Search Results

Search found 55248 results on 2210 pages for 'java memory model'.

Page 612/2210 | < Previous Page | 608 609 610 611 612 613 614 615 616 617 618 619  | Next Page >

  • How would I go about updating my electronic circuit simulator's 'electricity'?

    - by liqwidice
    I have made an application which allows the user to place down wires, power sources, and inverters on a virtual circuit board. All connections between tiles are automatic, as shown here: As you can see in the last image, the updating of power throughout this grid is not yet functioning. I think I understand how to do this updating conceptually, but getting it to work in my program is appearing to be much more difficult than I first imagined. My source code can be found here. If you have any tips as to how to I might approach this monstrous task, please let me know. EDIT The goal here is to simply get a working application. Getting tiles to pass on power to their neighbors is quite easy, but the tricky part is getting wires to "unpower" after the removal of a power source. The size of the grid is just 18x18, so efficiency really isn't a factor, for those wondering.

    Read the article

  • TileEntitySpecialRenderer only renders from certain angle

    - by Hullu2000
    I'm developing a Minecraft mod with Forge. I've added a tileentity and a custom renderer for it. The problem is: The block is only visible from sertain angles. I've compaed my code to other peoples code and it looks pretty much like them. The block is opaque and not to be rendered and the renderer is registered normally so the fault must be in the renderer. Here's the renderer code: public class TERender extends TileEntitySpecialRenderer { public void renderTileEntityAt(TileEntity tileEntity, double d, double d1, double d2, float f) { GL11.glPushMatrix(); GL11.glTranslatef((float)d, (float)d1, (float)d2); HeatConductTileEntity TE = (HeatConductTileEntity)tileEntity; renderBlock(TE, tileEntity.getWorldObj(), tileEntity.xCoord, tileEntity.yCoord, tileEntity.zCoord, mod.EMHeatConductor); GL11.glPopMatrix(); } public void renderBlock(HeatConductTileEntity tl, World world, int i, int j, int k, Block block) { Tessellator tessellator = Tessellator.instance; GL11.glColor3f(1, 1, 1); tessellator.startDrawingQuads(); tessellator.addVertex(0, 0, 0); tessellator.addVertex(1, 0, 0); tessellator.addVertex(1, 1, 0); tessellator.addVertex(0, 1, 0); tessellator.draw(); } }

    Read the article

  • how httpregistryfilter() in blackberry works?how to use [closed]

    - by Sowjanya
    i am trying to start my application using an url in my device browser. for this i used this: HttpFilterRegistry.registerFilter("www.atsas23.com","com.rim.samples.device.push"); Here this method will registry my application with www.atsas23.com and the second one will call the protocol class ,which is their in com.rim.samples.device.push. Now after doing ,still i am not getting .Means my app is not opening in browser.Can anybody tell why my application is not registering.what is going wrong.

    Read the article

  • Slick UnicodeFont displays in different location depending on the screen size?

    - by Joehot2000
    I am using the Slick2D library to draw text. The text draws perfectly, however it is in the wrong location! I could easily draw it in the correct location, however the problem is that the "correct location" is very different depending on the size of the screen - And my game needs to be able to have the screen size changed. Here is the render method for the text: public static void render() { glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); glLoadIdentity(); glDisableClientState(GL_VERTEX_ARRAY); glDisableClientState(GL_NORMAL_ARRAY); glUseProgram(0); glBindBuffer(GL_ARRAY_BUFFER, 0); glMatrixMode(GL_PROJECTION); glLoadMatrix(orthographicProjectionMatrix); glMatrixMode(GL_MODELVIEW); glPushMatrix(); glLoadIdentity(); glDisable(GL_LIGHTING); font.drawString(0, 0, "OMG ITS TEXT!", Color.green); glEnable(GL_LIGHTING); glPopMatrix(); glMatrixMode(GL_PROJECTION); glLoadMatrix(perspectiveProjectionMatrix); glMatrixMode(GL_MODELVIEW); } So, how can I set the text to be in the middle of the screen irrespective of screen size? Thanks!

    Read the article

  • Problem in searching String array [on hold]

    - by user2573607
    I'm working on a bank interface project, where I have to search an array of string when the user types in his username. The array has 10 strings, but only the first string is recognized as a valid username...I'm positive that the syntax of the search technique(Linear Search) is correct, but I cannot seem to find the problem. The code however compiles properly. Any answer will be appreciated, TIA! Aparna

    Read the article

  • UIImagePickerController, UIImage, Memory and More!

