Search Results

Search found 15803 results on 633 pages for 'self join'.

Page 618/633 | < Previous Page | 614 615 616 617 618 619 620 621 622 623 624 625  | Next Page >

  • SharePoint logging to a list

    - by Norgean
    I recently worked in an environment with several servers. Locating the correct SharePoint log file for error messages, or development trace calls, is cumbersome. And once the solution hit the cloud, it got even worse, as we had no access to the log files at all. Obviously we are not the only ones with this problem, and the current trend seems to be to log to a list. This had become an off-hour project, so rather than do the sensible thing and find a ready-made solution, I decided to do it the hard way. So! Fire up Visual Studio, create yet another empty SharePoint solution, and start to think of some requirements. Easy on/offI want to be able to turn list-logging on and off.Easy loggingFor me, this means being able to use string.Format.Easy filteringLet's have the possibility to add some filtering columns; category and severity, where severity can be "verbose", "warning" or "error". Easy on/off Well, that's easy. Create a new web feature. Add an event receiver, and create the list on activation of the feature. Tear the list down on de-activation. I chose not to create a new content type; I did not feel that it would give me anything extra. I based the list on the generic list - I think a better choice would have been the announcement type. Approximately: public void CreateLog(SPWeb web)         {             var list = web.Lists.TryGetList(LogListName);             if (list == null)             {                 var listGuid = web.Lists.Add(LogListName, "Logging for the masses", SPListTemplateType.GenericList);                 list = web.Lists[listGuid];                 list.Title = LogListTitle;                 list.Update();                 list.Fields.Add(Category, SPFieldType.Text, false);                 var stringColl = new StringCollection();                 stringColl.AddRange(new[]{Error, Information, Verbose});                 list.Fields.Add(Severity, SPFieldType.Choice, true, false, stringColl);                 ModifyDefaultView(list);             }         }Should be self explanatory, but: only create the list if it does not already exist (d'oh). Best practice: create it with a Url-friendly name, and, if necessary, give it a better title. ...because otherwise you'll have to look for a list with a name like "Simple_x0020_Log". I've added a couple of fields; a field for category, and a 'severity'. Both to make it easier to find relevant log messages. Notice that I don't have to call list.Update() after adding the fields - this would cause a nasty error (something along the lines of "List locked by another user"). The function for deleting the log is exactly as onerous as you'd expect:         public void DeleteLog(SPWeb web)         {             var list = web.Lists.TryGetList(LogListTitle);             if (list != null)             {                 list.Delete();             }         } So! "All" that remains is to log. Also known as adding items to a list. Lots of different methods with different signatures end up calling the same function. For example, LogVerbose(web, message) calls LogVerbose(web, null, message) which again calls another method which calls: private static void Log(SPWeb web, string category, string severity, string textformat, params object[] texts)         {             if (web != null)             {                 var list = web.Lists.TryGetList(LogListTitle);                 if (list != null)                 {                     var item = list.AddItem(); // NOTE! NOT list.Items.Add… just don't, mkay?                     var text = string.Format(textformat, texts);                     if (text.Length > 255) // because the title field only holds so many chars. Sigh.                         text = text.Substring(0, 254);                     item[SPBuiltInFieldId.Title] = text;                     item[Degree] = severity;                     item[Category] = category;                     item.Update();                 }             } // omitted: Also log to SharePoint log.         } By adding a params parameter I can call it as if I was doing a Console.WriteLine: LogVerbose(web, "demo", "{0} {1}{2}", "hello", "world", '!'); Ok, that was a silly example, a better one might be: LogError(web, LogCategory, "Exception caught when updating {0}. exception: {1}", listItem.Title, ex); For performance reasons I use list.AddItem rather than list.Items.Add. For completeness' sake, let us include the "ModifyDefaultView" function that I deliberately skipped earlier.         private void ModifyDefaultView(SPList list)         {             // Add fields to default view             var defaultView = list.DefaultView;             var exists = defaultView.ViewFields.Cast<string>().Any(field => String.CompareOrdinal(field, Severity) == 0);               if (!exists)             {                 var field = list.Fields.GetFieldByInternalName(Severity);                 if (field != null)                     defaultView.ViewFields.Add(field);                 field = list.Fields.GetFieldByInternalName(Category);                 if (field != null)                     defaultView.ViewFields.Add(field);                 defaultView.Update();                   var sortDoc = new XmlDocument();                 sortDoc.LoadXml(string.Format("<Query>{0}</Query>", defaultView.Query));                 var orderBy = (XmlElement) sortDoc.SelectSingleNode("//OrderBy");                 if (orderBy != null && sortDoc.DocumentElement != null)                     sortDoc.DocumentElement.RemoveChild(orderBy);                 orderBy = sortDoc.CreateElement("OrderBy");                 sortDoc.DocumentElement.AppendChild(orderBy);                 field = list.Fields[SPBuiltInFieldId.Modified];                 var fieldRef = sortDoc.CreateElement("FieldRef");                 fieldRef.SetAttribute("Name", field.InternalName);                 fieldRef.SetAttribute("Ascending", "FALSE");                 orderBy.AppendChild(fieldRef);                   fieldRef = sortDoc.CreateElement("FieldRef");                 field = list.Fields[SPBuiltInFieldId.ID];                 fieldRef.SetAttribute("Name", field.InternalName);                 fieldRef.SetAttribute("Ascending", "FALSE");                 orderBy.AppendChild(fieldRef);                 defaultView.Query = sortDoc.DocumentElement.InnerXml;                 //defaultView.Query = "<OrderBy><FieldRef Name='Modified' Ascending='FALSE' /><FieldRef Name='ID' Ascending='FALSE' /></OrderBy>";                 defaultView.Update();             }         } First two lines are easy - see if the default view includes the "Severity" column. If it does - quit; our job here is done.Adding "severity" and "Category" to the view is not exactly rocket science. But then? Then we build the sort order query. Through XML. The lines are numerous, but boring. All to achieve the CAML query which is commented out. The major benefit of using the dom to build XML, is that you may get compile time errors for spelling mistakes. I say 'may', because although the compiler will not let you forget to close a tag, it will cheerfully let you spell "Name" as "Naem". Whichever you prefer, at the end of the day the view will sort by modified date and ID, both descending. I added the ID as there may be several items with the same time stamp. So! Simple logging to a list, with sensible a view, and with normal functionality for creating your own filterings. I should probably have added some more views in code, ready filtered for "only errors", "errors and warnings" etc. And it would be nice to block verbose logging completely, but I'm not happy with the alternatives. (yetanotherfeature or an admin page seem like overkill - perhaps just removing it as one of the choices, and not log if it isn't there?) Before you comment - yes, try-catches have been removed for clarity. There is nothing worse than having a logging function that breaks your site!

    Read the article

  • At times, you need to hire a professional.

    - by Phil Factor
    After months of increasingly demanding toil, the development team I belonged to was told that the project was to be canned and the whole team would be fired.  I’d been brought into the team as an expert in the data implications of a business re-engineering of a major financial institution. Nowadays, you’d call me a data architect, I suppose.  I’d spent a happy year being paid consultancy fees solving a succession of interesting problems until the point when the company lost is nerve, and closed the entire initiative. The IT industry was in one of its characteristic mood-swings downwards.  After the announcement, we met in the canteen. A few developers had scented the smell of death around the project already hand had been applying unsuccessfully for jobs. There was a sense of doom in the mass of dishevelled and bleary-eyed developers. After giving vent to anger and despair, talk turned to getting new employment. It was then that I perked up. I’m not an obvious choice to give advice on getting, or passing,  IT interviews. I reckon I’ve failed most of the job interviews I’ve ever attended. I once even failed an interview for a job I’d already been doing perfectly well for a year. The jobs I’ve got have mostly been from personal recommendation. Paradoxically though, from years as a manager trying to recruit good staff, I know a lot about what IT managers are looking for.  I gave an impassioned speech outlining the important factors in getting to an interview.  The most important thing, certainly in my time at work is the quality of the résumé or CV. I can’t even guess the huge number of CVs (résumés) I’ve read through, scanning for candidates worth interviewing.  Many IT Developers find it impossible to describe their  career succinctly on two sides of paper.  They leave chunks of their life out (were they in prison?), get immersed in detail, put in irrelevancies, describe what was going on at work rather than what they themselves did, exaggerate their importance, criticize their previous employers, aren’t  aware of the important aspects of a role to a potential employer, suffer from shyness and modesty,  and lack any sort of organized perspective of their work. There are many ways of failing to write a decent CV. Many developers suffer from the delusion that their worth can be recognized purely from the code that they write, and shy away from anything that seems like self-aggrandizement. No.  A resume must make a good impression, which means presenting the facts about yourself in a clear and positive way. You can’t do it yourself. Why not have your resume professionally written? A good professional CV Writer will know the qualities being looked for in a CV and interrogate you to winkle them out. Their job is to make order and sense out of a confused career, to summarize in one page a mass of detail that presents to any recruiter the information that’s wanted. To stand back and describe an accurate summary of your skills, and work-experiences dispassionately, without rancor, pity or modesty. You are no more capable of producing an objective documentation of your career than you are of taking your own appendix out.  My next recommendation was more controversial. This is to have a professional image overhaul, or makeover, followed by a professionally-taken photo portrait. I discovered this by accident. It is normal for IT professionals to face impossible deadlines and long working hours by looking more and more like something that had recently blocked a sink. Whilst working in IT, and in a state of personal dishevelment, I’d been offered the role in a high-powered amateur production of an old ex- Broadway show, purely for my singing voice. I was supposed to be the presentable star. When the production team saw me, the air was thick with tension and despair. I was dragged kicking and protesting through a succession of desperate grooming, scrubbing, dressing, dieting. I emerged feeling like “That jewelled mass of millinery, That oiled and curled Assyrian bull, Smelling of musk and of insolence.” (Tennyson Maud; A Monodrama (1855) Section v1 stanza 6) I was then photographed by a professional stage photographer.  When the photographs were delivered, I was amazed. It wasn’t me, but it looked somehow respectable, confident, trustworthy.   A while later, when the show had ended, I took the photos, and used them for work. They went with the CV to job applications. It did the trick better than I could ever imagine.  My views went down big with the developers. Old rivalries were put immediately to one side. We voted, with a show of hands, to devote our energies for the entire notice period to getting employable. We had a team sourcing the CV Writer,  a team organising the make-overs and photographer, and a third team arranging  mock interviews. A fourth team determined the best websites and agencies for recruitment, with the help of friends in the trade.  Because there were around thirty developers, we were in a good negotiating position.  Of the three CV Writers we found who lived locally, one proved exceptional. She was an ex-journalist with an eye to detail, and years of experience in manipulating language. We tried her skills out on a developer who seemed a hopeless case, and he was called to interview within a week.  I was surprised, too, how many companies were experts at image makeovers. Within the month, we all looked like those weird slick  people in the ‘Office-tagged’ stock photographs who stare keenly and interestedly at PowerPoint slides in sleek chromium-plated high-rise offices. The portraits we used still adorn the entries of many of my ex-colleagues in LinkedIn. After a months’ worth of mock interviews, and technical Q&A, our stutters, hesitations, evasions and periphrastic circumlocutions were all gone.  There is little more to relate. With the résumés or CVs, mugshots, and schooling in how to pass interviews, we’d all got new and better-paid jobs well  before our month’s notice was ended. Whilst normally, an IT team under the axe is a sad and depressed place to belong to, this wonderful group of people had proved the power of organized group action in turning the experience to advantage. It left us feeling slightly guilty that we were somehow cheating, but I guess we were merely leveling the playing-field.

