Search Results

Search found 24401 results on 977 pages for 'duplicate content'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 607/977 | < Previous Page | 603 604 605 606 607 608 609 610 611 612 613 614  | Next Page >

  • Javascript sliding (preferably jQuery)

    - by jwzk
    I am trying to think of the name of the plugin (or a plugin) that slides content in (up or down). So I have a hidden div, I click on one of the titles/header, it opens the hidden div, if I click on another header it hides the other visible div, and slides up or down the new one. I can't think of it for some reason.. anyone?

    Read the article

  • Google App Engine Python Datastore

    - by python appengine
    Basically what Im trying to make is a data structure where it has the users name, id, and datejoined. Then i want a "sub-structure" where it has the users "text" and the date it was modified. and the user will have multiple instances of this text. class User(db.Model): ID = db.IntegerProperty() name = db.StringProperty() datejoined = db.DateTimeProperty(auto_now_add=True) class Content(db.Model): text = db.StringProperty() datemod= db.DateTimeProperty(auto_now_add = True) Is the code set up correctly?

    Read the article

  • How do I do a cross domain GET of an XML feed in a WordPress plugin?

    - by MM.
    I would like to use AJAX to display dynamic content via my wordpress plugin. The data source is an xml feed from a remote domain (not owned by me). I have tried using JQuery plugins that use YQL to do cross domain Ajax calls; however, they are geared towards json and tend to return the data to me in a mangled state. My question is, is there a way of obtaining an xml feed using ajax from a remote domain?

    Read the article

  • Date based publishing ASP.NET MVC

    - by kayluhb
    I am building a custom CMS in ASP.NET MVC and one of the requirements is that the content has a start and end date that dictates whether or not the page appears on the site. What is the best approach to this? Should I run some sort of chron job to mark the status of the page according to its publish dates? Does anyone have any resources or advice on the matter?

    Read the article

  • Triggering jquery event when an element appears on screen

    - by 0al0
    I want to show a fade effect as soon as the element appears on screen. There is a lot of content before this element so if I trigger the efect on document.ready, at certain resolutions the vistors wont´t see it. Is it possible to trigger an event when, after scrolling down, the element becomes visible? I am almost sure I have seen this effect before, but have no idea how to achieve it. Thank you!

    Read the article

  • paperclip plugin not support for I18n

    - by user354413
    I've added I18n support for error messages: Now you can define translations for the errors messages in e.g. your YAML locale file: en: paperclip: errors: attachment: size: "Invalid file size" content_type: "Unsupported content type" presence: "Cant' be blank" when I use validates_attachemnt_zie :avatar how to get error message?

    Read the article

  • include and Get not working on index

    - by diego
    I have a problem with my index.php, i have this small script that decides what content to deliver <?php $clase = $_GET['clase']; if ($clase == empresa) {include ("empresa.php");} elseif ($clase == productos) {include("productos.php");} else {include ($_SERVER['DOCUMENT_ROOT']."/inicio.html"); } ?> it works when i go to www.mysite.com/index.php but when i go to www.mysite.com it doesnt and i cant just figure our why.

    Read the article

  • How to test chrome extensions?

    - by swampsjohn
    Is there a good way to do this? I'm writing an extension that interacts with a website as a content script and saves data using localstorage. Are there any tools, frameworks, etc. that I can use to test this behavior? I realize there are some generic tools for testing javascript, but are those sufficiently power to test an extension? Unit testing is most important, but I'm also interested in other types of testing (such as integration testing).

    Read the article

  • Fancybox: Get id of clicked anchor/element

    - by kastru
    I am trying to get the id of the clicked/shown element in fancybox. I have tried both "this.id" and "this.attr("id")" - but none of them works. $("a.lightbox_image").fancybox({ 'transitionIn': 'elastic', 'transitionOut': 'elastic', 'speedIn': 600, 'speedOut': 200, 'content': 'Id of element clicked'+this.attr("id") }); Any suggestions?

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • How do I hide an HTML element before the page loads

    - by Robert
    I have some JQuery code that shows or hides a div. $("div#extraControls").show(); // OR .hide() I initially want the div to be not visible so I used: $(document).ready(function() { $("div#extraControls").hide(); }); However, on the browser, the content loads visible for a second before disappearing, which is not what I want. How do I set the hide the element before the page loads whilst keeping the ability to show hide it dynamically with a script?