    - by Itay
    I've noticed that there are many questions about how to handle UIImage objects, especially in conjunction with UIImagePickerController and then displaying it in a view (usually a UIImageView). Here is a collection of common questions and their answers. Feel free to edit and add your own. I obviously learnt all this information from somewhere too. Various forum posts, StackOverflow answers and my own experimenting brought me to all these solutions. Credit goes to those who posted some sample code that I've since used and modified. I don't remember who you all are - but hats off to you! How Do I Select An Image From the User's Images or From the Camera? You use UIImagePickerController. The documentation for the class gives a decent overview of how one would use it, and can be found here. Basically, you create an instance of the class, which is a modal view controller, display it, and set yourself (or some class) to be the delegate. Then you'll get notified when a user selects some form of media (movie or image in 3.0 on the 3GS), and you can do whatever you want. My Delegate Was Called - How Do I Get The Media? The delegate method signature is the following: - (void)imagePickerController:(UIImagePickerController *)picker didFinishPickingMediaWithInfo:(NSDictionary *)info; You should put a breakpoint in the debugger to see what's in the dictionary, but you use that to extract the media. For example: UIImage* image = [info objectForKey:UIImagePickerControllerOriginalImage]; There are other keys that work as well, all in the documentation. OK, I Got The Image, But It Doesn't Have Any Geolocation Data. What gives? Unfortunately, Apple decided that we're not worthy of this information. When they load the data into the UIImage, they strip it of all the EXIF/Geolocation data. Can I Get To The Original File Representing This Image on the Disk? Nope. For security purposes, you only get the UIImage. How Can I Look At The Underlying Pixels of the UIImage? Since the UIImage is immutable, you can't look at the direct pixels. However, you can make a copy. The code to this looks something like this: UIImage* image = ...; // An image NSData* pixelData = (NSData*) CGDataProviderCopyData(CGImageGetDataProvider(image.CGImage)); unsigned char* pixelBytes = (unsigned char *)[pixelData bytes]; // Take away the red pixel, assuming 32-bit RGBA for(int i = 0; i < [pixelData length]; i += 4) { pixelBytes[i] = 0; // red pixelBytes[i+1] = pixelBytes[i+1]; // green pixelBytes[i+2] = pixelBytes[i+2]; // blue pixelBytes[i+3] = pixelBytes[i+3]; // alpha } However, note that CGDataProviderCopyData provides you with an "immutable" reference to the data - meaning you can't change it (and you may get a BAD_ACCESS error if you do). Look at the next question if you want to see how you can modify the pixels. How Do I Modify The Pixels of the UIImage? The UIImage is immutable, meaning you can't change it. Apple posted a great article on how to get a copy of the pixels and modify them, and rather than copy and paste it here, you should just go read the article. Once you have the bitmap context as they mention in the article, you can do something similar to this to get a new UIImage with the modified pixels: CGImageRef ref = CGBitmapContextCreateImage(bitmap); UIImage* newImage = [UIImage imageWithCGImage:ref]; Do remember to release your references though, otherwise you're going to be leaking quite a bit of memory. After I Select 3 Images From The Camera, I Run Out Of Memory. Help! You have to remember that even though on disk these images take up only a few hundred kilobytes at most, that's because they're compressed as a PNG or JPG. When they are loaded into the UIImage, they become uncompressed. A quick over-the-envelope calculation would be: width x height x 4 = bytes in memory That's assuming 32-bit pixels. If you have 16-bit pixels (some JPGs are stored as RGBA-5551), then you'd replace the 4 with a 2. Now, images taken with the camera are 1600 x 1200 pixels, so let's do the math: 1600 x 1200 x 4 = 7,680,000 bytes = ~8 MB 8 MB is a lot, especially when you have a limit of around 24 MB for your application. That's why you run out of memory. OK, I Understand Why I Have No Memory. What Do I Do? There is never any reason to display images at their full resolution. The iPhone has a screen of 480 x 320 pixels, so you're just wasting space. If you find yourself in this situation, ask yourself the following question: Do I need the full resolution image? If the answer is yes, then you should save it to disk for later use. If the answer is no, then read the next part. Once you've decided what to do with the full-resolution image, then you need to create a smaller image to use for displaying. Many times you might even want several sizes for your image: a thumbnail, a full-size one for displaying, and the original full-resolution image. OK, I'm Hooked. How Do I Resize the Image? Unfortunately, there is no defined way how to resize an image. Also, it's important to note that when you resize it, you'll get a new image - you're not modifying the old one. There are a couple of methods to do the resizing. I'll present them both here, and explain the pros and cons of each. Method 1: Using UIKit + (UIImage*)imageWithImage:(UIImage*)image scaledToSize:(CGSize)newSize; { // Create a graphics image context UIGraphicsBeginImageContext(newSize); // Tell the old image to draw in this new context, with the desired // new size [image drawInRect:CGRectMake(0,0,newSize.width,newSize.height)]; // Get the new image from the context UIImage* newImage = UIGraphicsGetImageFromCurrentImageContext(); // End the context UIGraphicsEndImageContext(); // Return the new image. return newImage; } This method is very simple, and works great. It will also deal with the UIImageOrientation for you, meaning that you don't have to care whether the camera was sideways when the picture was taken. However, this method is not thread safe, and since thumbnailing is a relatively expensive operation (approximately ~2.5s on a 3G for a 1600 x 1200 pixel image), this is very much an operation you may want to do in the background, on a separate thread. Method 2: Using CoreGraphics + (UIImage*)imageWithImage:(UIImage*)sourceImage scaledToSize:(CGSize)newSize; { CGFloat targetWidth = targetSize.width; CGFloat targetHeight = targetSize.height; CGImageRef imageRef = [sourceImage CGImage]; CGBitmapInfo bitmapInfo = CGImageGetBitmapInfo(imageRef); CGColorSpaceRef colorSpaceInfo = CGImageGetColorSpace(imageRef); if (bitmapInfo == kCGImageAlphaNone) { bitmapInfo = kCGImageAlphaNoneSkipLast; } CGContextRef bitmap; if (sourceImage.imageOrientation == UIImageOrientationUp || sourceImage.imageOrientation == UIImageOrientationDown) { bitmap = CGBitmapContextCreate(NULL, targetWidth, targetHeight, CGImageGetBitsPerComponent(imageRef), CGImageGetBytesPerRow(imageRef), colorSpaceInfo, bitmapInfo); } else { bitmap = CGBitmapContextCreate(NULL, targetHeight, targetWidth, CGImageGetBitsPerComponent(imageRef), CGImageGetBytesPerRow(imageRef), colorSpaceInfo, bitmapInfo); } if (sourceImage.imageOrientation == UIImageOrientationLeft) { CGContextRotateCTM (bitmap, radians(90)); CGContextTranslateCTM (bitmap, 0, -targetHeight); } else if (sourceImage.imageOrientation == UIImageOrientationRight) { CGContextRotateCTM (bitmap, radians(-90)); CGContextTranslateCTM (bitmap, -targetWidth, 0); } else if (sourceImage.imageOrientation == UIImageOrientationUp) { // NOTHING } else if (sourceImage.imageOrientation == UIImageOrientationDown) { CGContextTranslateCTM (bitmap, targetWidth, targetHeight); CGContextRotateCTM (bitmap, radians(-180.)); } CGContextDrawImage(bitmap, CGRectMake(0, 0, targetWidth, targetHeight), imageRef); CGImageRef ref = CGBitmapContextCreateImage(bitmap); UIImage* newImage = [UIImage imageWithCGImage:ref]; CGContextRelease(bitmap); CGImageRelease(ref); return newImage; } The benefit of this method is that it is thread-safe, plus it takes care of all the small things (using correct color space and bitmap info, dealing with image orientation) that the UIKit version does. How Do I Resize and Maintain Aspect Ratio (like the AspectFill option)? It is very similar to the method above, and it looks like this: + (UIImage*)imageWithImage:(UIImage*)sourceImage scaledToSizeWithSameAspectRatio:(CGSize)targetSize; { CGSize imageSize = sourceImage.size; CGFloat width = imageSize.width; CGFloat height = imageSize.height; CGFloat targetWidth = targetSize.width; CGFloat targetHeight = targetSize.height; CGFloat scaleFactor = 0.0; CGFloat scaledWidth = targetWidth; CGFloat scaledHeight = targetHeight; CGPoint thumbnailPoint = CGPointMake(0.0,0.0); if (CGSizeEqualToSize(imageSize, targetSize) == NO) { CGFloat widthFactor = targetWidth / width; CGFloat heightFactor = targetHeight / height; if (widthFactor > heightFactor) { scaleFactor = widthFactor; // scale to fit height } else { scaleFactor = heightFactor; // scale to fit width } scaledWidth = width * scaleFactor; scaledHeight = height * scaleFactor; // center the image if (widthFactor > heightFactor) { thumbnailPoint.y = (targetHeight - scaledHeight) * 0.5; } else if (widthFactor < heightFactor) { thumbnailPoint.x = (targetWidth - scaledWidth) * 0.5; } } CGImageRef imageRef = [sourceImage CGImage]; CGBitmapInfo bitmapInfo = CGImageGetBitmapInfo(imageRef); CGColorSpaceRef colorSpaceInfo = CGImageGetColorSpace(imageRef); if (bitmapInfo == kCGImageAlphaNone) { bitmapInfo = kCGImageAlphaNoneSkipLast; } CGContextRef bitmap; if (sourceImage.imageOrientation == UIImageOrientationUp || sourceImage.imageOrientation == UIImageOrientationDown) { bitmap = CGBitmapContextCreate(NULL, targetWidth, targetHeight, CGImageGetBitsPerComponent(imageRef), CGImageGetBytesPerRow(imageRef), colorSpaceInfo, bitmapInfo); } else { bitmap = CGBitmapContextCreate(NULL, targetHeight, targetWidth, CGImageGetBitsPerComponent(imageRef), CGImageGetBytesPerRow(imageRef), colorSpaceInfo, bitmapInfo); } // In the right or left cases, we need to switch scaledWidth and scaledHeight, // and also the thumbnail point if (sourceImage.imageOrientation == UIImageOrientationLeft) { thumbnailPoint = CGPointMake(thumbnailPoint.y, thumbnailPoint.x); CGFloat oldScaledWidth = scaledWidth; scaledWidth = scaledHeight; scaledHeight = oldScaledWidth; CGContextRotateCTM (bitmap, radians(90)); CGContextTranslateCTM (bitmap, 0, -targetHeight); } else if (sourceImage.imageOrientation == UIImageOrientationRight) { thumbnailPoint = CGPointMake(thumbnailPoint.y, thumbnailPoint.x); CGFloat oldScaledWidth = scaledWidth; scaledWidth = scaledHeight; scaledHeight = oldScaledWidth; CGContextRotateCTM (bitmap, radians(-90)); CGContextTranslateCTM (bitmap, -targetWidth, 0); } else if (sourceImage.imageOrientation == UIImageOrientationUp) { // NOTHING } else if (sourceImage.imageOrientation == UIImageOrientationDown) { CGContextTranslateCTM (bitmap, targetWidth, targetHeight); CGContextRotateCTM (bitmap, radians(-180.)); } CGContextDrawImage(bitmap, CGRectMake(thumbnailPoint.x, thumbnailPoint.y, scaledWidth, scaledHeight), imageRef); CGImageRef ref = CGBitmapContextCreateImage(bitmap); UIImage* newImage = [UIImage imageWithCGImage:ref]; CGContextRelease(bitmap); CGImageRelease(ref); return newImage; } The method we employ here is to create a bitmap with the desired size, but draw an image that is actually larger, thus maintaining the aspect ratio. So We've Got Our Scaled Images - How Do I Save Them To Disk? This is pretty simple. Remember that we want to save a compressed version to disk, and not the uncompressed pixels. Apple provides two functions that help us with this (documentation is here): NSData* UIImagePNGRepresentation(UIImage *image); NSData* UIImageJPEGRepresentation (UIImage *image, CGFloat compressionQuality); And if you want to use them, you'd do something like: UIImage* myThumbnail = ...; // Get some image NSData* imageData = UIImagePNGRepresentation(myThumbnail); Now we're ready to save it to disk, which is the final step (say into the documents directory): // Give a name to the file NSString* imageName = @"MyImage.png"; // Now, we have to find the documents directory so we can save it // Note that you might want to save it elsewhere, like the cache directory, // or something similar. NSArray* paths = NSSearchPathForDirectoriesInDomains(NSDocumentDirectory, NSUserDomainMask, YES); NSString* documentsDirectory = [paths objectAtIndex:0]; // Now we get the full path to the file NSString* fullPathToFile = [documentsDirectory stringByAppendingPathComponent:imageName]; // and then we write it out [imageData writeToFile:fullPathToFile atomically:NO]; You would repeat this for every version of the image you have. How Do I Load These Images Back Into Memory? Just look at the various UIImage initialization methods, such as +imageWithContentsOfFile: in the Apple documentation.