    Read the article

  • Notes on implementing Visual Studio 2010 Navigate To

    - by cyberycon
    One of the many neat functions added to Visual Studio in VS 2010 was the Navigate To feature. You can find it by clicking Edit, Navigate To, or by using the keyboard shortcut Ctrl, (yes, that's control plus the comma key). This pops up the Navigate To dialog that looks like this: As you type, Navigate To starts searching through a number of different search providers for your term. The entries in the list change as you type, with most providers doing some kind of fuzzy or at least substring matching. If you have C#, C++ or Visual Basic projects in your solution, all symbols defined in those projects are searched. There's also a file search provider, which displays all matching filenames from projects in the current solution as well. And, if you have a Visual Studio package of your own, you can implement a provider too. Micro Focus (where I work) provide the Visual COBOL language inside Visual Studio (http://visualstudiogallery.msdn.microsoft.com/ef9bc810-c133-4581-9429-b01420a9ea40 ), and we wanted to provide this functionality too. This post provides some notes on the things I discovered mainly through trial and error, but also with some kind help from devs inside Microsoft. The expectation of Navigate To is that it searches across the whole solution, not just the current project. So in our case, we wanted to search for all COBOL symbols inside all of our Visual COBOL projects inside the solution. So first of all, here's the Microsoft documentation on Navigate To: http://msdn.microsoft.com/en-us/library/ee844862.aspx . It's the reference information on the Microsoft.VisualStudio.Language.NavigateTo.Interfaces Namespace, and it lists all the interfaces you will need to implement to create your own Navigate To provider. Navigate To uses Visual Studio's latest mechanism for integrating external functionality and services, Managed Extensibility Framework (MEF). MEF components don't require any registration with COM or any other registry entries to be found by Visual Studio. Visual Studio looks in several well-known locations for manifest files (extension.vsixmanifest). It then uses reflection to scan for MEF attributes on classes in the assembly to determine which functionality the assembly provides. MEF itself is actually part of the .NET framework, and you can learn more about it here: http://mef.codeplex.com/. To get started with Visual Studio and MEF you could do worse than look at some of the editor examples on the VSX page http://archive.msdn.microsoft.com/vsx . I've also written a small application to help with switching between development and production MEF assemblies, which you can find on Codeproject: http://www.codeproject.com/KB/miscctrl/MEF_Switch.aspx. The Navigate To interfaces Back to Navigate To, and summarizing the MSDN reference documentation, you need to implement the following interfaces: INavigateToItemProviderFactoryThis is Visual Studio's entry point to your Navigate To implementation, and you must decorate your implementation with the following MEF export attribute: [Export(typeof(INavigateToItemProviderFactory))]  INavigateToItemProvider Your INavigateToItemProviderFactory needs to return your implementation of INavigateToItemProvider. This class implements StartSearch() and StopSearch(). StartSearch() is the guts of your provider, and we'll come back to it in a minute. This object also needs to implement IDisposeable(). INavigateToItemDisplayFactory Your INavigateToItemProvider hands back NavigateToItems to the NavigateTo framework. But to give you good control over what appears in the NavigateTo dialog box, these items will be handed back to your INavigateToItemDisplayFactory, which must create objects implementing INavigateToItemDisplay  INavigateToItemDisplay Each of these objects represents one result in the Navigate To dialog box. As well as providing the description and name of the item, this object also has a NavigateTo() method that should be capable of displaying the item in an editor when invoked. Carrying out the search The lifecycle of your INavigateToItemProvider is the same as that of the Navigate To dialog. This dialog is modal, which makes your implementation a little easier because you know that the user can't be changing things in editors and the IDE while this dialog is up. But the Navigate To dialog DOES NOT run on the main UI thread of the IDE – so you need to be aware of that if you want to interact with editors or other parts of the IDE UI. When the user invokes the Navigate To dialog, your INavigateToItemProvider gets sent a TryCreateNavigateToItemProvider() message. Instantiate your INavigateToItemProvider and hand this back. The sequence diagram below shows what happens next. Your INavigateToItemProvider will get called with StartSearch(), and passed an INavigateToCallback. StartSearch() is an asynchronous request – you must return from this method as soon as possible, and conduct your search on a separate thread. For each match to the search term, instantiate a NavigateToItem object and send it to INavigateToCallback.AddItem(). But as the user types in the Search Terms field, NavigateTo will invoke your StartSearch() method repeatedly with the changing search term. When you receive the next StartSearch() message, you have to abandon your current search, and start a new one. You can't rely on receiving a StopSearch() message every time. Finally, when the Navigate To dialog box is closed by the user, you will get a Dispose() message – that's your cue to abandon any uncompleted searches, and dispose any resources you might be using as part of your search. While you conduct your search invoke INavigateToCallback.ReportProgress() occasionally to provide feedback about how close you are to completing the search. There does not appear to be any particular requirement to how often you invoke ReportProgress(), and you report your progress as the ratio of two integers. In my implementation I report progress in terms of the number of symbols I've searched over the total number of symbols in my dictionary, and send a progress report every 16 symbols. Displaying the Results The Navigate to framework invokes INavigateToItemDisplayProvider.CreateItemDisplay() once for each result you passed to the INavigateToCallback. CreateItemDisplay() is passed the NavigateToItem you handed to the callback, and must return an INavigateToItemDisplay object. NavigateToItem is a sealed class which has a few properties, including the name of the symbol. It also has a Tag property, of type object. This enables you to stash away all the information you will need to create your INavigateToItemDisplay, which must implement an INavigateTo() method to display a symbol in an editor IDE when the user double-clicks an entry in the Navigate To dialog box. Since the tag is of type object, it is up to you, the implementor, to decide what kind of object you store in here, and how it enables the retrieval of other information which is not included in the NavigateToItem properties. Some of the INavigateToItemDisplay properties are self-explanatory, but a couple of them are less obvious: Additional informationThe string you return here is displayed inside brackets on the same line as the Name property. In English locales, Visual Studio includes the preposition "of". If you look at the first line in the Navigate To screenshot at the top of this article, Book_WebRole.Default is the additional information for textBookAuthor, and is the namespace qualified type name the symbol appears in. For procedural COBOL code we display the Program Id as the additional information DescriptionItemsYou can use this property to return any textual description you want about the item currently selected. You return a collection of DescriptionItem objects, each of which has a category and description collection of DescriptionRun objects. A DescriptionRun enables you to specify some text, and optional formatting, so you have some control over the appearance of the displayed text. The DescriptionItems property is displayed at the bottom of the Navigate To dialog box, with the Categories on the left and the Descriptions on the right. The Visual COBOL implementation uses it to display more information about the location of an item, making it easier for the user to know disambiguate duplicate names (something there can be a lot of in large COBOL applications). Summary I hope this article is useful for anyone implementing Navigate To. It is a fantastic navigation feature that Microsoft have added to Visual Studio, but at the moment there still don't seem to be any examples on how to implement it, and the reference information on MSDN is a little brief for anyone attempting an implementation.

    Read the article

  • SOA Implementation Challenges

    Why do companies think that if they put up a web service that they are doing Service-Oriented Architecture (SOA)? Unfortunately, the IT and business world love to run on the latest hype or buzz words of which very few even understand the meaning. One of the largest issues companies have today as they consider going down the path of SOA, is the lack of knowledge regarding the architectural style and the over usage of the term SOA. So how do we solve this issue?I am sure most of you are thinking by now that you know what SOA is because you developed a few web services.  Isn’t that SOA, right? No, that is not SOA, but instead Just Another Web Service (JAWS). For us to better understand what SOA is let’s look at a few definitions.Douglas K. Bary defines service-oriented architecture as a collection of services. These services are enabled to communicate with each other in order to pass data or coordinating some activity with other services.If you look at this definition closely you will notice that Bary states that services communicate with each other. Let us compare this statement with my first statement regarding companies that claim to be doing SOA when they have just a collection of web services. In order for these web services to for an SOA application they need to be interdependent on one another forming some sort of architectural hierarchy. Just because a company has a few web services does not mean that they are all interconnected.SearchSOA from TechTarget.com states that SOA defines how two computing entities work collectively to enable one entity to perform a unit of work on behalf of another. Once again, just because a company has a few web services does not guarantee that they are even working together let alone if they are performing work for each other.SearchSOA also points out service interactions should be self-contained and loosely-coupled so that all interactions operate independent of each other.Of all the definitions regarding SOA Thomas Erl’s seems to shed the most light on this concept. He states that “SOA establishes an architectural model that aims to enhance the efficiency, agility, and productivity of an enterprise by positioning services as the primary means through which solution logic is represented in support of the realization of the strategic goals associated with service-oriented computing.” (Erl, 2011) Once again this definition proves that a collection of web services does not mean that a company is doing SOA. However, it does mean that a company has a collection of web services, and that is it.In order for a company to start to go down the path of SOA, they must take  a hard look at their existing business process while abstracting away any technology so that they can define what is they really want to accomplish. Once a company has done this, they can begin to factor out common sub business process like credit card process, user authentication or system notifications in to small components that can be built independent of each other and then reassembled to form new and dynamic services that are loosely coupled and agile in that they can change as a business grows.Another key pitfall of companies doing SOA is the fact that they let vendors drive their architecture. Why do companies do this? Vendors’ do not hold your company’s success as their top priority; in fact they hold their own success as their top priority by selling you as much stuff as you are willing to buy. In my experience companies tend to strive for the maximum amount of benefits with a minimal amount of cost. Does anyone else see any conflicts between this and the driving force behind vendors.Mike Kavis recommends in an article written in CIO.com that companies need to figure out what they need before they talk to a vendor or at least have some idea of what they need. It is important to thoroughly evaluate each vendor and watch them perform a live demo of their system so that you as the company fully understand what kind of product or service the vendor is actually offering. In addition, do research on each vendor that you are considering, check out blog posts, online reviews, and any information you can find on the vendor through various search engines.Finally he recommends companies to verify any recommendations supplied by a vendor. From personal experience this is very important. I can remember when the company I worked for purchased a $200,000 add-on to their phone system that never actually worked as it was intended. In fact, just after my departure from the company started the process of attempting to get their money back from the vendor. This potentially could have been avoided if the company had done the research before selecting this vendor to ensure that their product and vendor would live up to their claims. I know that some SOA vendor offer free training regarding SOA because they know that there are a lot of misconceptions about the topic. Superficially this is a great thing for companies to take part in especially if the company is starting to implement SOA architecture and are still unsure about some topics or are looking for some guidance regarding the topic. However beware that some companies will focus on their product line only regarding the training. As an example, InfoWorld.com claims that companies providing deep seminars disguised as training, focusing more about ESBs and SOA governance technology, and less on how to approach and solve the architectural issues of the attendees.In short, it is important to remember that we as software professionals are responsible for guiding a business’s technology sections should be well informed and fully understand any new concepts that may be considered for implementation. As I have demonstrated already a company that has a few web services does not mean that they are doing SOA.  Additionally, we must not let the new buzz word of the day drive our technology, but instead our technology decisions should be driven from research and proven experience. Finally, it is important to rely on vendors when necessary, however, always take what they say with a grain of salt while cross checking any claims that they may make because we have to live with the aftermath of a system after the vendors are gone.   References: Barry, D. K. (2011). Service-oriented architecture (SOA) definition. Retrieved 12 12, 2011, from Service-Architecture.com: http://www.service-architecture.com/web-services/articles/service-oriented_architecture_soa_definition.html Connell, B. (2003, 9). service-oriented architecture (SOA). Retrieved 12 12, 2011, from SearchSOA: http://searchsoa.techtarget.com/definition/service-oriented-architecture Erl, T. (2011, 12 12). Service-Oriented Architecture. Retrieved 12 12, 2011, from WhatIsSOA: http://www.whatissoa.com/p10.php InfoWorld. (2008, 6 1). Should you get your SOA knowledge from SOA vendors? . Retrieved 12 12, 2011, from InfoWorld.com: http://www.infoworld.com/d/architecture/should-you-get-your-soa-knowledge-soa-vendors-453 Kavis, M. (2008, 6 18). Top 10 Reasons Why People are Making SOA Fail. Retrieved 12 13, 2011, from CIO.com: http://www.cio.com/article/438413/Top_10_Reasons_Why_People_are_Making_SOA_Fail?page=5&taxonomyId=3016  

