
    I have a set of records from Solr where field[@name='url'] can have the following format: http://url/blabla/blabla.aspx?sv=[keyword%20keyword,%201] My understanding is that the square brackets denote an array syntax and I would like to use XSLT to remove the square brackets from all Urls. The reason for this is that I am using an Open URL resolver, which does not currently handle well those characters. The best option would be to strip the square brackets from all URLs before such resources are mediated by the Open URL resolver. There are cases where I have multiple occurrences of square brackets per Url. Can you please help me with this? Thanks for your help, I.

    Read the article

  • Retrieving dll version info via Win32 - VerQueryValue(...) crashes under Win7 x64

    - by user256890
    The respected open source .NET wrapper implementation (SharpBITS) of Windows BITS services fails identifying the underlying BITS version under Win7 x64. Here is the source code that fails. NativeMethods are native Win32 calls wrapped by .NET methods and decorated via DllImport attribute. private static BitsVersion GetBitsVersion() { try { string fileName = Path.Combine( System.Environment.SystemDirectory, "qmgr.dll"); int handle = 0; int size = NativeMethods.GetFileVersionInfoSize(fileName, out handle); if (size == 0) return BitsVersion.Bits0_0; byte[] buffer = new byte[size]; if (!NativeMethods.GetFileVersionInfo(fileName, handle, size, buffer)) { return BitsVersion.Bits0_0; } IntPtr subBlock = IntPtr.Zero; uint len = 0; if (!NativeMethods.VerQueryValue(buffer, @"\VarFileInfo\Translation", out subBlock, out len)) { return BitsVersion.Bits0_0; } int block1 = Marshal.ReadInt16(subBlock); int block2 = Marshal.ReadInt16((IntPtr)((int)subBlock + 2 )); string spv = string.Format( @"\StringFileInfo\{0:X4}{1:X4}\ProductVersion", block1, block2); string versionInfo; if (!NativeMethods.VerQueryValue(buffer, spv, out versionInfo, out len)) { return BitsVersion.Bits0_0; } ... The implementation follows the MSDN instructions by the letter. Still during the second VerQueryValue(...) call, the application crashes and kills the debug session without hesitation. Just a little more debug info right before the crash: spv = "\StringFileInfo\040904B0\ProductVersion" buffer = byte[1900] - full with binary data block1 = 1033 block2 = 1200 I looked at the targeted "C:\Windows\System32\qmgr.dll" file (The implementation of BITS) via Windows. It says that the Product Version is 7.5.7600.16385. Instead of crashing, this value should return in the verionInfo string. Any advice?

    Read the article

  • Help getting MVVM ViewModel to bind to the View

    - by cw
    Okay guys, I'm new to this model and Silverlight in general. I have the following code (changed object names, so syntax/spelling errors ignore). public class ViewModel { ViewModelSource m_vSource; public ViewModel(IViewModelSource source) { m_vSource= source; m_vSource.ItemArrived += new Action<Item>(m_vSource_ItemArrived); } void m_vSource_ItemArrived(Item obj) { Title = obj.Title; Subitems = obj.items; Description = obj.Description; } public void GetFeed(string serviceUrl) { m_vFeedSource.GetFeed(serviceUrl); } public string Title { get; set; } public IEnumerable<Subitems> Subitems { get; set; } public string Description { get; set; } } Here is the code I have in my page's codebehind. ViewModel m_vViewModel; public MainPage() { InitializeComponent(); m_vViewModel = new ViewModel(new ViewModelSource()); this.Loaded += new RoutedEventHandler(MainPage_Loaded); this.DataContext = m_vViewModel; } void MainPage_Loaded(object sender, RoutedEventArgs e) { m_vViewModel.GetItems("http://www.myserviceurl.com"); } Finally, here is a sample of what my xaml looks like. <!--TitleGrid is the name of the application and page title--> <Grid x:Name="TitleGrid" Grid.Row="0"> <TextBlock Text="My Super Title" x:Name="textBlockPageTitle" Style="{StaticResource PhoneTextPageTitle1Style}"/> <TextBlock Text="{Binding Path=Title}" x:Name="textBlockListTitle" Style="{StaticResource PhoneTextPageTitle2Style}"/> </Grid> I know I'm missing something, but I'm just not knowledgable enough which is why I'm asking you guys :) Is there anything I'm doing wrong here? Thanks!

    Read the article

  • Copy SQL Server data from one server to another on a schedule

    - by rwmnau
    I have a pair of SQL Servers at different webhosts, and I'm looking for a way to periodically update the one server using the other. Here's what I'm looking for: As automated as possible - ideally, without any involvement on my part once it's set up. Pushes a number of databases, in their entirely (including any schema changes) from one server to the other Freely allows changes on the source server without breaking my process. For this reason, I don't want to use replication, as I'd have to break it every time there's an update on the source, and then recreate the publication and subscription One database is about 4GB in size and contains binary data. I'm not sure if there's a way to export this to a script, but it would be a mammoth file if I did. Originally, I was thinking of writing something that takes a scheduled full backup of each database, FTPs the backups from one server to the other once they're done, and then the new server picks it up and restores it. The only downside I can see to this is that there's no way to know that the backups are done before starting to transfer them - can these backups be done synchronously? Also, the server being refreshes is our test server, so if there's some downtime involved in moving the data, that's fine. Does anybody out there have a better idea, or is what I'm currently considering the best non-replication way to go? Thanks for your help, everybody. UPDATE: I ended up designing a custom solution to get this done using BAT files, 7Zip,command line FTP, and OSQL, so it runs in a completely automatic way and aggregates the data from a dozen servers across the country. I've detailed the steps in a blog entry. Thanks for all your input!

    Read the article

  • Web service reference location?

    - by Damien Dennehy
    I have a Visual Studio 2008 solution that's currently consisting of three projects: A DataFactory project for Business Logic/Data Access. A Web project consisting of the actual user interface, pages, controls, etc. A Web.Core project consisting of utility classes, etc. The application requires consuming a web service. Normally I'd add the service reference to the Web project, but I'm not sure if this is best practice or not. The following options are open to me: Add the reference to the Web project. Add the reference to the Web.Core project, and create a wrapper method that Web will call to consume the web service. Add a new project called Web.Services, and copy step 2. This project is expected to increase in size so I'm open to any suggestions.

    Read the article

  • An unhandled exception of type 'System.StackOverflowException' occurred in mscorlib.dll

    - by Sahar
    Hello everybody i wrote a code in asp.net that read data from files and draw a graph. It worked but after awhile when i run the program, this exception arise "An unhandled exception of type 'System.StackOverflowException' occurred in mscorlib.dll" in this statement in the code: if (File.Exists(fName)) <----(here is the exception) { stream = File.Open(fName, FileMode.Open); g_day = Deserialize(stream); stream.Close(); int cn = 0; if (g_day.Values.Count != 0) cn = g_day.Values[g_day.Values.Count - 1].Value; Label1.Text = cn.ToString(); } can u help me

    Read the article

< Previous Page | 587 588 589 590 591 592 593 594 595 596 597 598  | Next Page >