    Read the article

  • SSL in tomcat with apr and Centos 6

    - by Jonathan
    I'm facing a problem setting up my tomcat with apr native lib, I have the following: Tomcat: 7.0.42 Java: 1.7.0_40-b43 OS: Centos 6.4 (2.6.32-358.18.1.el6.i686) APR: 1.3.9 Native lib: 1.1.27 OpenSSL: openssl-1.0.0-27.el6_4.2.i686 My server.xml looks like: ... <Listener className="org.apache.catalina.core.AprLifecycleListener" SSLEngine="on" /> ... <Connector port="8443" protocol="HTTP/1.1" SSLEnabled="true" maxThreads="150" scheme="https" secure="true" clientAuth="false" sslProtocol="TLS" SSLCertificateFile="/tmp/monitoringPortalCert.pem" SSLCertificateKeyFile="/tmp/monitoringPortalKey.pem" SSLPassword="hide" /> ... I compiled the native lib as follow: ./configure --with-apr=/usr/bin/apr-1-config --with-ssl=yes --prefix=$CATALINA_HOME make && make install The APR is loaded ok: Oct 06, 2013 7:55:14 PM org.apache.catalina.core.AprLifecycleListener init INFO: Loaded APR based Apache Tomcat Native library 1.1.27 using APR version 1.3.9. But I'm still having this error: SEVERE: Failed to initialize the SSLEngine. org.apache.tomcat.jni.Error: 70023: This function has not been implemented on this platform ./configure outcome [root@localhost native]# ./configure --with-apr=/usr/bin/apr-1-config --with-ssl=yes -- prefix=$CATALINA_HOME && make && make install checking build system type... i686-pc-linux-gnu checking host system type... i686-pc-linux-gnu checking target system type... i686-pc-linux-gnu checking for a BSD-compatible install... /usr/bin/install -c checking for working mkdir -p... yes Tomcat Native Version: 1.1.27 checking for chosen layout... tcnative checking for APR... yes setting CC to "gcc" setting CPP to "gcc -E" checking for JDK location (please wait)... /usr/java/jdk1.7.0_40 from environment checking Java platform... checking Java platform... checking for sablevm... NONE adding "-I/usr/java/jdk1.7.0_40/include" to TCNATIVE_PRIV_INCLUDES checking os_type directory... linux adding "-I/usr/java/jdk1.7.0_40/include/linux" to TCNATIVE_PRIV_INCLUDES checking for gcc... gcc checking whether the C compiler works... yes checking for C compiler default output file name... a.out checking for suffix of executables... checking whether we are cross compiling... no checking for suffix of object files... o checking whether we are using the GNU C compiler... yes checking whether gcc accepts -g... yes checking for gcc option to accept ISO C89... none needed checking for OpenSSL library... using openssl from /usr/lib and /usr/include checking OpenSSL library version... ok checking for OpenSSL DSA support... yes setting TCNATIVE_LDFLAGS to "-lssl -lcrypto" adding "-DHAVE_OPENSSL" to CFLAGS setting TCNATIVE_LIBS to "" setting TCNATIVE_LIBS to " /usr/lib/libapr-1.la -lpthread" configure: creating ./config.status config.status: creating tcnative.pc config.status: creating Makefile config.status: executing default commands make[1]: Entering directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' make[1]: Nothing to be done for `local-all'. make[1]: Leaving directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' make[1]: Entering directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' make[1]: Nothing to be done for `local-all'. make[1]: Leaving directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' /usr/lib/apr-1/build/mkdir.sh /usr/apache-tomcat-7.0.42/include/apr-1 /usr/apache- tomcat-7.0.42/lib/pkgconfig \ /usr/apache-tomcat-7.0.42/lib /usr/apache-tomcat-7.0.42/bin /usr/bin/install -c -m 644 tcnative.pc /usr/apache-tomcat-7.0.42/lib/pkgconfig/tcnative- 1.pc list=''; for i in $list; do \ ( cd $i ; make DESTDIR= install ); \ done /bin/sh /usr/lib/apr-1/build/libtool --mode=install /usr/bin/install -c -m 755 libtcnative-1.la /usr/apache-tomcat-7.0.42/lib libtool: install: /usr/bin/install -c -m 755 .libs/libtcnative-1.so.0.1.27 /usr/apache- tomcat-7.0.42/lib/libtcnative-1.so.0.1.27 libtool: install: (cd /usr/apache-tomcat-7.0.42/lib && { ln -s -f libtcnative- 1.so.0.1.27 libtcnative-1.so.0 || { rm -f libtcnative-1.so.0 && ln -s libtcnative- 1.so.0.1.27 libtcnative-1.so.0; }; }) libtool: install: (cd /usr/apache-tomcat-7.0.42/lib && { ln -s -f libtcnative- 1.so.0.1.27 libtcnative-1.so || { rm -f libtcnative-1.so && ln -s libtcnative-1.so.0.1.27 libtcnative-1.so; }; }) libtool: install: /usr/bin/install -c -m 755 .libs/libtcnative-1.lai /usr/apache-tomcat- 7.0.42/lib/libtcnative-1.la libtool: install: /usr/bin/install -c -m 755 .libs/libtcnative-1.a /usr/apache-tomcat- 7.0.42/lib/libtcnative-1.a libtool: install: chmod 644 /usr/apache-tomcat-7.0.42/lib/libtcnative-1.a libtool: install: ranlib /usr/apache-tomcat-7.0.42/lib/libtcnative-1.a libtool: install: warning: remember to run `libtool --finish /usr/local/apr/lib' make && make install outcome: make[1]: Entering directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' make[1]: Nothing to be done for `local-all'. make[1]: Leaving directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' make[1]: Entering directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' make[1]: Nothing to be done for `local-all'. make[1]: Leaving directory `/usr/apache-tomcat-7.0.42/bin/tomcat-native-1.1.27- src/jni/native' /usr/lib/apr-1/build/mkdir.sh /usr/apache-tomcat-7.0.42/include/apr-1 /usr/apache- tomcat-7.0.42/lib/pkgconfig \ /usr/apache-tomcat-7.0.42/lib /usr/apache-tomcat-7.0.42/bin /usr/bin/install -c -m 644 tcnative.pc /usr/apache-tomcat-7.0.42/lib/pkgconfig/tcnative- 1.pc list=''; for i in $list; do \ ( cd $i ; make DESTDIR= install ); \ done /bin/sh /usr/lib/apr-1/build/libtool --mode=install /usr/bin/install -c -m 755 libtcnative-1.la /usr/apache-tomcat-7.0.42/lib libtool: install: /usr/bin/install -c -m 755 .libs/libtcnative-1.so.0.1.27 /usr/apache- tomcat-7.0.42/lib/libtcnative-1.so.0.1.27 libtool: install: (cd /usr/apache-tomcat-7.0.42/lib && { ln -s -f libtcnative- 1.so.0.1.27 libtcnative-1.so.0 || { rm -f libtcnative-1.so.0 && ln -s libtcnative- 1.so.0.1.27 libtcnative-1.so.0; }; }) libtool: install: (cd /usr/apache-tomcat-7.0.42/lib && { ln -s -f libtcnative- 1.so.0.1.27 libtcnative-1.so || { rm -f libtcnative-1.so && ln -s libtcnative-1.so.0.1.27 libtcnative-1.so; }; }) libtool: install: /usr/bin/install -c -m 755 .libs/libtcnative-1.lai /usr/apache-tomcat- 7.0.42/lib/libtcnative-1.la libtool: install: /usr/bin/install -c -m 755 .libs/libtcnative-1.a /usr/apache-tomcat- 7.0.42/lib/libtcnative-1.a libtool: install: chmod 644 /usr/apache-tomcat-7.0.42/lib/libtcnative-1.a libtool: install: ranlib /usr/apache-tomcat-7.0.42/lib/libtcnative-1.a libtool: install: warning: remember to run `libtool --finish /usr/local/apr/lib' It seems everything is fine, but the error is not self-explanatory Could you guys help to understand where my error is? What am I missing? Thanks in advance for your support.