    Read the article

  • FOUR questions to ask if you are implementing DATABASE-AS-A-SERVICE

    - by Sudip Datta
    During my ongoing tenure at Oracle, I have met all types of DBAs. Happy DBAs, unhappy DBAs, proud DBAs, risk-loving DBAs, cautious DBAs. These days, as Database-as-a-Service (DBaaS) becomes more mainstream, I find some complacent DBAs who are basking in their achievement of having implemented DBaaS. Some others, however, are not that happy. They grudgingly complain that they did not have much of a say in the implementation, they simply had to follow what their cloud architects (mostly infrastructure admins) offered them. In most cases it would be a database wrapped inside a VM that would be labeled as “Database as a Service”. In other cases, it would be existing brute-force automation simply exposed in a portal. As much as I think that there is more to DBaaS than those approaches and often get tempted to propose Enterprise Manager 12c, I try to be objective. Neither do I want to dampen the spirit of the happy ones, nor do I want to stoke the pain of the unhappy ones. As I mentioned in my previous post, I don’t deny vanilla automation could be useful. I like virtualization too for what it has helped us accomplish in terms of resource management, but we need to scrutinize its merit on a case-by-case basis and apply it meaningfully. For DBAs who either claim to have implemented DBaaS or are planning to do so, I simply want to provide four key questions to ponder about: 1. Does it make life easier for your end users? Database-as-a-Service can have several types of end users. Junior DBAs, QA Engineers, Developers- each having their own skillset. The objective of DBaaS is to make their life simple, so that they can focus on their core responsibilities without having to worry about additional stuff. For example, if you are a Developer using Oracle Application Express (APEX), you want to deal with schema, objects and PL/SQL code and not with datafiles or listener configuration. If you are a QA Engineer needing database copies for functional testing, you do not want to deal with underlying operating system patching and compliance issues. The question to ask, therefore, is, whether DBaaS makes life easier for those users. It is often convenient to give them VM shells to deal with a la Amazon EC2 IaaS, but is that what they really want? Is it a productive use of a developer's time if he needs to apply RPM errata to his Linux operating system. Asking him to keep the underlying operating system current is like making a guest responsible for a restaurant's decor. 2. Does it make life easier for your administrators? Cloud, in general, is supposed to free administrators from attending to mundane tasks like provisioning services for every single end user request. It is supposed to enable a readily consumable platform and enforce standardization in the process. For example, if a Service Catalog exposes DBaaS of specific database versions and configurations, it, by its very nature, enforces certain discipline and standardization within the IT environment. What if, instead of specific database configurations, cloud allowed each end user to create databases of their liking resulting in hundreds of version and patch levels and thousands of individual databases. Therefore the right question to ask is whether the unwanted consequence of DBaaS is OS and database sprawl. And if so, who is responsible for tracking them, backing them up, administering them? Studies have shown that these administrative overheads increase exponentially with new targets, and it could result in a management nightmare. That leads us to our next question. 3. Does it satisfy your Security Officers and Compliance Auditors? Compliance Auditors need to know who did what and when. They also want the cloud platform to be secure, so that end users have little freedom in tampering with it. Dealing with VM sprawl is not the easiest of challenges, let alone dealing with them as they keep getting reconfigured and moved around. This leads to the proverbial needle in the haystack problem, and all it needs is one needle to cause a serious compliance issue in the enterprise. Bottomline is, flexibility and agility should not come at the expense of compliance and it is very important to get the balance right. Can we have security and isolation without creating compliance challenges? Instead of a ‘one size fits all approach’ i.e. OS level isolation, can we think smartly about database isolation or schema based isolation? This is where the appropriate resource modeling needs to be applied. The usual systems management vendors out there with heterogeneous common-denominator approach have compromised on these semantics. If you follow Enterprise Manager’s DBaaS solution, you will see that we have considered different models, not precluding virtualization, for different customer use cases. The judgment to use virtual assemblies versus databases on physical RAC versus Schema-as-a-Service in a single database, should be governed by the need of the applications and not by putting compliance considerations in the backburner. 4. Does it satisfy your CIO? Finally, does it satisfy your higher ups? As the sponsor of cloud initiative, the CIO is expected to lead an IT transformation project, not merely a run-of-the-mill IT operations. Simply virtualizing server resources and delivering them through self-service is a good start, but hardly transformational. CIOs may appreciate the instant benefit from server consolidation, but studies have revealed that the ROI from consolidation would flatten out at 20-25%. The question would be: what next? As we go higher up in the stack, the need to virtualize, segregate and optimize shifts to those layers that are more palpable to the business users. As Sushil Kumar noted in his blog post, " the most important thing to note here is the enterprise private cloud is not just an IT project, rather it is a business initiative to create an IT setup that is more aligned with the needs of today's dynamic and highly competitive business environment." Business users could not care less about infrastructure consolidation or virtualization - they care about business agility and service level assurance. Last but not the least, lot of CIOs get miffed if we ask them to throw away their existing hardware investments for implementing DBaaS. In Oracle, we always emphasize on freedom of choosing a platform; hence Enterprise Manager’s DBaaS solution is platform neutral. It can work on any Operating System (that the agent is certified on) Oracle’s hardware as well as 3rd party hardware. As a parting note, I urge you to remember these 4 questions. Remember that your satisfaction as an implementer lies in the satisfaction of others.

    Read the article

  • Hibernate unable to instantiate default tuplizer - cannot find getter

    - by ZeldaPinwheel
    I'm trying to use Hibernate to persist a class that looks like this: public class Item implements Serializable, Comparable<Item> { // Item id private Integer id; // Description of item in inventory private String description; // Number of items described by this inventory item private int count; //Category item belongs to private String category; // Date item was purchased private GregorianCalendar purchaseDate; public Item() { } public Integer getId() { return id; } public void setId(Integer id) { this.id = id; } public String getDescription() { return description; } public void setDescription(String description) { this.description = description; } public int getCount() { return count; } public void setCount(int count) { this.count = count; } public String getCategory() { return category; } public void setCategory(String category) { this.category = category; } public GregorianCalendar getPurchaseDate() { return purchaseDate; } public void setPurchasedate(GregorianCalendar purchaseDate) { this.purchaseDate = purchaseDate; } My Hibernate mapping file contains the following: <property name="puchaseDate" type="java.util.GregorianCalendar"> <column name="purchase_date"></column> </property> When I try to run, I get error messages indicating there is no getter function for the purchaseDate attribute: 577 [main] INFO org.hibernate.connection.DriverManagerConnectionProvider - Using Hibernate built-in connection pool (not for production use!) 577 [main] INFO org.hibernate.connection.DriverManagerConnectionProvider - Hibernate connection pool size: 20 577 [main] INFO org.hibernate.connection.DriverManagerConnectionProvider - autocommit mode: false 592 [main] INFO org.hibernate.connection.DriverManagerConnectionProvider - using driver: com.mysql.jdbc.Driver at URL: jdbc:mysql://localhost:3306/home_inventory 592 [main] INFO org.hibernate.connection.DriverManagerConnectionProvider - connection properties: {user=root, password=****} 1078 [main] INFO org.hibernate.cfg.SettingsFactory - RDBMS: MySQL, version: 5.1.45 1078 [main] INFO org.hibernate.cfg.SettingsFactory - JDBC driver: MySQL-AB JDBC Driver, version: mysql-connector-java-5.1.12 ( Revision: ${bzr.revision-id} ) 1103 [main] INFO org.hibernate.dialect.Dialect - Using dialect: org.hibernate.dialect.MySQLDialect 1107 [main] INFO org.hibernate.engine.jdbc.JdbcSupportLoader - Disabling contextual LOB creation as JDBC driver reported JDBC version [3] less than 4 1109 [main] INFO org.hibernate.transaction.TransactionFactoryFactory - Using default transaction strategy (direct JDBC transactions) 1110 [main] INFO org.hibernate.transaction.TransactionManagerLookupFactory - No TransactionManagerLookup configured (in JTA environment, use of read-write or transactional second-level cache is not recommended) 1110 [main] INFO org.hibernate.cfg.SettingsFactory - Automatic flush during beforeCompletion(): disabled 1110 [main] INFO org.hibernate.cfg.SettingsFactory - Automatic session close at end of transaction: disabled 1110 [main] INFO org.hibernate.cfg.SettingsFactory - JDBC batch size: 15 1110 [main] INFO org.hibernate.cfg.SettingsFactory - JDBC batch updates for versioned data: disabled 1111 [main] INFO org.hibernate.cfg.SettingsFactory - Scrollable result sets: enabled 1111 [main] INFO org.hibernate.cfg.SettingsFactory - JDBC3 getGeneratedKeys(): enabled 1111 [main] INFO org.hibernate.cfg.SettingsFactory - Connection release mode: auto 1111 [main] INFO org.hibernate.cfg.SettingsFactory - Maximum outer join fetch depth: 2 1111 [main] INFO org.hibernate.cfg.SettingsFactory - Default batch fetch size: 1 1111 [main] INFO org.hibernate.cfg.SettingsFactory - Generate SQL with comments: disabled 1111 [main] INFO org.hibernate.cfg.SettingsFactory - Order SQL updates by primary key: disabled 1111 [main] INFO org.hibernate.cfg.SettingsFactory - Order SQL inserts for batching: disabled 1112 [main] INFO org.hibernate.cfg.SettingsFactory - Query translator: org.hibernate.hql.ast.ASTQueryTranslatorFactory 1113 [main] INFO org.hibernate.hql.ast.ASTQueryTranslatorFactory - Using ASTQueryTranslatorFactory 1113 [main] INFO org.hibernate.cfg.SettingsFactory - Query language substitutions: {} 1113 [main] INFO org.hibernate.cfg.SettingsFactory - JPA-QL strict compliance: disabled 1113 [main] INFO org.hibernate.cfg.SettingsFactory - Second-level cache: enabled 1113 [main] INFO org.hibernate.cfg.SettingsFactory - Query cache: disabled 1113 [main] INFO org.hibernate.cfg.SettingsFactory - Cache region factory : org.hibernate.cache.impl.NoCachingRegionFactory 1113 [main] INFO org.hibernate.cfg.SettingsFactory - Optimize cache for minimal puts: disabled 1114 [main] INFO org.hibernate.cfg.SettingsFactory - Structured second-level cache entries: disabled 1117 [main] INFO org.hibernate.cfg.SettingsFactory - Echoing all SQL to stdout 1118 [main] INFO org.hibernate.cfg.SettingsFactory - Statistics: disabled 1118 [main] INFO org.hibernate.cfg.SettingsFactory - Deleted entity synthetic identifier rollback: disabled 1118 [main] INFO org.hibernate.cfg.SettingsFactory - Default entity-mode: pojo 1118 [main] INFO org.hibernate.cfg.SettingsFactory - Named query checking : enabled 1118 [main] INFO org.hibernate.cfg.SettingsFactory - Check Nullability in Core (should be disabled when Bean Validation is on): enabled 1151 [main] INFO org.hibernate.impl.SessionFactoryImpl - building session factory org.hibernate.HibernateException: Unable to instantiate default tuplizer [org.hibernate.tuple.entity.PojoEntityTuplizer] at org.hibernate.tuple.entity.EntityTuplizerFactory.constructTuplizer(EntityTuplizerFactory.java:110) at org.hibernate.tuple.entity.EntityTuplizerFactory.constructDefaultTuplizer(EntityTuplizerFactory.java:135) at org.hibernate.tuple.entity.EntityEntityModeToTuplizerMapping.<init>(EntityEntityModeToTuplizerMapping.java:80) at org.hibernate.tuple.entity.EntityMetamodel.<init>(EntityMetamodel.java:323) at org.hibernate.persister.entity.AbstractEntityPersister.<init>(AbstractEntityPersister.java:475) at org.hibernate.persister.entity.SingleTableEntityPersister.<init>(SingleTableEntityPersister.java:133) at org.hibernate.persister.PersisterFactory.createClassPersister(PersisterFactory.java:84) at org.hibernate.impl.SessionFactoryImpl.<init>(SessionFactoryImpl.java:295) at org.hibernate.cfg.Configuration.buildSessionFactory(Configuration.java:1385) at service.HibernateSessionFactory.currentSession(HibernateSessionFactory.java:53) at service.ItemSvcHibImpl.generateReport(ItemSvcHibImpl.java:78) at service.test.ItemSvcTest.testGenerateReport(ItemSvcTest.java:226) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at junit.framework.TestCase.runTest(TestCase.java:164) at junit.framework.TestCase.runBare(TestCase.java:130) at junit.framework.TestResult$1.protect(TestResult.java:106) at junit.framework.TestResult.runProtected(TestResult.java:124) at junit.framework.TestResult.run(TestResult.java:109) at junit.framework.TestCase.run(TestCase.java:120) at junit.framework.TestSuite.runTest(TestSuite.java:230) at junit.framework.TestSuite.run(TestSuite.java:225) at org.eclipse.jdt.internal.junit.runner.junit3.JUnit3TestReference.run(JUnit3TestReference.java:130) at org.eclipse.jdt.internal.junit.runner.TestExecution.run(TestExecution.java:38) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:467) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:683) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.run(RemoteTestRunner.java:390) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.main(RemoteTestRunner.java:197) Caused by: java.lang.reflect.InvocationTargetException at sun.reflect.NativeConstructorAccessorImpl.newInstance0(Native Method) at sun.reflect.NativeConstructorAccessorImpl.newInstance(NativeConstructorAccessorImpl.java:39) at sun.reflect.DelegatingConstructorAccessorImpl.newInstance(DelegatingConstructorAccessorImpl.java:27) at java.lang.reflect.Constructor.newInstance(Constructor.java:513) at org.hibernate.tuple.entity.EntityTuplizerFactory.constructTuplizer(EntityTuplizerFactory.java:107) ... 29 more Caused by: org.hibernate.PropertyNotFoundException: Could not find a getter for puchaseDate in class domain.Item at org.hibernate.property.BasicPropertyAccessor.createGetter(BasicPropertyAccessor.java:328) at org.hibernate.property.BasicPropertyAccessor.getGetter(BasicPropertyAccessor.java:321) at org.hibernate.mapping.Property.getGetter(Property.java:304) at org.hibernate.tuple.entity.PojoEntityTuplizer.buildPropertyGetter(PojoEntityTuplizer.java:299) at org.hibernate.tuple.entity.AbstractEntityTuplizer.<init>(AbstractEntityTuplizer.java:158) at org.hibernate.tuple.entity.PojoEntityTuplizer.<init>(PojoEntityTuplizer.java:77) ... 34 more I'm new to Hibernate, so I don't know all the ins and outs, but I do have the getter and setter for the purchaseDate attribute. I don't know what I'm missing here - does anyone else? Thanks!