    Read the article

  • PHP URL GET parameters inside URL parameter

    - by user547794
    Hello, I am developing facebook/myspace content share buttons. The Facebook link takes you to a URL on my website, but I need to pass additional parameters to my URL along with the parameters passed to facebook. Here's my example: http://www.facebook.com/share.php?t=MyCompany&u=http://foobar.com/test7.php?Share=161&FbShare=Facebook28 Do I need to escape something inside the "u" parameter?

    Read the article

  • Drupal, Views: using AJAX to load the complete node ?

    - by Patrick
    hi, I've a View page with all the content of my website (the node headers). When I click on one of these header I would like to load the complete node without refreshing the page and display it on the left. Can I do this with Views (I mean.. does it have a functionality to load a complete node and add it to the current page ? thanks

    Read the article

  • SimpleModal Strange ASP.NET Button problem

    - by bhsstudio
    Hi I have the following codes $('#<%= btnOpen.ClientID %>').click(function() { $('#content').modal(); }); <asp:Button ID="btnOpen" runat="server" Text="Open" /> When I click on the button, the modal window will appear for about 0.5 second and disappear right away.Can anyone help me please? Thanks a lot!

    Read the article

  • update SMS body, but not Date

    - by everinsearch
    I'm trying to update body of all sms on Android device with getContentResolver().update(Uri.parse("content://sms"), values..... query but after request done, also updates message creation/received time. How i can update message but leave old message date? I have tried send to update query ContentValues values = sms values oject; values.put("body", updatedBody); values.put("date", oldValues.getAsString("date")); but it does not help.

    Read the article

  • How can i limit parsing and display the previously parsed contents in iphone?

    - by Warrior
    I am new to iphone development.I parsing a url and displayed its content in the table.On clicking a row it plays a video.When i click a done button, i once again call the tableview.When i call the table view it parse the url once again to display the contents .I want to limit the parsing for 1 time and for the next time i want to display the contents which are parsed at the first time.How can i achieve it ?Please help me out.Thanks.

    Read the article

  • jQuery animate slidding background image using mouse position wont stop... just keeps going

    - by simian
    I have a neat little jQuery script I am working on. Goal: parent div with overflow hidden holds a larger div with image. When I move the mouse to the left or right of the parent div, the div with image changes margin-left to move left or right. Problem is... if I move the mouse out of the parent div (left or right), the image keeps going. I need the image to stop when the mouse is not on the inside left or right edge of the parent div. Any ideas? <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <script type="text/javascript" src="http://code.jquery.com/jquery-latest.js"></script> <script type="text/javascript"> //<![CDATA[ jQuery.noConflict (); jQuery(document).ready(function(){ jQuery('#container').mousemove(function(e){ var parentWidth = jQuery('#container').width(); var parentWidthLeft = Math.round(.1 * jQuery('#container').width()); var parentWidthRight = Math.round(jQuery('#container').width() - parentWidthLeft); var parentHeight = jQuery('#container').height(); var parentOffset = jQuery('#container').offset(); var X = Math.round(e.pageX - parentOffset.left); var Y = Math.round(e.pageY - parentOffset.top); if (X<parentWidthLeft) { jQuery('#image').animate({'left': '-' + parentWidth }, 5000); } if (X>parentWidthRight) { jQuery('#image').animate({'left': parentWidth }, 5000); } if (X<=parentWidthRight && X>=parentWidthLeft) { jQuery('#image').stop(); } if (X<1) { jQuery('#image').stop(); } }); jQuery('#container').mouseleave(function(){ jQuery('#image').stop(); }); }); // ]]> </script> </head> <body> <div id="container" style="width: 500px; height: 500px; overflow: hidden; border: 10px solid #000; position: relative; margin: auto auto;"> <div id="image" style="position: absolute; left: 0; top: 0;"><img src="http://dump4free.com/imgdump/1/Carmen-Electra_1wallpaper1024x768.jpg" alt="" /></div> </div> </body> </html>

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 603 604 605 606 607 608 609 610 611 612 613 614  | Next Page >