    Read the article

  • Package <blah> does not exist - NetBeans 6.8 & Windows 7

    - by bjmac
    I'm using NetBeans 6.8 on Windows 7. Upgrade from WinXP and NetBEans 6.7. Now my existing java web app project is no longer able to import/find the packages I've developed. And yet the project still compiles and runs OK. I've tried changing the Java Platform/JDK from 1.6.0_10 back to JDK 1.5.0_22 but I still receive errors package does not exist. All other libraries and packages are able to import OK ...

    Read the article

  • GlassFish change port of web-service

    - by Dror
    Hi, I am new to Java and Linux. I have a JSP site and a java web service deployed on a GlassFish server (working OK). I need to change the port of both the application and web-service. I have changed the listener port in the domain.xml file, but the web application is still trying to connect to the WSDL on port 8080. How can I change the configuration of the web service port? Thanks

    Read the article

  • set JAVA_HOME in windows but "ant build" still fails

    - by patrickinmpls
    I set JAVA_HOME in windows environment preferences echo %JAVA_HOME% C:\Program Files (x86)\Java\jdk1.6.0_20 but then I try to run ant build and I get Perhaps JAVA_HOME does not point to the JDK. It is currently set to "C:\Program Files\Java\jre6" I think the registry key JAVASOFT is interfering with my environment variable, but I'm not sure how to fix this

    Read the article

  • Is there a way to automatically keep Chrome/Ask Tool Bar from installing?

    - by hydroparadise
    So of lately, I've had to warn my users to watch out for unwanted programs that are coming in with Adobe Flash and Java updates. Adobe seems to be pushing Google's Chrome and Java with the Ask.com Toolbar. I admit that it could be much worse because both instance simply require an uncheck during some point of the update process, but on a large scale, prevention is better than confrontation. Any suggestions?

    Read the article

  • How to determine JAVA_HOME on Debian/Ubuntu?

    - by Witek
    On Ubuntu it is possible to have multiple JVMs at the same time. The default one is selected with update-alternatives. But this does not set the JAVA_HOME environment variable, due to a debian policy. I am writing a launcher script (bash), which starts a java application. This java application needs the JAVA_HOME environment variable. So how to get the path of the JVM which is currently selected by update-alternatives?

    Read the article

  • Error:Unable to acsess jarfile

    - by user2539617
    Whenever I turn on my HP Pavilion slimline (type of computer) it says Error:Unable to acsess jarfile C:/Users/Private/Appdata/RoamingServer258261055 The tab name is Java Virtual Machine Launcher Somehow. This effects me connecting to java programs that require online on a downloaded platform such as .exe or .bin. So if you try to login on Minecraft it won't connect. Raidcall,Skype,Sony Vegas. I really need help!

    Read the article

  • Synchronizing issue: I want the main thread to be run before another thread but it sometimes doesn´t

    - by Rox
    I have done my own small concurrency framework (just for learning purposes) inspired by the java.util.concurrency package. This is about the Callable/Future mechanism. My code below is the whole one and is compilable and very easy to understand. My problem is that sometimes I run into a deadlock where the first thread (the main thread) awaits for a signal from the other thread. But then the other thread has already notified the main thread before the main thread went into waiting state, so the main thread cannot wake up. FutureTask.get() should always be run before FutureTask.run() but sometimes the run() method (which is called by new thread) runs before the get() method (which is called by main thread). I don´t know how I can prevent that. This is a pseudo code of how I want the two threads to be run. //From main thread: Executor.submit().get() (in get() the main thread waits for new thread to notify) ->submit() calls Executor.execute(FutureTask object) -> execute() starts new thread -> new thread shall notify `main thread` I cannot understand how the new thread can start up and run faster than the main thread that actually starts the new thread. Main.java: public class Main { public static void main(String[] args) { new ExecutorServiceExample(); } public Main() { ThreadExecutor executor = new ThreadExecutor(); Integer i = executor.submit(new Callable<Integer>() { @Override public Integer call() { return 10; } }).get(); System.err.println("Value: "+i); } } ThreadExecutor.java: public class ThreadExecutor { public ThreadExecutor() {} protected <V> RunnableFuture<V> newTaskFor(Callable c) { return new FutureTask<V>(c); } public <V> Future<V> submit(Callable<V> task) { if (task == null) throw new NullPointerException(); RunnableFuture<V> ftask = newTaskFor(task); execute(ftask); return ftask; } public void execute(Runnable r) { new Thread(r).start(); } } FutureTask.java: import java.util.concurrent.locks.Condition; import java.util.concurrent.locks.ReentrantLock; import java.util.logging.Level; import java.util.logging.Logger; public class FutureTask<V> implements RunnableFuture<V> { private Callable<V> callable; private volatile V result; private ReentrantLock lock = new ReentrantLock(); private Condition condition = lock.newCondition(); public FutureTask(Callable callable) { if (callable == null) throw new NullPointerException(); this.callable = callable; } @Override public void run() { acquireLock(); System.err.println("RUN"+Thread.currentThread().getName()); V v = this.callable.call(); set(v); condition.signal(); releaseLock(); } @Override public V get() { acquireLock(); System.err.println("GET "+Thread.currentThread().getName()); try { condition.await(); } catch (InterruptedException ex) { Logger.getLogger(FutureTask.class.getName()).log(Level.SEVERE, null, ex); } releaseLock(); return this.result; } public void set(V v) { this.result = v; } private void acquireLock() { lock.lock(); } private void releaseLock() { lock.unlock(); } } And the interfaces: public interface RunnableFuture<V> extends Runnable, Future<V> { @Override void run(); } public interface Future<V> { V get(); } public interface Callable<V> { V call(); }

    Read the article

  • is it right to call ejb bean from thread by ThreadPoolExecutor?

    - by kislo_metal
    I trying to call some ejb bean method from tread. and getting error : (as is glassfish v3) Log Level SEVERE Logger javax.enterprise.system.std.com.sun.enterprise.v3.services.impl Name-Value Pairs {_ThreadName=Thread-1, _ThreadID=42} Record Number 928 Message ID java.lang.NullPointerException at ua.co.rufous.server.broker.TempLicService.run(TempLicService.java Complete Message 35) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:637) here is tread public class TempLicService implements Runnable { String hash; //it`s Stateful bean @EJB private LicActivatorLocal lActivator; public TempLicService(String hash) { this.hash= hash; } @Override public void run() { lActivator.proccessActivation(hash); } } my ThreadPoolExecutor public class RequestThreadPoolExecutor extends ThreadPoolExecutor { private boolean isPaused; private ReentrantLock pauseLock = new ReentrantLock(); private Condition unpaused = pauseLock.newCondition(); private static RequestThreadPoolExecutor threadPool; private RequestThreadPoolExecutor() { super(1, Integer.MAX_VALUE, 10, TimeUnit.SECONDS, new LinkedBlockingQueue<Runnable>()); System.out.println("RequestThreadPoolExecutor created"); } public static RequestThreadPoolExecutor getInstance() { if (threadPool == null) threadPool = new RequestThreadPoolExecutor(); return threadPool; } public void runService(Runnable task) { threadPool.execute(task); } protected void beforeExecute(Thread t, Runnable r) { super.beforeExecute(t, r); pauseLock.lock(); try { while (isPaused) unpaused.await(); } catch (InterruptedException ie) { t.interrupt(); } finally { pauseLock.unlock(); } } public void pause() { pauseLock.lock(); try { isPaused = true; } finally { pauseLock.unlock(); } } public void resume() { pauseLock.lock(); try { isPaused = false; unpaused.signalAll(); } finally { pauseLock.unlock(); } } public void shutDown() { threadPool.shutdown(); } //<<<<<< creating thread here public void runByHash(String hash) { Runnable service = new TempLicService(hash); threadPool.runService(service); } } and method where i call it (it is gwt servlet, but there is no proble to call thread that not contain ejb) : @Override public Boolean submitHash(String hash) { System.out.println("submiting hash"); try { if (tBoxService.getTempLicStatus(hash) == 1) { //<<< here is the call RequestThreadPoolExecutor.getInstance().runByHash(hash); return true; } } catch (NoResultException e) { e.printStackTrace(); } return false; } I need to organize some pool of submitting hash to server (calls of LicActivator bean), is ThreadPoolExecutor design good idea and why it is not working in my case? (as I know we can`t create thread inside bean, but could we call bean from different threads? ). If No, what is the bast practice for organize such request pool? Thanks. << Answer: I am using DI (EJB 3.1) soo i do not need any look up here. (application packed in ear and both modules in it (web module and ejb), it works perfect for me). But I can use it only in managed classes. So.. 2.Can I use manual look up in Tread ? Could I use Bean that extends ThreadPoolExecutor and calling another bean that implements Runnable ? Or it is not allowed ?