    Read the article

  • HttpClient POST fails to submit the form

    - by Jayomat
    Hi, I'm writing an app to check for the bus timetable's. Therefor I need to post some data to a html page, submit it, and parse the resulting page with htmlparser. Though it may be asked a lot, can some one help me identify if 1) this page does support post/get (I think it does) 2) which fields I need to use? 3) How to make the actual request? this is my code so far: String url = "http://busspur02.aseag.de/bs.exe?Cmd=RV&Karten=true&DatumT=30&DatumM=4&DatumJ=2010&ZeitH=&ZeitM=&Suchen=%28S%29uchen&GT0=&HT0=&GT1=&HT1="; String charset = "CP1252"; System.out.println("startFrom: "+start_from); System.out.println("goTo: "+destination); //String tag.v List<NameValuePair> params = new ArrayList<NameValuePair>(); params.add(new BasicNameValuePair("HTO", start_from)); params.add(new BasicNameValuePair("HT1", destination)); params.add(new BasicNameValuePair("GTO", "Aachen")); params.add(new BasicNameValuePair("GT1", "Aachen")); params.add(new BasicNameValuePair("DatumT", day)); params.add(new BasicNameValuePair("DatumM", month)); params.add(new BasicNameValuePair("DatumJ", year)); params.add(new BasicNameValuePair("ZeitH", hour)); params.add(new BasicNameValuePair("ZeitM", min)); UrlEncodedFormEntity query = new UrlEncodedFormEntity(params, charset); HttpPost post = new HttpPost(url); post.setEntity(query); InputStream response = new DefaultHttpClient().execute(post).getEntity().getContent(); // Now do your thing with the facebook response. String source = readText(response,"CP1252"); Log.d(TAG_AVV,response.toString()); System.out.println("STREAM "+source); One person also gave me a hint to use firebug to read what's going on at the page, but I don't really understand what to look for, or more precisely, how to use the provided information. I also find it confusing, for example, that when I enter the data by hand, the url says, for example, "....HTO=Kaiserplatz&...", but in Firebug, the same Kaiserplatz is connected to a different field, in this case: \<\td class="Start3" Kaiserplatz <\/td (I inserted \ to make it visible) The last line in my code prints the html page, but without having send a request.. it's printed as if there was no input at all... My app is almost done, I hope someone can help me out to finish it! thanks in advance EDIT: this is what the s.o.p returns: (At some point there actually is some input, but only the destination ???) 04-30 03:15:43.524: INFO/System.out(3303): STREAM <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN"> 04-30 03:15:43.524: INFO/System.out(3303): <html> 04-30 03:15:43.524: INFO/System.out(3303): <head> 04-30 03:15:43.545: INFO/System.out(3303): <title>Busspur online</title> 04-30 03:15:43.554: INFO/System.out(3303): <base href="http://busspur02.aseag.de"> 04-30 03:15:43.554: INFO/System.out(3303): <meta name="description" content="Busspur im Internet"> 04-30 03:15:43.554: INFO/System.out(3303): <meta name="author" content="Dr. Manfred Enning"> 04-30 03:15:43.554: INFO/System.out(3303): <meta name="AUTH_TYPE" content="Basic"> 04-30 03:15:43.574: INFO/System.out(3303): <meta HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=windows-1252"> 04-30 03:15:43.574: INFO/System.out(3303): <meta HTTP-EQUIV="Content-Language" CONTENT="de"> 04-30 03:15:43.574: INFO/System.out(3303): <link rel=stylesheet type="text/css" href="busspur.css"> 04-30 03:15:43.574: INFO/System.out(3303): </head> 04-30 03:15:43.574: INFO/System.out(3303): 04-30 03:15:43.574: INFO/System.out(3303): <body> 04-30 03:15:43.574: INFO/System.out(3303): <table border="0" cellspacing="0" cellpadding="0" width="100%"> 04-30 03:15:43.574: INFO/System.out(3303): <tr> 04-30 03:15:43.584: INFO/System.out(3303): <td align="left" width="25%"><small>Version: 6.8.1.9s2<br>Datenstand: 13.04.2010 04-30 03:15:43.584: INFO/System.out(3303): 04-30 03:15:43.584: INFO/System.out(3303): <br>12.04.2010 - 12.06.2010 04-30 03:15:43.584: INFO/System.out(3303): <br>1663 04-30 03:15:43.584: INFO/System.out(3303): 3D3B9</small> 04-30 03:15:43.584: INFO/System.out(3303): </td> 04-30 03:15:43.584: INFO/System.out(3303): 04-30 03:15:43.584: INFO/System.out(3303): <td align="center" width="50%"> 04-30 03:15:43.584: INFO/System.out(3303): <a href="/bs.exe/SL?Sprache=Nederlands&amp;SID=3D3B9"><img src="http://www.busspur.de/logos/nederlands.gif" alt="Nederlands" border="0" Width="32" Height="22"></a><a href="/bs.exe/SL?Sprache=English&amp;SID=3D3B9"><img src="http://www.busspur.de/logos/english.gif" alt="English" border="0" Width="32" Height="22"></a><a href="/bs.exe/SL?Sprache=Francais&amp;SID=3D3B9"><img src="http://www.busspur.de/logos/francais.gif" alt="Francais" border="0" Width="32" Height="22"></a> 04-30 03:15:43.584: INFO/System.out(3303): </td> 04-30 03:15:43.584: INFO/System.out(3303): 04-30 03:15:43.594: INFO/System.out(3303): <td align="right" width="25%"> 04-30 03:15:43.594: INFO/System.out(3303): <a href="http://www.avv.de/"><img src="/logos/avvlogo.gif" border="0" alt="AVV"></a> 04-30 03:15:43.594: INFO/System.out(3303): </td> 04-30 03:15:43.594: INFO/System.out(3303): </tr> 04-30 03:15:43.594: INFO/System.out(3303): </table> 04-30 03:15:43.594: INFO/System.out(3303): 04-30 03:15:43.594: INFO/System.out(3303): <!-- Kopfbereich (automatisch erzeugt) --> 04-30 03:15:43.594: INFO/System.out(3303): <div align="center"> 04-30 03:15:43.594: INFO/System.out(3303): 04-30 03:15:43.604: INFO/System.out(3303): <H2>Busspur-Online <i>Verbindungsabfrage</i></H2> 04-30 03:15:43.604: INFO/System.out(3303): </div> 04-30 03:15:43.604: INFO/System.out(3303): <!-- Ende Kopfbereich --> 04-30 03:15:43.604: INFO/System.out(3303): 04-30 03:15:43.604: INFO/System.out(3303): <!-- Ausgabebereich (automatisch erzeugt) --> 04-30 03:15:43.604: INFO/System.out(3303): <div align="center"> 04-30 03:15:43.614: INFO/System.out(3303): <p></p> 04-30 03:15:43.614: INFO/System.out(3303): <p></p> 04-30 03:15:43.614: INFO/System.out(3303): 04-30 03:15:43.614: INFO/System.out(3303): 04-30 03:15:43.624: INFO/System.out(3303): </div> 04-30 03:15:43.624: INFO/System.out(3303): <!-- Ende Ausgabebereich --> 04-30 03:15:43.634: INFO/System.out(3303): 04-30 03:15:43.634: INFO/System.out(3303): <!-- Fussnotenbereich (automatisch erzeugt) --> 04-30 03:15:43.634: INFO/System.out(3303): <div align="left"> 04-30 03:15:43.634: INFO/System.out(3303): 04-30 03:15:43.634: INFO/System.out(3303): 04-30 03:15:43.634: INFO/System.out(3303): </div> 04-30 03:15:43.634: INFO/System.out(3303): <!-- Ende Fussnotenbereich --> 04-30 03:15:43.634: INFO/System.out(3303): 04-30 03:15:43.634: INFO/System.out(3303): <!-- Nachschlageliste (automatisch erzeugt) --> 04-30 03:15:43.634: INFO/System.out(3303): <div align="center"> 04-30 03:15:43.644: INFO/System.out(3303): 04-30 03:15:43.644: INFO/System.out(3303): </div> 04-30 03:15:43.644: INFO/System.out(3303): <!-- Ende Nachschlageliste --> 04-30 03:15:43.644: INFO/System.out(3303): 04-30 03:15:43.644: INFO/System.out(3303): 04-30 03:15:43.644: INFO/System.out(3303): <!-- Eingabeformular --> 04-30 03:15:43.644: INFO/System.out(3303): 04-30 03:15:43.644: INFO/System.out(3303): 04-30 03:15:43.644: INFO/System.out(3303): <!-- Eingabeformular --> 04-30 03:15:43.644: INFO/System.out(3303): <form name="Maske" action="/bs.exe" method="get"> 04-30 03:15:43.644: INFO/System.out(3303): 04-30 03:15:43.644: INFO/System.out(3303): <input type="hidden" name="SID" value="3D3B9"> 04-30 03:15:43.644: INFO/System.out(3303): <input type="hidden" name="ScreenX" value=""> 04-30 03:15:43.654: INFO/System.out(3303): <input type="hidden" name="ScreenY" value=""> 04-30 03:15:43.654: INFO/System.out(3303): <input type="hidden" class="hiddenForm" name="CMD" value="CR" /> 04-30 03:15:43.654: INFO/System.out(3303): 04-30 03:15:43.654: INFO/System.out(3303): 04-30 03:15:43.654: INFO/System.out(3303): <input TYPE="Submit" name="Suchen" value="S" tabindex="20" style="visibility:hidden"> 04-30 03:15:43.654: INFO/System.out(3303): 04-30 03:15:43.654: INFO/System.out(3303): <table align="center" border="0" cellspacing="0" cellpadding="2"> 04-30 03:15:43.654: INFO/System.out(3303): <tr> 04-30 03:15:43.654: INFO/System.out(3303): <td class="Haupt"> 04-30 03:15:43.654: INFO/System.out(3303): 04-30 03:15:43.674: INFO/System.out(3303): <table border="0" cellspacing="0" cellpadding="2"> 04-30 03:15:43.674: INFO/System.out(3303): <!-- 1.Zeile Startauswahl --> 04-30 03:15:43.674: INFO/System.out(3303): <tr> 04-30 03:15:43.674: INFO/System.out(3303): <td rowspan="2" class="Start1"> 04-30 03:15:43.674: INFO/System.out(3303): Start 04-30 03:15:43.685: INFO/System.out(3303): </td> 04-30 03:15:43.685: INFO/System.out(3303): 04-30 03:15:43.685: INFO/System.out(3303): <td class="Start2" height="25"> 04-30 03:15:43.685: INFO/System.out(3303): Stadt/Gemeinde 04-30 03:15:43.685: INFO/System.out(3303): </td> 04-30 03:15:43.685: INFO/System.out(3303): 04-30 03:15:43.685: INFO/System.out(3303): <td class="Start3"> 04-30 03:15:43.685: INFO/System.out(3303): <input type="text" name="GT0" value="" tabindex="1" /> 04-30 03:15:43.704: INFO/System.out(3303): 04-30 03:15:43.704: INFO/System.out(3303): </td> 04-30 03:15:43.704: INFO/System.out(3303): 04-30 03:15:43.704: INFO/System.out(3303): 04-30 03:15:43.704: INFO/System.out(3303): <td rowspan="2" class="Start4"> 04-30 03:15:43.714: INFO/System.out(3303): <input type="submit" name="Map0" value="Karte" tabindex="100" /> 04-30 03:15:43.724: INFO/System.out(3303): 04-30 03:15:43.724: INFO/System.out(3303): </td> 04-30 03:15:43.724: INFO/System.out(3303): 04-30 03:15:43.724: INFO/System.out(3303): 04-30 03:15:43.724: INFO/System.out(3303): </tr> 04-30 03:15:43.724: INFO/System.out(3303): 04-30 03:15:43.724: INFO/System.out(3303): <tr> 04-30 03:15:43.734: INFO/System.out(3303): <td class="Start2" height="25"> 04-30 03:15:43.734: INFO/System.out(3303): <select name="T0" id="efaT0"> 04-30 03:15:43.734: INFO/System.out(3303): <option value="A" >Adresse 04-30 03:15:43.734: INFO/System.out(3303): <option value="H" selected="selected">Haltestelle 04-30 03:15:43.734: INFO/System.out(3303): <option value="Z" >Bes. Ziel 04-30 03:15:43.734: INFO/System.out(3303): </select> 04-30 03:15:43.734: INFO/System.out(3303): 04-30 03:15:43.734: INFO/System.out(3303): </td> 04-30 03:15:43.734: INFO/System.out(3303): 04-30 03:15:43.734: INFO/System.out(3303): <td class="Start3"> 04-30 03:15:43.734: INFO/System.out(3303): <input type="text" name="HT0" value="" tabindex="2" /> 04-30 03:15:43.734: INFO/System.out(3303): 04-30 03:15:43.745: INFO/System.out(3303): </td> 04-30 03:15:43.754: INFO/System.out(3303): 04-30 03:15:43.774: INFO/System.out(3303): </tr> 04-30 03:15:43.784: INFO/System.out(3303): 04-30 03:15:43.784: INFO/System.out(3303): <!-- 2.Zeile Ziel oder ViaAuswahl --> 04-30 03:15:43.784: INFO/System.out(3303): 04-30 03:15:43.805: INFO/System.out(3303): <tr> 04-30 03:15:43.834: INFO/System.out(3303): <td rowspan="2" class="Ziel1"> 04-30 03:15:43.834: INFO/System.out(3303): Ziel 04-30 03:15:43.834: INFO/System.out(3303): </td> 04-30 03:15:43.844: INFO/System.out(3303): 04-30 03:15:43.844: INFO/System.out(3303): <td class="Ziel2" height="25"> 04-30 03:15:43.844: INFO/System.out(3303): Stadt/Gemeinde 04-30 03:15:43.844: INFO/System.out(3303): </td> 04-30 03:15:43.854: INFO/System.out(3303): 04-30 03:15:43.854: INFO/System.out(3303): <td class="Ziel3"> 04-30 03:15:43.854: INFO/System.out(3303): Aachen 04-30 03:15:43.864: INFO/System.out(3303): </td> 04-30 03:15:43.874: INFO/System.out(3303): 04-30 03:15:43.874: INFO/System.out(3303): 04-30 03:15:43.884: INFO/System.out(3303): <td rowspan="2" class="Ziel4"> 04-30 03:15:43.884: INFO/System.out(3303): <input type="submit" name="Map1" value="Karte" tabindex="101" /> 04-30 03:15:43.884: INFO/System.out(3303): 04-30 03:15:43.884: INFO/System.out(3303): </td> 04-30 03:15:43.884: INFO/System.out(3303): 04-30 03:15:43.884: INFO/System.out(3303): 04-30 03:15:43.884: INFO/System.out(3303): </tr> 04-30 03:15:43.884: INFO/System.out(3303): 04-30 03:15:43.884: INFO/System.out(3303): <tr> 04-30 03:15:43.884: INFO/System.out(3303): <td class="Ziel2" height="25"> 04-30 03:15:43.894: INFO/System.out(3303): <small></small> 04-30 03:15:43.894: INFO/System.out(3303): </td> 04-30 03:15:43.894: INFO/System.out(3303): <td class="Ziel3"> 04-30 03:15:43.894: INFO/System.out(3303): Karlsgraben 04-30 03:15:43.904: INFO/System.out(3303): </td> 04-30 03:15:43.904: INFO/System.out(3303): </tr> 04-30 03:15:43.904: INFO/System.out(3303): 04-30 03:15:43.914: INFO/System.out(3303): 04-30 03:15:43.924: INFO/System.out(3303): 04-30 03:15:43.934: INFO/System.out(3303): 04-30 03:15:43.934: INFO/System.out(3303): 04-30 03:15:43.934: INFO/System.out(3303): 04-30 03:15:43.934: INFO/System.out(3303): <!