    Read the article

  • High Linux loads on low CPU/memory usage

    - by user13323
    Hi. I have quite strange situation, where my CentOS 5.5 box loads are high, but the CPU and memory used are pretty low: top - 20:41:38 up 42 days, 6:14, 2 users, load average: 19.79, 21.25, 18.87 Tasks: 254 total, 1 running, 253 sleeping, 0 stopped, 0 zombie Cpu(s): 3.8%us, 0.3%sy, 0.1%ni, 95.0%id, 0.6%wa, 0.0%hi, 0.1%si, 0.0%st Mem: 4035284k total, 4008084k used, 27200k free, 38748k buffers Swap: 4208928k total, 242576k used, 3966352k free, 1465008k cached free -mt total used free shared buffers cached Mem: 3940 3910 29 0 37 1427 -/+ buffers/cache: 2445 1495 Swap: 4110 236 3873 Total: 8050 4147 3903 Iostat also shows good results: avg-cpu: %user %nice %system %iowait %steal %idle 3.83 0.13 0.41 0.58 0.00 95.05 Here is the ps aux output: USER PID %CPU %MEM VSZ RSS TTY STAT START TIME COMMAND root 1 0.0 0.0 10348 80 ? Ss 2010 2:11 init [3] root 2 0.0 0.0 0 0 ? S< 2010 0:00 [migration/0] root 3 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/0] root 4 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/0] root 5 0.0 0.0 0 0 ? S< 2010 0:02 [migration/1] root 6 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/1] root 7 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/1] root 8 0.0 0.0 0 0 ? S< 2010 0:02 [migration/2] root 9 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/2] root 10 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/2] root 11 0.0 0.0 0 0 ? S< 2010 0:02 [migration/3] root 12 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/3] root 13 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/3] root 14 0.0 0.0 0 0 ? S< 2010 0:03 [migration/4] root 15 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/4] root 16 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/4] root 17 0.0 0.0 0 0 ? S< 2010 0:01 [migration/5] root 18 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/5] root 19 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/5] root 20 0.0 0.0 0 0 ? S< 2010 0:11 [migration/6] root 21 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/6] root 22 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/6] root 23 0.0 0.0 0 0 ? S< 2010 0:01 [migration/7] root 24 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/7] root 25 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/7] root 26 0.0 0.0 0 0 ? S< 2010 0:00 [migration/8] root 27 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/8] root 28 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/8] root 29 0.0 0.0 0 0 ? S< 2010 0:00 [migration/9] root 30 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/9] root 31 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/9] root 32 0.0 0.0 0 0 ? S< 2010 0:08 [migration/10] root 33 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/10] root 34 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/10] root 35 0.0 0.0 0 0 ? S< 2010 0:05 [migration/11] root 36 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/11] root 37 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/11] root 38 0.0 0.0 0 0 ? S< 2010 0:02 [migration/12] root 39 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/12] root 40 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/12] root 41 0.0 0.0 0 0 ? S< 2010 0:14 [migration/13] root 42 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/13] root 43 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/13] root 44 0.0 0.0 0 0 ? S< 2010 0:04 [migration/14] root 45 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/14] root 46 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/14] root 47 0.0 0.0 0 0 ? S< 2010 0:01 [migration/15] root 48 0.0 0.0 0 0 ? SN 2010 0:00 [ksoftirqd/15] root 49 0.0 0.0 0 0 ? S< 2010 0:00 [watchdog/15] root 50 0.0 0.0 0 0 ? S< 2010 0:00 [events/0] root 51 0.0 0.0 0 0 ? S< 2010 0:00 [events/1] root 52 0.0 0.0 0 0 ? S< 2010 0:00 [events/2] root 53 0.0 0.0 0 0 ? S< 2010 0:00 [events/3] root 54 0.0 0.0 0 0 ? S< 2010 0:00 [events/4] root 55 0.0 0.0 0 0 ? S< 2010 0:00 [events/5] root 56 0.0 0.0 0 0 ? S< 2010 0:00 [events/6] root 57 0.0 0.0 0 0 ? S< 2010 0:00 [events/7] root 58 0.0 0.0 0 0 ? S< 2010 0:00 [events/8] root 59 0.0 0.0 0 0 ? S< 2010 0:00 [events/9] root 60 0.0 0.0 0 0 ? S< 2010 0:00 [events/10] root 61 0.0 0.0 0 0 ? S< 2010 0:00 [events/11] root 62 0.0 0.0 0 0 ? S< 2010 0:00 [events/12] root 63 0.0 0.0 0 0 ? S< 2010 0:00 [events/13] root 64 0.0 0.0 0 0 ? S< 2010 0:00 [events/14] root 65 0.0 0.0 0 0 ? S< 2010 0:00 [events/15] root 66 0.0 0.0 0 0 ? S< 2010 0:00 [khelper] root 107 0.0 0.0 0 0 ? S< 2010 0:00 [kthread] root 126 0.0 0.0 0 0 ? S< 2010 0:00 [kblockd/0] root 127 0.0 0.0 0 0 ? S< 2010 0:03 [kblockd/1] root 128 0.0 0.0 0 0 ? S< 2010 0:01 [kblockd/2] root 129 0.0 0.0 0 0 ? S< 2010 0:00 [kblockd/3] root 130 0.0 0.0 0 0 ? S< 2010 0:05 [kblockd/4] root 131 0.0 0.0 0 0 ? S< 2010 0:00 [kblockd/5] root 132 0.0 0.0 0 0 ? S< 2010 0:00 [kblockd/6] root 133 0.0 0.0 0 0 ? S< 2010 0:00 [kblockd/7] root 134 0.0 0.0 0 0 ? S< 2010 0:00 [kblockd/8] root 135 0.0 0.0 0 0 ? S< 2010 0:02 [kblockd/9] root 136 0.0 0.0 0 0 ? S< 2010 0:00 [kblockd/10] root 137 0.0 0.0 0 0 ? S< 2010 0:00 [kblockd/11] root 138 0.0 0.0 0 0 ? S< 2010 0:04 [kblockd/12] root 139 0.0 0.0 0 0 ? S< 2010 0:00 [kblockd/13] root 140 0.0 0.0 0 0 ? S< 2010 0:00 [kblockd/14] root 141 0.0 0.0 0 0 ? S< 2010 0:00 [kblockd/15] root 142 0.0 0.0 0 0 ? S< 2010 0:00 [kacpid] root 281 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/0] root 282 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/1] root 283 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/2] root 284 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/3] root 285 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/4] root 286 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/5] root 287 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/6] root 288 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/7] root 289 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/8] root 290 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/9] root 291 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/10] root 292 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/11] root 293 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/12] root 294 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/13] root 295 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/14] root 296 0.0 0.0 0 0 ? S< 2010 0:00 [cqueue/15] root 299 0.0 0.0 0 0 ? S< 2010 0:00 [khubd] root 301 0.0 0.0 0 0 ? S< 2010 0:00 [kseriod] root 490 0.0 0.0 0 0 ? S 2010 0:00 [khungtaskd] root 493 0.1 0.0 0 0 ? S< 2010 94:48 [kswapd1] root 494 0.0 0.0 0 0 ? S< 2010 0:00 [aio/0] root 495 0.0 0.0 0 0 ? S< 2010 0:00 [aio/1] root 496 0.0 0.0 0 0 ? S< 2010 0:00 [aio/2] root 497 0.0 0.0 0 0 ? S< 2010 0:00 [aio/3] root 498 0.0 0.0 0 0 ? S< 2010 0:00 [aio/4] root 499 0.0 0.0 0 0 ? S< 2010 0:00 [aio/5] root 500 0.0 0.0 0 0 ? S< 2010 0:00 [aio/6] root 501 0.0 0.0 0 0 ? S< 2010 0:00 [aio/7] root 502 0.0 0.0 0 0 ? S< 2010 0:00 [aio/8] root 503 0.0 0.0 0 0 ? S< 2010 0:00 [aio/9] root 504 0.0 0.0 0 0 ? S< 2010 0:00 [aio/10] root 505 0.0 0.0 0 0 ? S< 2010 0:00 [aio/11] root 506 0.0 0.0 0 0 ? S< 2010 0:00 [aio/12] root 507 0.0 0.0 0 0 ? S< 2010 0:00 [aio/13] root 508 0.0 0.0 0 0 ? S< 2010 0:00 [aio/14] root 509 0.0 0.0 0 0 ? S< 2010 0:00 [aio/15] root 665 0.0 0.0 0 0 ? S< 2010 0:00 [kpsmoused] root 808 0.0 0.0 0 0 ? S< 2010 0:00 [ata/0] root 809 0.0 0.0 0 0 ? S< 2010 0:00 [ata/1] root 810 0.0 0.0 0 0 ? S< 2010 0:00 [ata/2] root 811 0.0 0.0 0 0 ? S< 2010 0:00 [ata/3] root 812 0.0 0.0 0 0 ? S< 2010 0:00 [ata/4] root 813 0.0 0.0 0 0 ? S< 2010 0:00 [ata/5] root 814 0.0 0.0 0 0 ? S< 2010 0:00 [ata/6] root 815 0.0 0.0 0 0 ? S< 2010 0:00 [ata/7] root 816 0.0 0.0 0 0 ? S< 2010 0:00 [ata/8] root 817 0.0 0.0 0 0 ? S< 2010 0:00 [ata/9] root 818 0.0 0.0 0 0 ? S< 2010 0:00 [ata/10] root 819 0.0 0.0 0 0 ? S< 2010 0:00 [ata/11] root 820 0.0 0.0 0 0 ? S< 2010 0:00 [ata/12] root 821 0.0 0.0 0 0 ? S< 2010 0:00 [ata/13] root 822 0.0 0.0 0 0 ? S< 2010 0:00 [ata/14] root 823 0.0 0.0 0 0 ? S< 2010 0:00 [ata/15] root 824 0.0 0.0 0 0 ? S< 2010 0:00 [ata_aux] root 842 0.0 0.0 0 0 ? S< 2010 0:00 [scsi_eh_0] root 843 0.0 0.0 0 0 ? S< 2010 0:00 [scsi_eh_1] root 844 0.0 0.0 0 0 ? S< 2010 0:00 [scsi_eh_2] root 845 0.0 0.0 0 0 ? S< 2010 0:00 [scsi_eh_3] root 846 0.0 0.0 0 0 ? S< 2010 0:00 [scsi_eh_4] root 847 0.0 0.0 0 0 ? S< 2010 0:00 [scsi_eh_5] root 882 0.0 0.0 0 0 ? S< 2010 0:00 [kstriped] root 951 0.0 0.0 0 0 ? S< 2010 4:24 [kjournald] root 976 0.0 0.0 0 0 ? S< 2010 0:00 [kauditd] postfix 990 0.0 0.0 54208 2284 ? S 21:19 0:00 pickup -l -t fifo -u root 1013 0.0 0.0 12676 8 ? S<s 2010 0:00 /sbin/udevd -d root 1326 0.0 0.0 90900 3400 ? Ss 14:53 0:00 sshd: root@notty root 1410 0.0 0.0 53972 2108 ? Ss 14:53 0:00 /usr/libexec/openssh/sftp-server root 2690 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/0] root 2691 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/1] root 2692 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/2] root 2693 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/3] root 2694 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/4] root 2695 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/5] root 2696 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/6] root 2697 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/7] root 2698 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/8] root 2699 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/9] root 2700 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/10] root 2701 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/11] root 2702 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/12] root 2703 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/13] root 2704 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/14] root 2705 0.0 0.0 0 0 ? S< 2010 0:00 [kmpathd/15] root 2706 0.0 0.0 0 0 ? S< 2010 0:00 [kmpath_handlerd] root 2755 0.0 0.0 0 0 ? S< 2010 4:35 [kjournald] root 2757 0.0 0.0 0 0 ? S< 2010 3:38 [kjournald] root 2759 0.0 0.0 0 0 ? S< 2010 4:10 [kjournald] root 2761 0.0 0.0 0 0 ? S< 2010 4:26 [kjournald] root 2763 0.0 0.0 0 0 ? S< 2010 3:15 [kjournald] root 2765 0.0 0.0 0 0 ? S< 2010 3:04 [kjournald] root 2767 0.0 0.0 0 0 ? S< 2010 3:02 [kjournald] root 2769 0.0 0.0 0 0 ? S< 2010 2:58 [kjournald] root 2771 0.0 0.0 0 0 ? S< 2010 0:00 [kjournald] root 3340 0.0 0.0 5908 356 ? Ss 2010 2:48 syslogd -m 0 root 3343 0.0 0.0 3804 212 ? Ss 2010 0:03 klogd -x root 3430 0.0 0.0 0 0 ? S< 2010 0:50 [kondemand/0] root 3431 0.0 0.0 0 0 ? S< 2010 0:54 [kondemand/1] root 3432 0.0 0.0 0 0 ? S< 2010 0:00 [kondemand/2] root 3433 0.0 0.0 0 0 ? S< 2010 0:00 [kondemand/3] root 3434 0.0 0.0 0 0 ? S< 2010 0:00 [kondemand/4] root 3435 0.0 0.0 0 0 ? S< 2010 0:00 [kondemand/5] root 3436 0.0 0.0 0 0 ? S< 2010 0:00 [kondemand/6] root 3437 0.0 0.0 0 0 ? S< 2010 0:00 [kondemand/7] root 3438 0.0 0.0 0 0 ? S< 2010 0:00 [kondemand/8] root 3439 0.0 0.0 0 0 ? S< 2010 0:00 [kondemand/9] root 3440 0.0 0.0 0 0 ? S< 2010 0:00 [kondemand/10] root 3441 0.0 0.0 0 0 ? S< 2010 0:00 [kondemand/11] root 3442 0.0 0.0 0 0 ? S< 2010 0:00 [kondemand/12] root 3443 0.0 0.0 0 0 ? S< 2010 0:00 [kondemand/13] root 3444 0.0 0.0 0 0 ? S< 2010 0:00 [kondemand/14] root 3445 0.0 0.0 0 0 ? S< 2010 0:00 [kondemand/15] root 3461 0.0 0.0 10760 284 ? Ss 2010 3:44 irqbalance rpc 3481 0.0 0.0 8052 4 ? Ss 2010 0:00 portmap root 3526 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/0] root 3527 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/1] root 3528 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/2] root 3529 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/3] root 3530 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/4] root 3531 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/5] root 3532 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/6] root 3533 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/7] root 3534 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/8] root 3535 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/9] root 3536 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/10] root 3537 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/11] root 3538 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/12] root 3539 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/13] root 3540 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/14] root 3541 0.0 0.0 0 0 ? S< 2010 0:00 [rpciod/15] root 3563 0.0 0.0 10160 8 ? Ss 2010 0:00 rpc.statd root 3595 0.0 0.0 55180 4 ? Ss 2010 0:00 rpc.idmapd dbus 3618 0.0 0.0 21256 28 ? Ss 2010 0:00 dbus-daemon --system root 3649 0.2 0.4 563084 18796 ? S<sl 2010 179:03 mfsmount /mnt/mfs -o rw,mfsmaster=web1.ovs.local root 3702 0.0 0.0 3800 8 ? Ss 2010 0:00 /usr/sbin/acpid 68 3715 0.0 0.0 31312 816 ? Ss 2010 3:14 hald root 3716 0.0 0.0 21692 28 ? S 2010 0:00 hald-runner 68 3726 0.0 0.0 12324 8 ? S 2010 0:00 hald-addon-acpi: listening on acpid socket /var/run/acpid.socket 68 3730 0.0 0.0 12324 8 ? S 2010 0:00 hald-addon-keyboard: listening on /dev/input/event0 root 3773 0.0 0.0 62608 332 ? Ss 2010 0:00 /usr/sbin/sshd ganglia 3786 0.0 0.0 24704 988 ? Ss 2010 14:26 /usr/sbin/gmond root 3843 0.0 0.0 54144 300 ? Ss 2010 1:49 /usr/libexec/postfix/master postfix 3855 0.0 0.0 54860 1060 ? S 2010 0:22 qmgr -l -t fifo -u root 3877 0.0 0.0 74828 708 ? Ss 2010 1:15 crond root 3891 1.4 1.9 326960 77704 ? S<l 2010 896:59 mfschunkserver root 4122 0.0 0.0 18732 176 ? Ss 2010 0:10 /usr/sbin/atd root 4193 0.0 0.8 129180 35984 ? Ssl 2010 11:04 /usr/bin/ruby /usr/sbin/puppetd root 4223 0.0 0.0 18416 172 ? S 2010 0:10 /usr/sbin/smartd -q never root 4227 0.0 0.0 3792 8 tty1 Ss+ 2010 0:00 /sbin/mingetty tty1 root 4230 0.0 0.0 3792 8 tty2 Ss+ 2010 0:00 /sbin/mingetty tty2 root 4231 0.0 0.0 3792 8 tty3 Ss+ 2010 0:00 /sbin/mingetty tty3 root 4233 0.0 0.0 3792 8 tty4 Ss+ 2010 0:00 /sbin/mingetty tty4 root 4234 0.0 0.0 3792 8 tty5 Ss+ 2010 0:00 /sbin/mingetty tty5 root 4236 0.0 0.0 3792 8 tty6 Ss+ 2010 0:00 /sbin/mingetty tty6 root 5596 0.0 0.0 19368 20 ? Ss 2010 0:00 DarwinStreamingServer qtss 5597 0.8 0.9 166572 37408 ? Sl 2010 523:02 DarwinStreamingServer root 8714 0.0 0.0 0 0 ? S Jan31 0:33 [pdflush] root 9914 0.0 0.0 65612 968 pts/1 R+ 21:49 0:00 ps aux root 10765 0.0 0.0 76792 1080 ? Ss Jan24 0:58 SCREEN root 10766 0.0 0.0 66212 872 pts/3 Ss Jan24 0:00 /bin/bash root 11833 0.0 0.0 63852 1060 pts/3 S+ 17:17 0:00 /bin/sh ./launch.sh root 11834 437 42.9 4126884 1733348 pts/3 Sl+ 17:17 1190:50 /usr/bin/java -Xms128m -Xmx512m -XX:+UseConcMarkSweepGC -jar /JavaCore/JavaCore.jar root 13127 4.7 1.1 110564 46876 ? Ssl 17:18 12:55 /JavaCore/fetcher.bin root 19392 0.0 0.0 90108 3336 ? Rs 20:35 0:00 sshd: root@pts/1 root 19401 0.0 0.0 66216 1640 pts/1 Ss 20:35 0:00 -bash root 20567 0.0 0.0 90108 412 ? Ss Jan16 1:58 sshd: root@pts/0 root 20569 0.0 0.0 66084 912 pts/0 Ss Jan16 0:00 -bash root 21053 0.0 0.0 63856 28 ? S Jan30 0:00 /bin/sh /usr/bin/WowzaMediaServerd /usr/local/WowzaMediaServer/bin/setenv.sh /var/run/WowzaM root 21054 2.9 10.3 2252652 418468 ? Sl Jan30 314:25 java -Xmx1200M -server -Djava.net.preferIPv4Stack=true -Dcom.sun.management.jmxremote=true - root 21915 0.0 0.0 0 0 ? S Feb01 0:00 [pdflush] root 29996 0.0 0.0 76524 1004 pts/0 S+ 14:41 0:00 screen -x Any idea what could this be, or where I should look for more diagnostic information? Thanks.