-- 3.Zeile Datum/Zeit/Intervall --> 04-30 03:15:43.934: INFO/System.out(3303): <tr> 04-30 03:15:43.944: INFO/System.out(3303): <td rowspan="3" class="Zeit1"> 04-30 03:15:43.944: INFO/System.out(3303): Zeit 04-30 03:15:43.944: INFO/System.out(3303): </td> 04-30 03:15:43.944: INFO/System.out(3303): <td class="Datum2"> 04-30 03:15:43.944: INFO/System.out(3303): Datum 04-30 03:15:43.944: INFO/System.out(3303): </td> 04-30 03:15:43.944: INFO/System.out(3303): 04-30 03:15:43.944: INFO/System.out(3303): <!-- Für Abfragen ohne Karte alternativ Zeile ohne colspan hinzufügen --> 04-30 03:15:43.954: INFO/System.out(3303): 04-30 03:15:43.964: INFO/System.out(3303): <td class="Datum3" height="25" colspan="2"> 04-30 03:15:43.984: INFO/System.out(3303): <select name="DatumT" tabindex="10" id="efaDatumT"> 04-30 03:15:43.984: INFO/System.out(3303): <option >1</option> 04-30 03:15:43.984: INFO/System.out(3303): <option >2</option> 04-30 03:15:43.984: INFO/System.out(3303): <option >3</option> 04-30 03:15:43.984: INFO/System.out(3303): <option >4</option> 04-30 03:15:43.984: INFO/System.out(3303): <option >5</option> 04-30 03:15:43.984: INFO/System.out(3303): <option >6</option> 04-30 03:15:43.984: INFO/System.out(3303): <option >7</option> 04-30 03:15:43.984: INFO/System.out(3303): <option >8</option> 04-30 03:15:43.994: INFO/System.out(3303): <option >9</option> 04-30 03:15:43.994: INFO/System.out(3303): <option >10</option> 04-30 03:15:43.994: INFO/System.out(3303): <option >11</option> 04-30 03:15:43.994: INFO/System.out(3303): <option >12</option> 04-30 03:15:44.005: INFO/System.out(3303): <option >13</option> 04-30 03:15:44.024: INFO/System.out(3303): <option >14</option> 04-30 03:15:44.034: INFO/System.out(3303): <option >15</option> 04-30 03:15:44.034: INFO/System.out(3303): <option >16</option> 04-30 03:15:44.034: INFO/System.out(3303): <option >17</option> 04-30 03:15:44.034: INFO/System.out(3303): <option >18</option> 04-30 03:15:44.044: INFO/System.out(3303): <option >19</option> 04-30 03:15:44.044: INFO/System.out(3303): <option >20</option> 04-30 03:15:44.044: INFO/System.out(3303): <option >21</option> 04-30 03:15:44.044: INFO/System.out(3303): <option >22</option> 04-30 03:15:44.044: INFO/System.out(3303): <option >23</option> 04-30 03:15:44.044: INFO/System.out(3303): <option >24</option> 04-30 03:15:44.044: INFO/System.out(3303): <option >25</option> 04-30 03:15:44.044: INFO/System.out(3303): <option >26</option> 04-30 03:15:44.044: INFO/System.out(3303): <option >27</option> 04-30 03:15:44.044: INFO/System.out(3303): <option >28</option> 04-30 03:15:44.044: INFO/System.out(3303): <option >29</option> 04-30 03:15:44.044: INFO/System.out(3303): <option selected="selected">30</option> 04-30 03:15:44.044: INFO/System.out(3303): <option >31</option> 04-30 03:15:44.055: INFO/System.out(3303): </select> 04-30 03:15:44.055: INFO/System.out(3303): . 04-30 03:15:44.055: INFO/System.out(3303): <select name="DatumM" tabindex="11" id="efaDatumM"> 04-30 03:15:44.055: INFO/System.out(3303): <option >1</option> 04-30 03:15:44.055: INFO/System.out(3303): <option >2</option> 04-30 03:15:44.055: INFO/System.out(3303): <option >3</option> 04-30 03:15:44.064: INFO/System.out(3303): <option selected="selected">4</option> 04-30 03:15:44.064: INFO/System.out(3303): <option >5</option> 04-30 03:15:44.064: INFO/System.out(3303): <option >6</option> 04-30 03:15:44.064: INFO/System.out(3303): <option >7</option> 04-30 03:15:44.064: INFO/System.out(3303): <option >8</option> 04-30 03:15:44.064: INFO/System.out(3303): <option >9</option> 04-30 03:15:44.064: INFO/System.out(3303): <option >10</option> 04-30 03:15:44.064: INFO/System.out(3303): <option >11</option> 04-30 03:15:44.085: INFO/System.out(3303): <option >12</option> 04-30 03:15:44.085: INFO/System.out(3303): </select> 04-30 03:15:44.085: INFO/System.out(3303): . 04-30 03:15:44.085: INFO/System.out(3303): <select name="DatumJ" tabindex="12" id="efaDatumJ"> 04-30 03:15:44.095: INFO/System.out(3303): <option >2009</option> 04-30 03:15:44.095: INFO/System.out(3303): <option selected="selected">2010</option> 04-30 03:15:44.095: INFO/System.out(3303): <option >2011</option> 04-30 03:15:44.095: INFO/System.out(3303): </select> 04-30 03:15:44.095: INFO/System.out(3303): 04-30 03:15:44.095: INFO/System.out(3303): </td> 04-30 03:15:44.095: INFO/System.out(3303): 04-30 03:15:44.105: INFO/System.out(3303): </tr> 04-30 03:15:44.115: INFO/System.out(3303): 04-30 03:15:44.115: INFO/System.out(3303): <tr> 04-30 03:15:44.115: INFO/System.out(3303): <td class="Uhrzeit2"> 04-30 03:15:44.115: INFO/System.out(3303): <input type="radio" name="AbfAnk" value="Abf" checked />Abfahrten ab<br /> 04-30 03:15:44.115: INFO/System.out(3303): <input type="radio" name="AbfAnk" value="Ank" />Ankünfte bis 04-30 03:15:44.115: INFO/System.out(3303): 04-30 03:15:44.115: INFO/System.out(3303): </td> 04-30 03:15:44.125: INFO/System.out(3303): <td class="Uhrzeit3" height="25"> 04-30 03:15:44.125: INFO/System.out(3303): <select name="ZeitH" tabindex="14" id="efaZeitH"> 04-30 03:15:44.125: INFO/System.out(3303): <option >0</option> 04-30 03:15:44.125: INFO/System.out(3303): <option >1</option> 04-30 03:15:44.125: INFO/System.out(3303): <option >2</option> 04-30 03:15:44.135: INFO/System.out(3303): <option >3</option> 04-30 03:15:44.135: INFO/System.out(3303): <option >4</option> 04-30 03:15:44.135: INFO/System.out(3303): <option >5</option> 04-30 03:15:44.135: INFO/System.out(3303): <option >6</option> 04-30 03:15:44.135: INFO/System.out(3303): <option >7</option> 04-30 03:15:44.135: INFO/System.out(3303): <option >8</option> 04-30 03:15:44.145: INFO/System.out(3303): <option >9</option> 04-30 03:15:44.145: INFO/System.out(3303): <option >10</option> 04-30 03:15:44.145: INFO/System.out(3303): <option >11</option> 04-30 03:15:44.145: INFO/System.out(3303): <option >12</option> 04-30 03:15:44.145: INFO/System.out(3303): <option >13</option> 04-30 03:15:44.145: INFO/System.out(3303): <option >14</option> 04-30 03:15:44.145: INFO/System.out(3303): <option selected="selected">15</option> 04-30 03:15:44.145: INFO/System.out(3303): <option >16</option> 04-30 03:15:44.145: INFO/System.out(3303): <option >17</option> 04-30 03:15:44.145: INFO/System.out(3303): <option >18</option> 04-30 03:15:44.145: INFO/System.out(3303): <option >19</option> 04-30 03:15:44.155: INFO/System.out(3303): <option >20</option> 04-30 03:15:44.155: INFO/System.out(3303): <option >21</option> 04-30 03:15:44.155: INFO/System.out(3303): <option >22</option> 04-30 03:15:44.155: INFO/System.out(3303): <option >23</option> 04-30 03:15:44.155: INFO/System.out(3303): </select> 04-30 03:15:44.155: INFO/System.out(3303): : 04-30 03:15:44.155: INFO/System.out(3303): <select name="ZeitM" tabindex="15" id="efaZeitM"> 04-30 03:15:44.155: INFO/System.out(3303): <option >00</option> 04-30 03:15:44.155: INFO/System.out(3303): <option selected="selected">15</option> 04-30 03:15:44.155: INFO/System.out(3303): <option >30</option> 04-30 03:15:44.155: INFO/System.out(3303): <option >45</option> 04-30 03:15:44.155: INFO/System.out(3303): </select> 04-30 03:15:44.155: INFO/System.out(3303): 04-30 03:15:44.155: INFO/System.out(3303): </td> 04-30 03:15:44.155: INFO/System.out(3303): 04-30 03:15:44.165: INFO/System.out(3303): <td class="Uhrzeit2">&nbsp;</td> 04-30 03:15:44.165: INFO/System.out(3303): 04-30 03:15:44.165: INFO/System.out(3303): </tr> 04-30 03:15:44.165: INFO/System.out(3303): 04-30 03:15:44.165: INFO/System.out(3303): <tr> 04-30 03:15:44.165: INFO/System.out(3303): <td class="Intervall2"> 04-30 03:15:44.165: INFO/System.out(3303): Intervall 04-30 03:15:44.165: INFO/System.out(3303): </td> 04-30 03:15:44.184: INFO/System.out(3303): 04-30 03:15:44.184: INFO/System.out(3303): <td class="Intervall3" height="25"> 04-30 03:15:44.184: INFO/System.out(3303): <select name="Intervall" tabindex="13" id="efaIntervall"> 04-30 03:15:44.184: INFO/System.out(3303): <option value="60" >1 h</option> 04-30 03:15:44.184: INFO/System.out(3303): <option value="120" >2 h</option> 04-30 03:15:44.184: INFO/System.out(3303): <option value="240" >4 h</option> 04-30 03:15:44.184: INFO/System.out(3303): <option value="480" >8 h</option> 04-30 03:15:44.184: INFO/System.out(3303): <option value="1800" >ganzer Tag</option> 04-30 03:15:44.194: INFO/System.out(3303): </select> 04-30 03:15:44.194: INFO/System.out(3303): 04-30 03:15:44.204: INFO/System.out(3303): </td> 04-30 03:15:44.204: INFO/System.out(3303): 04-30 03:15:44.204: INFO/System.out(3303): <td class="Intervall3">&nbsp; 04-30 03:15:44.204: INFO/System.out(3303): 04-30 03:15:44.204: INFO/System.out(3303): </tr> 04-30 03:15:44.204: INFO/System.out(3303): </table> 04-30 03:15:44.204: INFO/System.out(3303): 04-30 03:15:44.204: INFO/System.out(3303): </td> 04-30 03:15:44.204: INFO/System.out(3303): 04-30 03:15:44.204: INFO/System.out(3303): <td class="Schalter" valign="top"> 04-30 03:15:44.204: INFO/System.out(3303): <table class="Schalter"> 04-30 03:15:44.204: INFO/System.out(3303): <!-- Buttons --> 04-30 03:15:44.204: INFO/System.out(3303): <tr> 04-30 03:15:44.204: INFO/System.out(3303): <td class="Schalter" align="center"> 04-30 03:15:44.226: INFO/System.out(3303): <input TYPE="Submit" accesskey="s" class="SuchenBtn" name="Suchen" tabindex="20" VALUE="(S)uchen"> 04-30 03:15:44.226: INFO/System.out(3303): </td> 04-30 03:15:44.226: INFO/System.out(3303): </tr> 04-30 03:15:44.226: INFO/System.out(3303): 04-30 03:15:44.226: INFO/System.out(3303): 04-30 03:15:44.226: INFO/System.out(3303): <tr> 04-30 03:15:44.226: INFO/System.out(3303): <td class="Schalter" align="center"> 04-30 03:15:44.226: INFO/System.out(3303): <input TYPE="Submit" accesskey="o" name="Optionen" tabindex="22" VALUE="(O)ptionen"> 04-30 03:15:44.226: INFO/System.out(3303): </td> 04-30 03:15:44.226: INFO/System.out(3303): </tr> 04-30 03:15:44.226: INFO/System.out(3303): 04-30 03:15:44.226: INFO/System.out(3303): 04-30 03:15:44.226: INFO/System.out(3303): <tr> 04-30 03:15:44.226: INFO/System.out(3303): <td class="Schalter" align="center"> 04-30 03:15:44.226: INFO/System.out(3303): <input TYPE="Button" accesskey="z" tabindex="24" VALUE="(Z)urück" onClick="history.back()"> 04-30 03:15:44.226: INFO/System.out(3303): </td> 04-30 03:15:44.226: INFO/System.out(3303): </tr> 04-30 03:15:44.226: INFO/System.out(3303): <tr> 04-30 03:15:44.226: INFO/System.out(3303): <td class="Schalter" align="center"> 04-30 03:15:44.226: INFO/System.out(3303): <input TYPE="Button" accesskey="h" tabindex="25" VALUE="(H)ilfe" onClick="self.location.href='/bs.exe/FF?N=hilfe&amp;SID=3D3B9'"> 04-30 03:15:44.226: INFO/System.out(3303): </td> 04-30 03:15:44.235: INFO/System.out(3303): </tr> 04-30 03:15:44.235: INFO/System.out(3303): <tr> 04-30 03:15:44.235: INFO/System.out(3303): <td class="Schalter" align="center"> 04-30 03:15:44.235: INFO/System.out(3303): <input TYPE="Submit" accesskey="n" tabindex="26" name="Loeschen" VALUE="(N)eue Suche"> 04-30 03:15:44.235: INFO/System.out(3303): </td> 04-30 03:15:44.235: INFO/System.out(3303): </tr> 04-30 03:15:44.235: INFO/System.out(3303): 04-30 03:15:44.235: INFO/System.out(3303): <tr> 04-30 03:15:44.235: INFO/System.out(3303): 04-30 03:15:44.244: INFO/System.out(3303): <td class="Schalter" align="center"> 04-30 03:15:44.244: INFO/System.out(3303): <input TYPE="Button" accesskey="a" tabindex="27" VALUE="H(a)ltestelle" onClick="self.location.href='/bs.exe/RHFF?Karten=true?N=Result&amp;SID=3D3B9'"> 04-30 03:15:44.244: INFO/System.out(3303): </td> 04-30 03:15:44.244: INFO/System.out(3303): 04-30 03:15:44.244: INFO/System.out(3303): </tr> 04-30 03:15:44.244: INFO/System.out(3303): </table> 04-30 03:15:44.254: INFO/System.out(3303): 04-30 03:15:44.254: INFO/System.out(3303): </td> 04-30 03:15:44.254: INFO/System.out(3303): </tr> 04-30 03:15:44.254: INFO/System.out(3303): </table> 04-30 03:15:44.254: INFO/System.out(3303): </form> 04-30 03:15:44.254: INFO/System.out(3303): 04-30 03:15:44.254: INFO/System.out(3303): 04-30 03:15:44.254: INFO/System.out(3303): <!-- Meldungsbereich (automatisch erzeugt) --> 04-30 03:15:44.254: INFO/System.out(3303): <div align="center" id="meldungen"> 04-30 03:15:44.265: INFO/System.out(3303): <table class="Bedienhinweise"><tr><td rowspan="2"><img SRC="http://www.busspur.de/logos/hinweis.png" ALIGN="top" alt="Symbol" WIDTH="32" HEIGHT="20">&nbsp;</td><td rowspan="2">Start</td><td>Geben Sie den Namen der Stadt/Gemeinde ein</td></tr><tr><td>Geben Sie den Namen der Haltestelle ein</td></tr></table> 04-30 03:15:44.265: INFO/System.out(3303): </div> 04-30 03:15:44.265:

    Read the article

  • Using NHibernate Criteria API to select sepcific set of data together with a count

    - by mfloryan
    I have the following domain set up for persistence with NHibernate: I am using the PaperConfiguration as the root aggregate. I want to select all PaperConfiguration objects for a given Tier and AcademicYearConfiguration. This works really well as per the following example: ICriteria criteria = session.CreateCriteria<PaperConfiguration>() .Add(Restrictions.Eq("AcademicYearConfiguration", configuration)) .CreateCriteria("Paper") .CreateCriteria("Unit") .CreateCriteria("Tier") .Add(Restrictions.Eq("Id", tier.Id)) return criteria.List<PaperConfiguration>(); (Perhaps there is a better way of doing this though). Yet also need to know how many ReferenceMaterials there are for each PaperConfiguration and I would like to get it in the same call. Avoid HQL - I already have an HQL solution for it. I know this is what projections are for and this question suggests an idea but I can't get it to work. I have a PaperConfigurationView that has, instead of IList<ReferenceMaterial> ReferenceMaterials the ReferenceMaterialCount and was thinking along the lines of ICriteria criteria = session.CreateCriteria<PaperConfiguration>() .Add(Restrictions.Eq("AcademicYearConfiguration", configuration)) .CreateCriteria("Paper") .CreateCriteria("Unit") .CreateCriteria("Tier") .Add(Restrictions.Eq("Id", tier.Id)) .SetProjection( Projections.ProjectionList() .Add(Projections.Property("IsSelected"), "IsSelected") .Add(Projections.Property("Paper"), "Paper") // and so on for all relevant properties .Add(Projections.Count("ReferenceMaterials"), "ReferenceMaterialCount") .SetResultTransformer(Transformers.AliasToBean<PaperConfigurationView>()); return criteria.List< PaperConfigurationView >(); unfortunately this does not work. What am I doing wrong? The following simplified query: ICriteria criteria = session.CreateCriteria<PaperConfiguration>() .CreateCriteria("ReferenceMaterials") .SetProjection( Projections.ProjectionList() .Add(Projections.Property("Id"), "Id") .Add(Projections.Count("ReferenceMaterials"), "ReferenceMaterialCount") ).SetResultTransformer(Transformers.AliasToBean<PaperConfigurationView>()); return criteria.List< PaperConfigurationView >(); creates this rather unexpected SQL: SELECT this_.Id as y0_, count(this_.Id) as y1_ FROM Domain.PaperConfiguration this_ inner join Domain.ReferenceMaterial referencem1_ on this_.Id=referencem1_.PaperConfigurationId The above query fails with ADO.NET error as it obviously is not a correct SQL since it is missing a group by or the count being count(referencem1_.Id) rather than (this_.Id). NHibernate mappings: <class name="PaperConfiguration" table="PaperConfiguration"> <id name="Id" type="Int32"> <column name="Id" sql-type="int" not-null="true" unique="true" index="PK_PaperConfiguration"/> <generator class="native" /> </id> <!-- IPersistent --> <version name="VersionLock" /> <!-- IAuditable --> <property name="WhenCreated" type="DateTime" /> <property name="CreatedBy" type="String" length="50" /> <property name="WhenChanged" type="DateTime" /> <property name="ChangedBy" type="String" length="50" /> <property name="IsEmeEnabled" type="boolean" not-null="true" /> <property name="IsSelected" type="boolean" not-null="true" /> <many-to-one name="Paper" column="PaperId" class="Paper" not-null="true" access="field.camelcase"/> <many-to-one name="AcademicYearConfiguration" column="AcademicYearConfigurationId" class="AcademicYearConfiguration" not-null="true" access="field.camelcase"/> <bag name="ReferenceMaterials" generic="true" cascade="delete" lazy="true" inverse="true"> <key column="PaperConfigurationId" not-null="true" /> <one-to-many class="ReferenceMaterial" /> </bag> </class> <class name="ReferenceMaterial" table="ReferenceMaterial"> <id name="Id" type="Int32"> <column name="Id" sql-type="int" not-null="true" unique="true" index="PK_ReferenceMaterial"/> <generator class="native" /> </id> <!-- IPersistent --> <version name="VersionLock" /> <!-- IAuditable --> <property name="WhenCreated" type="DateTime" /> <property name="CreatedBy" type="String" length="50" /> <property name="WhenChanged" type="DateTime" /> <property name="ChangedBy" type="String" length="50" /> <property name="Name" type="String" not-null="true" /> <property name="ContentFile" type="String" not-null="false" /> <property name="Position" type="int" not-null="false" /> <property name="CommentaryName" type="String" not-null="false" /> <property name="CommentarySubjectTask" type="String" not-null="false" /> <property name="CommentaryPointScore" type="String" not-null="false" /> <property name="CommentaryContentFile" type="String" not-null="false" /> <many-to-one name="PaperConfiguration" column="PaperConfigurationId" class="PaperConfiguration" not-null="true"/> </class>

    Read the article

  • Trying to run WCF web service on non-domain VM, Security Errors

    - by NealWalters
    Am I in a Catch-22 situation here? My goal is to take a WCF service that I inherited, and run it on a VM and test it by calling it from my desktop PC. The VM is in a workgroup, and not in the company's domain. Basically, we need more test environments, ideally one per developer (we may have 2 to 4 people that need this). Thus the idea of the VM was that each developer could have his own web server that somewhat matches or real environment (where we actually have two websites, an external/exposed and internal). [Using VS2010 .NET 4.0] In the internal service, each method was decorated with this attribute: [OperationBehavior(Impersonation = ImpersonationOption.Required)] I'm still researching why this was needed. I think it's because a webapp calls the "internal" service, and either a) we need the credentials of the user, or b) we may doing some PrinciplePermission.Demands to see if the user is in a group. My interest is creating some ConsoleTest programs or UnitTest programs. I changed to allowed like this: [OperationBehavior(Impersonation = ImpersonationOption.Allowed)] because I was getting this error in trying to view the .svc in the browser: The contract operation 'EditAccountFamily' requires Windows identity for automatic impersonation. A Windows identity that represents the caller is not provided by binding ('WSHttpBinding','http://tempuri.org/') for contract ('IAdminService','http://tempuri.org/'. I don't get that error with the original bindings look like this: However, I believe I need to turn off this security since the web service is not on the domain. I tend to get these errors in the client: 1) The request for security token could not be satisfied because authentication failed - as an InnerException of "SecurityNegotiation was unhandled". or 2) The caller was not authenticated by the service as an InnerException of "SecurityNegotiation was unhandled". So can I create some configuration of code and web.config that will allow each developer to work on his own VM? Or must I join the VM to the domain? The number of permutations seems near endless. I've started to create a Word.doc that says what to do with each error, but now I'm in the catch-22 where I'm stuck. Thanks, Neal Server Bindings: <bindings> <wsHttpBinding> <binding name="wsHttpEndpointBinding" maxBufferPoolSize="2147483647" maxReceivedMessageSize="500000000"> <readerQuotas maxDepth="2147483647" maxStringContentLength="2147483647" maxArrayLength="2147483647" maxBytesPerRead="2147483647" maxNameTableCharCount="2147483647" /> <!-- <security mode="None" /> This is one thing I tried --> <security> <message clientCredentialType="Windows" /> </security> </binding> </wsHttpBinding> </bindings> <behaviors> <serviceBehaviors> <behavior name="ABC.AdminService.AdminServiceBehavior"> <!-- To avoid disclosing metadata information, set the value below to false and remove the metadata endpoint above before deployment --> <serviceMetadata httpGetEnabled="true" /> <!-- To receive exception details in faults for debugging purposes, set the value below to true. Set to false before deployment to avoid disclosing exception information --> <serviceDebug includeExceptionDetailInFaults="true" /> <serviceCredentials> </serviceCredentials> <!--<serviceAuthorization principalPermissionMode="UseAspNetRoles" roleProviderName="AspNetWindowsTokenRoleProvider"/>--> <serviceAuthorization principalPermissionMode="UseWindowsGroups" impersonateCallerForAllOperations="true" /> </behavior> <behavior name="ABC.AdminService.IAdminServiceTransportBehavior"> <!-- To avoid disclosing metadata information, set the value below to false and remove the metadata endpoint above before deployment --> <serviceMetadata httpGetEnabled="true" /> <!-- To receive exception details in faults for debugging purposes, set the value below to true. Set to false before deployment to avoid disclosing exception information --> <serviceDebug includeExceptionDetailInFaults="false" /> <serviceCredentials> <clientCertificate> <authentication certificateValidationMode="PeerTrust" /> </clientCertificate> <serviceCertificate findValue="WCfServer" storeLocation="LocalMachine" storeName="My" x509FindType="FindBySubjectName" /> </serviceCredentials> </behavior> </serviceBehaviors> </behaviors> <serviceHostingEnvironment multipleSiteBindingsEnabled="true" /> CLIENT: <system.serviceModel> <bindings> <wsHttpBinding> <binding name="WSHttpBinding_IAdminService" closeTimeout="00:01:00" openTimeout="00:01:00" receiveTimeout="00:10:00" sendTimeout="00:01:00" bypassProxyOnLocal="false" transactionFlow="false" hostNameComparisonMode="StrongWildcard" maxBufferPoolSize="524288" maxReceivedMessageSize="65536" messageEncoding="Text" textEncoding="utf-8" useDefaultWebProxy="true" allowCookies="false"> <readerQuotas maxDepth="32" maxStringContentLength="8192" maxArrayLength="16384" maxBytesPerRead="4096" maxNameTableCharCount="16384" /> <reliableSession ordered="true" inactivityTimeout="00:10:00" enabled="false" /> <security mode="Message"> <transport clientCredentialType="Windows" proxyCredentialType="None" realm="" /> <message clientCredentialType="Windows" negotiateServiceCredential="true" algorithmSuite="Default" /> </security> </binding> </wsHttpBinding> </bindings> <client> <endpoint address="http://192.168.159.132/EC_AdminService/AdminService.svc" binding="wsHttpBinding" bindingConfiguration="WSHttpBinding_IAdminService" contract="svcRef.IAdminService" name="WSHttpBinding_IAdminService"> <identity> <dns value="localhost" /> </identity> </endpoint> </client> </system.serviceModel>

    Read the article

  • Custom styled select box

    - by Ivan
    Hi to all am trying to use javascript for custom styled select boxes from www.gerrendesign.com/entry_images/selectboxdemo.zip and as I have plenty entries inside one of select box I need to make but am stuck in creation of scrolling function. As this select boxes are compatible with almost all older and new browsers. I need only suggestion or solution how to add scroll in this linked/attached files above - if select box is populated with plenty of entries (example cities, states, or exchange rates...) Am stuck here... Thanks for your cooperation Ivan THIS IS CODE: $(document).ready(function(){ // first locate all of the select tags on the page and hide them $("select.changeMe").css('display','none'); //now, for each select box, run this function $("select.changeMe").each(function(){ var curSel = $(this); // get the CSS width from the original select box var gddWidth = $(curSel).css('width'); var gddWidthL = gddWidth.slice(0,-2); var gddWidth2 = gddWidthL - 28; var gddWidth3 = gddWidthL - 16; // build the new div structure var gddTop = '<div style="width:' + gddWidthL + 'px" class="selectME" tabindex="0"><div class="cornerstop"><div><div></div></div></div><div class="middle"><div><div><div>'; //get the default selected option var whatSelected = $(curSel).children('option:selected').text(); //write the default var gddFirst = '<div class="first"><span class="selectME gselected" style="width:'+ gddWidth2 + 'px;">'+ whatSelected +'</span><span id="arrowImg"></span><div class="clears"></div></div><ul class="selectME">'; // create a new array of div options from the original's options var addItems = new Array(); $(curSel).children('option').each( function() { var text = $(this).text(); var selVal = $(this).attr('value'); var before = '<li style="width:' + gddWidthL + 'px;"><a href="#" rel="' + selVal + '" tabindex="0" style="width:' + gddWidth3 + 'px;">'; var after = '</a></li>'; addItems.push(before + text + after); }); //hide the default from the list of options var removeFirst = addItems.shift(); // create the end of the div selectbox and close everything off var gddBottom ='</ul></div></div></div></div><div class="cornersbottom"><div><div></div></div></div></div>' //write everything after each selectbox var GDD = gddTop + gddFirst + addItems.join('') + gddBottom; $(curSel).after(GDD); //this var selects the div select box directly after each of the origials var nGDD = $(curSel).next('div.selectME'); $(nGDD).find('li:first').addClass("first"); $(nGDD).find('li:last').addClass('last'); //handle the on click functions - push results back to old text box $(nGDD).click( function(e) { var myTarA = $(e.target).attr('rel'); var myTarT = $(e.target).text(); var myTar = $(e.target); //if closed, then open if( $(nGDD).find('li').css('display') == 'none') { //this next line closes any other selectboxes that might be open $('div.selectME').find('li').css('display','none'); $(nGDD).find('li').css('display','block'); //if user clicks off of the div select box, then shut the whole thing down $(document.window || 'body').click( function(f) { var myTar2 = $(f.target); if (myTar2 !== nGDD) {$(nGDD).find('li').css('display','none');} }); return false; } else { if (myTarA == null){ $(nGDD).find('li').css('display','none'); return false; } else { //set the value of the old select box $(curSel).val(myTarA); //set the text of the new one $(nGDD).find('span.gselected').text(myTarT); $(nGDD).find('li').css('display','none'); return false; } } //handle the tab index functions }).focus( function(e) { $(nGDD).find('li:first').addClass('currentDD'); $(nGDD).find('li:last').addClass('lastDD'); function checkKey(e){ //on keypress handle functions function moveDown() { var current = $(nGDD).find('.currentDD:first'); var next = $(nGDD).find('.currentDD').next(); if ($(current).is('.lastDD')){ return false; } else { $(next).addClass('currentDD'); $(current).removeClass('currentDD'); } } function moveUp() { var current = $(nGDD).find('.currentDD:first'); var prev = $(nGDD).find('.currentDD').prev(); if ($(current).is('.first')){ return false; } else { $(prev).addClass('currentDD'); $(current).removeClass('currentDD'); } } var curText = $(nGDD).find('.currentDD:first').text(); var curVal = $(nGDD).find('.currentDD:first a').attr('rel'); switch (e.keyCode) { case 40: $(curSel).val(curVal); $(nGDD).find('span.gselected').text(curText); moveDown(); return false; break; case 38: $(curSel).val(curVal); $(nGDD).find('span.gselected').text(curText); moveUp(); return false; break; case 13: $(nGDD).find('li').css('display','none'); } } $(document).keydown(checkKey); }).blur( function() { $(document).unbind('keydown'); }); }); });

    Read the article

  • C# WPF application is using too much memory while GC.GetTotalMemory() is low

    - by Dmitry
    I wrote little WPF application with 2 threads - main thread is GUI thread and another thread is worker. App has one WPF form with some controls. There is a button, allowing to select directory. After selecting directory, application scans for .jpg files in that directory and checks if their thumbnails are in hashtable. if they are, it does nothing. else it's adding their full filenames to queue for worker. Worker is taking filenames from this queue, loading JPEG images (using WPF's JpegBitmapDecoder and BitmapFrame), making thumbnails of them (using WPF's TransformedBitmap) and adding them to hashtable. Everything works fine, except memory consumption by this application when making thumbnails for big images (like 5000x5000 pixels). I've added textboxes on my form to show memory consumption (GC.GetTotalMemory() and Process.GetCurrentProcess().PrivateMemorySize64) and was very surprised, cuz GC.GetTotalMemory() stays close to 1-2 Mbytes, while private memory size constantly grows, especially when loading new image (~ +100Mb per image). Even after loading all images, making thumbnails of them and freeing original images, private memory size stays at ~700-800Mbytes. My VirtualBox is limited to 512Mb of physical memory and Windows in VirtualBox starts to swap alot to handle this huge memory consumption. I guess I'm doing something wrong, but I don't know how to investigate this problem, cuz according to GC, allocated memory size is very low. Attaching code of thumbnail loader class: class ThumbnailLoader { Hashtable thumbnails; Queue<string> taskqueue; EventWaitHandle wh; Thread[] workers; bool stop; object locker; int width, height, processed, added; public ThumbnailLoader() { int workercount,i; wh = new AutoResetEvent(false); thumbnails = new Hashtable(); taskqueue = new Queue<string>(); stop = false; locker = new object(); width = height = 64; processed = added = 0; workercount = Environment.ProcessorCount; workers=new Thread[workercount]; for (i = 0; i < workercount; i++) { workers[i] = new Thread(Worker); workers[i].IsBackground = true; workers[i].Priority = ThreadPriority.Highest; workers[i].Start(); } } public void SetThumbnailSize(int twidth, int theight) { width = twidth; height = theight; if (thumbnails.Count!=0) AddTask("#resethash"); } public void GetProgress(out int Added, out int Processed) { Added = added; Processed = processed; } private void AddTask(string filename) { lock(locker) { taskqueue.Enqueue(filename); wh.Set(); added++; } } private string NextTask() { lock(locker) { if (taskqueue.Count == 0) return null; else { processed++; return taskqueue.Dequeue(); } } } public static string FileNameToHash(string s) { return FormsAuthentication.HashPasswordForStoringInConfigFile(s, "MD5"); } public bool GetThumbnail(string filename,out BitmapFrame thumbnail) { string hash; hash = FileNameToHash(filename); if (thumbnails.ContainsKey(hash)) { thumbnail=(BitmapFrame)thumbnails[hash]; return true; } AddTask(filename); thumbnail = null; return false; } private BitmapFrame LoadThumbnail(string filename) { FileStream fs; JpegBitmapDecoder bd; BitmapFrame oldbf, bf; TransformedBitmap tb; double scale, dx, dy; fs = new FileStream(filename, FileMode.Open); bd = new JpegBitmapDecoder(fs, BitmapCreateOptions.None, BitmapCacheOption.OnLoad); oldbf = bd.Frames[0]; dx = (double)oldbf.Width / width; dy = (double)oldbf.Height / height; if (dx > dy) scale = 1 / dx; else scale = 1 / dy; tb = new TransformedBitmap(oldbf, new ScaleTransform(scale, scale)); bf = BitmapFrame.Create(tb); fs.Close(); oldbf = null; bd = null; GC.Collect(); return bf; } public void Dispose() { lock(locker) { stop = true; } AddTask(null); foreach (Thread worker in workers) { worker.Join(); } wh.Close(); } private void Worker() { string curtask,hash; while (!stop) { curtask = NextTask(); if (curtask == null) wh.WaitOne(); else { if (curtask == "#resethash") thumbnails.Clear(); else { hash = FileNameToHash(curtask); try { thumbnails[hash] = LoadThumbnail(curtask); } catch { thumbnails[hash] = null; } } } } } }