    Read the article

  • applet does not load

    - by jcp
    We have a legacy program that was ported from Java 1.3 to Java 1.5. This application involves applets which worked fine before. After porting however, the applet would not load. However there are no errors or exceptions. The app would just try to load it forever. We tried to run it with Java 1.6 and poof! No problems whatsoever. Isn't Java 6 backwards compatible? So how come it would run in that version and not in 1.5? ==== Java Console log for Java 1.5.0_19 basic: Registered modality listener basic: Registered modality listener basic: Registered modality listener liveconnect: Invoking JS method: document liveconnect: Invoking JS method: document liveconnect: Invoking JS method: document liveconnect: Invoking JS method: URL liveconnect: Invoking JS method: URL liveconnect: Invoking JS method: URL basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=1 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=2 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Added progress listener: sun.plugin.util.GrayBoxPainter@b0bad7 basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Added progress listener: sun.plugin.util.GrayBoxPainter@ba9340 basic: Added progress listener: sun.plugin.util.GrayBoxPainter@1198891 basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 network: Connecting <something>.jar with proxy=HTTP @ proxy/<ip address> basic: Loading <something>.jar from cache basic: No certificate info, this is unsigned JAR file. Left START init() Left END init() Right START init() Control start() Waiting for Left Panel to load... Right START start() network: Connecting socket://<ip address>:14444 with proxy=DIRECT Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... my HostName : <ip address> Thread-19 Check : Thread-19 Check : Monitor : run : start Thread-20 Monitor : Monitor: run() start Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... the last message goes on forever... and now with the working version: ==== Java Console log for Java 1.6.0_15 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@1b000e7 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@12611a7 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@1807ca8 network: CleanupThread used 6 us network: CleanupThread used 5 us network: CleanupThread used 6 us cache: Skip blacklist check as cached value is ok. network: Cache entry found [url: <something>.jar, version: null] network: Connecting <something>.jar with proxy=HTTP @ proxy/<ip address> network: ResponseCode for <something>.jar : 304 network: Encoding for <something>.jar : null network: Disconnect connection to <something>.jar Reading certificates from 11 <something>.jar | <something>.idx network: No certificate info for unsigned JAR file: <something>.jar basic: Applet loaded. basic: Applet loaded. basic: Applet resized and added to parent container basic: Applet resized and added to parent container basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27768955 us, TotalTime: 28099230 us Right START init() basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27770563 us, TotalTime: 28100838 us Left START init() basic: Applet loaded. basic: Applet resized and added to parent container basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27779332 us, TotalTime: 28109607 us Left END init() basic: Applet initialized basic: Removed progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@12611a7 basic: Applet made visible And that's it. Still haven't figured out why it works with java6 and not java5. @valli: the object tag was used, not applet @thorbjorn: i tried that already... it just keeps saying loading applet... @aaron: how can i know what exception it is, if there really is one? and yes we have considered that its a java bug but i still havent found what that bug is. i have to submit a report tomorrow and i've scoured the net but came up with nothing as of yet... @all: thank you for your replies

    Read the article

  • o display an image

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • Using only alphanumeric characters(a-z) inside toCharArray

    - by Aaron
    Below you will find me using toCharArray in order to send a string to array. I then MOVE the value of the letter using a for statement... for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } However, when I use shiftCode to move the value such as... a shifted by -1; I get a symbol @. Is there a way to send the string to shiftCode or tell shiftCode to ONLY use letters? I need it to see my text, like "aaron", and when I use the for statement iterate through a-z only and ignore all symbols and numbers. I THINK it is as simple as... letter=codeWord.toCharArray(a,z); But trying different forms of that and googling it didn't give me any results. Perhaps it has to do with regex or something? Below you will find a complete copy of my program; it works exactly how I want it to do; but it iterates through letters and symbols. I also tried finding instructions online for toCharArray but if there exists any arguments I can't locate them. My program... import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Aaron L. Jones * CS219 * AaronJonesProg3 * * This program is designed to - * Work as a Ceasar Cipher */ /** * * Aaron Jones */ public class AaronJonesProg3 { static String codeWord; static int shiftCode; static int i; static char[] letter; /** * @param args the command line arguments */ public static void main(String[] args) throws IOException { // Instantiating that Buffer Class // We are going to use this to read data from the user; in buffer // For performance related reasons BufferedReader reader; // Building the reader variable here // Just a basic input buffer (Holds things for us) reader = new BufferedReader(new InputStreamReader(System.in)); // Java speaks to us here / We get it to query our user System.out.print("Please enter text to encrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); /**************************************************************** **************************************************************** ***************************************************************/ // Java speaks to us here / We get it to query our user System.out.print("Please enter text to decrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); } }

    Read the article

  • Injection of an EJB into a web java class under JBoss 7.1.1

    - by Dobbo
    I am trying to build a website using JBoss 7.1.1 and RESTeasy. I have managed to constructed and deploy and EAR with a both a WAR and an EJB-JAR contained within: voyager-app.ear META-INF/MANIFEST.MF META-INF/application.xml META-INF/jboss-app.xml lib/voyager-lib.jar voyager-adm.war voyager-ejb.jar voyager-web.war So far things are very simple. voyager-adm.war & voyager-lib.jar are empty (just the manifest file) but I know that I'm going to have code for them shortly. There is just one Stateful EJB - HarbourMasterBean (with just a local interface) and a few Database Entity Beans in the EJB jar file: voyager-ejb.jar META-INF/MANIFEST.MF META-INF/persistence.xml com/nutrastat/voyager/db/HarbourMasterBean.class com/nutrastat/voyager/db/HarbourMasterLocal.class com/nutrastat/voyager/db/PortEntity.class com/nutrastat/voyager/db/ShipEntity.class As far as I can tell the EJBs deploy correctly because the database units are created and the log shows that the publication of some HarbourMaster references: java:global/voyager-app/voyager-ejb/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:app/voyager-ejb/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:module/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:global/voyager-app/voyager-ejb/harbour-master java:app/voyager-ejb/harbour-master java:module/harbour-master The problem lies in getting the HarbourMaster EJB injected into my web bean. The reference to it is alway NULL no matter what I try. voyager-web.war META-INF/MANIFEST.MF WEB-INF/web.xml WEB-INF/classes/com/nutrastat/voyager/web/ WEB-INF/classes/com/nutrastat/voyager/web/Ships.class WEB-INF/classes/com/nutrastat/voyager/web/VoyagerApplication.class Ships.java: @Path("fleet") public class Ships { protected transient final Logger log; @EJB private HarbourMasterLocal harbourMaster; public Ships() { log = LoggerFactory.getLogger(getClass()); } @GET @Path("ships") @Produces({"text/plain"}) public String listShips() { if (log.isDebugEnabled()) log.debug("Harbour master value: " + harbourMaster); return "Harbour Master: " + harbourMaster; } } &lt;web-app xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd" version="3.0" &gt; <display-name>Voyager Web Application</display-name> <listener> <listener-class> org.jboss.resteasy.plugins.server.servlet.ResteasyBootstrap </listener-class> </listener> <servlet> <servlet-name>Resteasy</servlet-name> <servlet-class> org.jboss.resteasy.plugins.server.servlet.HttpServletDispatcher </servlet-class> <init-param> <param-name> javax.ws.rs.Application </param-name> <param-value> com.nutrastat.voyager.web.VoyagerApplication </param-value> </init-param> </servlet> <servlet-mapping> <servlet-name>Resteasy</servlet-name> <url-pattern>/*</url-pattern> </servlet-mapping> &lt;/web-app&gt; I have been searching the web for an answer and read a number of places, both on StackOverflow and elsewhere that suggests is can be done, and that the problems lies with configuration. But they post only snippets and I'm never sure if I'm doing things correctly. Many thanks for any help you can provide. Dobbo

    Read the article

  • Watching a variable for changes without polling.

    - by milkfilk
    I'm using a framework called Processing which is basically a Java applet. It has the ability to do key events because Applet can. You can also roll your own callbacks of sorts into the parent. I'm not doing that right now and maybe that's the solution. For now, I'm looking for a more POJO solution. So I wrote some examples to illustrate my question. Please ignore using key events on the command line (console). Certainly this would be a very clean solution but it's not possible on the command line and my actual app isn't a command line app. In fact, a key event would be a good solution for me but I'm trying to understand events and polling beyond just keyboard specific problems. Both these examples flip a boolean. When the boolean flips, I want to fire something once. I could wrap the boolean in an Object so if the Object changes, I could fire an event too. I just don't want to poll with an if() statement unnecessarily. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Example of checking a variable for changes. * Uses dumb if() and polls continuously. */ public class NotAvoidingPolling { public static void main(String[] args) { boolean typedA = false; String input = ""; System.out.println("Type 'a' please."); while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic if (input.equals("a")) { typedA = true; } else { typedA = false; } // problem: this is polling. if (typedA) System.out.println("Typed 'a'."); } } } Running this outputs: Type 'a' please. a Typed 'a'. On some forums people suggested using an Observer. And although this decouples the event handler from class being observed, I still have an if() on a forever loop. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; import java.util.Observable; import java.util.Observer; /* * Example of checking a variable for changes. * This uses an observer to decouple the handler feedback * out of the main() but still is polling. */ public class ObserverStillPolling { boolean typedA = false; public static void main(String[] args) { // this ObserverStillPolling o = new ObserverStillPolling(); final MyEvent myEvent = new MyEvent(o); final MyHandler myHandler = new MyHandler(); myEvent.addObserver(myHandler); // subscribe // watch for event forever Thread thread = new Thread(myEvent); thread.start(); System.out.println("Type 'a' please."); String input = ""; while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic // but it's decoupled now because there's no handler here. if (input.equals("a")) { o.typedA = true; } } } } class MyEvent extends Observable implements Runnable { // boolean typedA; ObserverStillPolling o; public MyEvent(ObserverStillPolling o) { this.o = o; } public void run() { // watch the main forever while (true) { // event fire if (this.o.typedA) { setChanged(); // in reality, you'd pass something more useful notifyObservers("You just typed 'a'."); // reset this.o.typedA = false; } } } } class MyHandler implements Observer { public void update(Observable obj, Object arg) { // handle event if (arg instanceof String) { System.out.println("We received:" + (String) arg); } } } Running this outputs: Type 'a' please. a We received:You just typed 'a'. I'd be ok if the if() was a NOOP on the CPU. But it's really comparing every pass. I see real CPU load. This is as bad as polling. I can maybe throttle it back with a sleep or compare the elapsed time since last update but this is not event driven. It's just less polling. So how can I do this smarter? How can I watch a POJO for changes without polling? In C# there seems to be something interesting called properties. I'm not a C# guy so maybe this isn't as magical as I think. private void SendPropertyChanging(string property) { if (this.PropertyChanging != null) { this.PropertyChanging(this, new PropertyChangingEventArgs(property)); } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do I prevent my form from freezing when it is loading an image from the web at the click of a button?

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • JSF tags not being rendered as HTML

    - by Toto
    I'm following the Java EE firstcup tutorial using Netbeans and Glassfish. When I execute the JSF web tier I've been instructed to code, the browser gets the same JSF markup coded in the .xhtml file, and the tags are not rendered as HTML tags. I know this by using the view source code in my browser. For example, for this code: <html xmlns="http://www.w3.org/1999/xhtml" xmlns:f="http://java.sun.com/jsf/core" xmlns:h="http://java.sun.com/jsf/html"> <h:head> <title>Page title here</title> </h:head> <h:body> <h2> <h:outputText value="#{bundle.WelcomeMessage}" /> </h2> </h:body> </html> The browser should get something like: <html ...> <head> <title>Page title here</title> </head> <body> <h2> the welcome message goes here </h2> </body> </html> Right? Well, my browser is getting jsf code (the first piece of code above) and not the html code (the second piece of code above). It seems to be a configuration problem in netbeans or glassfish but don't know what. Any ideas? This is my web.xml file: <?xml version="1.0" encoding="UTF-8"?> <web-app version="3.0" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd"> <context-param> <param-name>javax.faces.PROJECT_STAGE</param-name> <param-value>Development</param-value> </context-param> <servlet> <servlet-name>Faces Servlet</servlet-name> <servlet-class>javax.faces.webapp.FacesServlet</servlet-class> <load-on-startup>1</load-on-startup> </servlet> <servlet-mapping> <servlet-name>Faces Servlet</servlet-name> <url-pattern>/firstcup/*</url-pattern> </servlet-mapping> <session-config> <session-timeout> 30 </session-timeout> </session-config> <welcome-file-list> <welcome-file>greetings.xhtml</welcome-file> </welcome-file-list> </web-app> This is my faces-config.xml file: <?xml version='1.0' encoding='UTF-8'?> <!-- =========== FULL CONFIGURATION FILE ================================== --> <faces-config version="2.0" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-facesconfig_2_0.xsd"> <application> <resource-bundle> <base-name>firstcup.web.WebMessages</base-name> <var>bundle</var> </resource-bundle> <locale-config> <default-locale>en</default-locale> <supported-locale>es</supported-locale> </locale-config> </application> <navigation-rule> <from-view-id>/greetings.xhtml</from-view-id> <navigation-case> <from-outcome>success</from-outcome> <to-view-id>/response.xhtml</to-view-id> </navigation-case> </navigation-rule> </faces-config> Moreover: The url I'm entering in the browser is http://localhost:8081/firstcup/ but I've also tried: http://localhost:8081/firstcup/greetings.xhtml I've checked Glassfish logs and there's no information about not being able to load FacesServlet

    Read the article

< Previous Page | 608 609 610 611 612 613 614 615 616 617 618 619  | Next Page >