    Read the article

  • Problem using Hibernate-Search

    - by KCore
    Hi, I am using hibernate search for my application. It is well configured and running perfectly till some time back, when it stopped working suddenly. The reason according to me being the number of my model (bean) classes. I have some 90 classes, which I add to my configuration, while building my Hibernate Configuration. When, I disable hibernate search (remove the search annotations and use Configuration instead of AnnotationsConfiguration), I try to start my application, it Works fine. But,the same app when I enable search, it just hangs up. I tried debugging and found the exact place where it hangs. After adding all the class to my AnnotationsConfiguration object, when I say cfg.buildSessionfactory(), It never comes out of that statement. (I have waited for hours!!!) Also when I decrease the number of my model classes (like say to half i.e. 50) it comes out of that statement and the application works fine.. Can Someone tell why is this happening?? My versions of hibernate are: hibernate-core-3.3.1.GA.jar hibernate-annotations-3.4.0.GA.jar hibernate-commons-annotations-3.1.0.GA.jar hibernate-search-3.1.0.GA.jar Also if need to avoid using AnnotationsConfiguration, I read that I need to configure the search event listeners explicitly.. can anyone list all the neccessary listeners and their respective classes? (I tried the standard ones given in Hibernate Search books, but they give me ClassNotFound exception and I have all the neccesarty libs in classpath) Here are the last few lines of hibernate trace I managed to pull : 16:09:32,814 INFO AnnotationConfiguration:369 - Hibernate Validator not found: ignoring 16:09:32,892 INFO ConnectionProviderFactory:95 - Initializing connection provider: org.hibernate.connection.C3P0ConnectionProvider 16:09:32,895 INFO C3P0ConnectionProvider:103 - C3P0 using driver: com.mysql.jdbc.Driver at URL: jdbc:mysql://localhost:3306/autolinkcrmcom_data 16:09:32,898 INFO C3P0ConnectionProvider:104 - Connection properties: {user=root, password=****} 16:09:32,900 INFO C3P0ConnectionProvider:107 - autocommit mode: false 16:09:33,694 INFO SettingsFactory:116 - RDBMS: MySQL, version: 5.1.37-1ubuntu5.1 16:09:33,696 INFO SettingsFactory:117 - JDBC driver: MySQL-AB JDBC Driver, version: mysql-connector-java-3.1.10 ( $Date: 2005/05/19 15:52:23 $, $Revision: 1.1.2.2 $ ) 16:09:33,701 INFO Dialect:175 - Using dialect: org.hibernate.dialect.MySQLDialect 16:09:33,707 INFO TransactionFactoryFactory:59 - Using default transaction strategy (direct JDBC transactions) 16:09:33,709 INFO TransactionManagerLookupFactory:80 - No TransactionManagerLookup configured (in JTA environment, use of read-write or transactional second-level cache is not recommended) 16:09:33,711 INFO SettingsFactory:170 - Automatic flush during beforeCompletion(): disabled 16:09:33,714 INFO SettingsFactory:174 - Automatic session close at end of transaction: disabled 16:09:32,814 INFO AnnotationConfiguration:369 - Hibernate Validator not found: ignoring 16:09:32,892 INFO ConnectionProviderFactory:95 - Initializing connection provider: org.hibernate.connection.C3P0ConnectionProvider 16:09:32,895 INFO C3P0ConnectionProvider:103 - C3P0 using driver: com.mysql.jdbc.Driver at URL: jdbc:mysql://localhost:3306/autolinkcrmcom_data 16:09:32,898 INFO C3P0ConnectionProvider:104 - Connection properties: {user=root, password=****} 16:09:32,900 INFO C3P0ConnectionProvider:107 - autocommit mode: false 16:09:33,694 INFO SettingsFactory:116 - RDBMS: MySQL, version: 5.1.37-1ubuntu5.1 16:09:33,696 INFO SettingsFactory:117 - JDBC driver: MySQL-AB JDBC Driver, version: mysql-connector-java-3.1.10 ( $Date: 2005/05/19 15:52:23 $, $Revision: 1.1.2.2 $ ) 16:09:33,701 INFO Dialect:175 - Using dialect: org.hibernate.dialect.MySQLDialect 16:09:33,707 INFO TransactionFactoryFactory:59 - Using default transaction strategy (direct JDBC transactions) 16:09:33,709 INFO TransactionManagerLookupFactory:80 - No TransactionManagerLookup configured (in JTA environment, use of read-write or transactional second-level cache is not recommended) 16:09:33,711 INFO SettingsFactory:170 - Automatic flush during beforeCompletion(): disabled 16:09:33,714 INFO SettingsFactory:174 - Automatic session close at end of transaction: disabled 16:09:33,716 INFO SettingsFactory:181 - JDBC batch size: 15 16:09:33,719 INFO SettingsFactory:184 - JDBC batch updates for versioned data: disabled 16:09:33,721 INFO SettingsFactory:189 - Scrollable result sets: enabled 16:09:33,723 DEBUG SettingsFactory:193 - Wrap result sets: disabled 16:09:33,725 INFO SettingsFactory:197 - JDBC3 getGeneratedKeys(): enabled 16:09:33,727 INFO SettingsFactory:205 - Connection release mode: auto 16:09:33,730 INFO SettingsFactory:229 - Maximum outer join fetch depth: 2 16:09:33,732 INFO SettingsFactory:232 - Default batch fetch size: 1000 16:09:33,735 INFO SettingsFactory:236 - Generate SQL with comments: disabled 16:09:33,737 INFO SettingsFactory:240 - Order SQL updates by primary key: disabled 16:09:33,740 INFO SettingsFactory:244 - Order SQL inserts for batching: disabled 16:09:33,742 INFO SettingsFactory:420 - Query translator: org.hibernate.hql.ast.ASTQueryTranslatorFactory 16:09:33,744 INFO ASTQueryTranslatorFactory:47 - Using ASTQueryTranslatorFactory 16:09:33,747 INFO SettingsFactory:252 - Query language substitutions: {} 16:09:33,750 INFO SettingsFactory:257 - JPA-QL strict compliance: disabled 16:09:33,752 INFO SettingsFactory:262 - Second-level cache: enabled 16:09:33,754 INFO SettingsFactory:266 - Query cache: disabled 16:09:33,757 INFO SettingsFactory:405 - Cache region factory : org.hibernate.cache.impl.bridge.RegionFactoryCacheProviderBridge 16:09:33,759 INFO RegionFactoryCacheProviderBridge:61 - Cache provider: net.sf.ehcache.hibernate.EhCacheProvider 16:09:33,762 INFO SettingsFactory:276 - Optimize cache for minimal puts: disabled 16:09:33,764 INFO SettingsFactory:285 - Structured second-level cache entries: disabled 16:09:33,766 INFO SettingsFactory:314 - Statistics: disabled 16:09:33,769 INFO SettingsFactory:318 - Deleted entity synthetic identifier rollback: disabled 16:09:33,771 INFO SettingsFactory:333 - Default entity-mode: pojo 16:09:33,774 INFO SettingsFactory:337 - Named query checking : enabled 16:09:33,869 INFO Version:20 - Hibernate Search 3.1.0.GA 16:09:35,134 DEBUG DocumentBuilderIndexedEntity:157 - Field selection in projections is set to false for entity **com.xyz.abc**. recognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernaterecognized hibernateDocumentBuilderIndexedEntity Donno what the last line indicates ??? (hibernaterecognized....) After the last line it doesnt do anything (no trace too ) and just hangs....

    Read the article

  • Google Chrome: JavaScript associative arrays, evaluated out of sequence

    - by Jerry
    Ok, so on a web page, I've got a JavaScript object which I'm using as an associative array. This exists statically in a script block when the page loads: var salesWeeks = { "200911" : ["11 / 2009", "Fiscal 2009"], "200910" : ["10 / 2009", "Fiscal 2009"], "200909" : ["09 / 2009", "Fiscal 2009"], "200908" : ["08 / 2009", "Fiscal 2009"], "200907" : ["07 / 2009", "Fiscal 2009"], "200906" : ["06 / 2009", "Fiscal 2009"], "200905" : ["05 / 2009", "Fiscal 2009"], "200904" : ["04 / 2009", "Fiscal 2009"], "200903" : ["03 / 2009", "Fiscal 2009"], "200902" : ["02 / 2009", "Fiscal 2009"], "200901" : ["01 / 2009", "Fiscal 2009"], "200852" : ["52 / 2008", "Fiscal 2009"], "200851" : ["51 / 2008", "Fiscal 2009"] }; The order of the key/value pairs is intentional, as I'm turning the object into an HTML select box such as this: <select id="ddl_sw" name="ddl_sw"> <option value="">== SELECT WEEK ==</option> <option value="200911">11 / 2009 (Fiscal 2009)</option> <option value="200910">10 / 2009 (Fiscal 2009)</option> <option value="200909">09 / 2009 (Fiscal 2009)</option> <option value="200908">08 / 2009 (Fiscal 2009)</option> <option value="200907">07 / 2009 (Fiscal 2009)</option> <option value="200906">06 / 2009 (Fiscal 2009)</option> <option value="200905">05 / 2009 (Fiscal 2009)</option> <option value="200904">04 / 2009 (Fiscal 2009)</option> <option value="200903">03 / 2009 (Fiscal 2009)</option> <option value="200902">02 / 2009 (Fiscal 2009)</option> <option value="200901">01 / 2009 (Fiscal 2009)</option> <option value="200852">52 / 2008 (Fiscal 2009)</option> <option value="200851">51 / 2008 (Fiscal 2009)</option> </select> ...with code that looks like this (snipped from a function): var arr = []; arr.push( "<select id=\"ddl_sw\" name=\"ddl_sw\">" + "<option value=\"\">== SELECT WEEK ==</option>" ); for(var key in salesWeeks) { arr.push( "<option value=\"" + key + "\">" + salesWeeks[key][0] + " (" + salesWeeks[key][1] + ")" + "<\/option>" ); } arr.push("<\/select>"); return arr.join(""); This all works fine in IE, FireFox and Opera. However in Chrome, the order comes out all weird: <select id="ddl_sw" name="ddl_sw"> <option value="">== SELECT WEEK ==</option> <option value="200852">52 / 2008 (Fiscal 2009)</option> <option value="200908">08 / 2009 (Fiscal 2009)</option> <option value="200906">06 / 2009 (Fiscal 2009)</option> <option value="200902">02 / 2009 (Fiscal 2009)</option> <option value="200907">07 / 2009 (Fiscal 2009)</option> <option value="200904">04 / 2009 (Fiscal 2009)</option> <option value="200909">09 / 2009 (Fiscal 2009)</option> <option value="200903">03 / 2009 (Fiscal 2009)</option> <option value="200905">05 / 2009 (Fiscal 2009)</option> <option value="200901">01 / 2009 (Fiscal 2009)</option> <option value="200910">10 / 2009 (Fiscal 2009)</option> <option value="200911">11 / 2009 (Fiscal 2009)</option> <option value="200851">51 / 2008 (Fiscal 2009)</option> </select> NOTE: This order, though weird, does not change on subsequent refreshes. It's always in this order. So, what is Chrome doing? Some optimization in how it processes the loop? In the first place, am I wrong to rely on the order that the key/value pairs are declared in any associative array? I never questioned it before, I just assumed the order would hold because this technique has always worked for me in the other browsers. But I suppose I've never seen it stated anywhere that the order is guaranteed. Maybe it's not? Any insight would be awesome. Thanks.

    Read the article

  • Exception on ExecuteReader() using OleDbCommand and Access

    - by Shane Fagan
    Hi again all, I'm getting the error below for this SQL statement in VB.Net 'Fill in the datagrid with the info needed from the accdb file 'to make it simple to access the db connstring = "Provider=Microsoft.ACE.OLEDB.12.0;Data " connstring += "Source=" & Application.StartupPath & "\AuctioneerSystem.accdb" 'make the new connection conn = New System.Data.OleDb.OleDbConnection(connstring) 'the sql command SQLString = "SELECT AllPropertyDetails.PropertyID, Street, Town, County, Acres, Quotas, ResidenceDetails, Status, HighestBid, AskingPrice FROM AllPropertyDetails " SQLString += "INNER JOIN Land ON AllPropertyDetails.PropertyID = Land.PropertyID " SQLString += "WHERE Deleted = False " If PriceRadioButton.Checked = True Then SQLString += "ORDER BY AskingPrice ASC" ElseIf AcresRadioButton.Checked = True Then SQLString += "ORDER BY Acres ASC" End If 'try to open the connection conn.Open() 'if the connection is open If ConnectionState.Open.ToString = "Open" Then 'use the sqlstring and conn to create the command cmd = New System.Data.OleDb.OleDbCommand(SQLString, conn) 'read the db and put it into dr dr = cmd.ExecuteReader If dr.HasRows Then 'if there is rows in the db then make sure the list box is clear 'clear the rows and columns if there is rows in the data grid LandDataGridView.Rows.Clear() LandDataGridView.Columns.Clear() 'add the columns LandDataGridView.Columns.Add("PropertyNumber", "Property Number") LandDataGridView.Columns.Add("Address", "Address") LandDataGridView.Columns.Add("Acres", "No. of Acres") LandDataGridView.Columns.Add("Quotas", "Quotas") LandDataGridView.Columns.Add("Details", "Residence Details") LandDataGridView.Columns.Add("Status", "Status") LandDataGridView.Columns.Add("HighestBid", "Highest Bid") LandDataGridView.Columns.Add("Price", "Asking Price") While dr.Read 'output the fields into the data grid LandDataGridView.Rows.Add( _ dr.Item("PropertyID").ToString _ , dr.Item("Street").ToString & " " & dr.Item("Town").ToString & ", " & dr.Item("County").ToString _ , dr.Item("Acres").ToString _ , dr.Item("Quota").ToString _ , dr.Item("ResidenceDetails").ToString _ , dr.Item("Status").ToString _ , dr.Item("HighestBid").ToString _ , dr.Item("AskingPrice").ToString) End While End If 'close the data reader dr.Close() End If 'close the connection conn.Close() Any ideas why its not working? The fields in the DB and the table names seem ok but its not working :/ The tables are AllPropertyDetails ProperyID:Number Street: text Town: text County: text Status: text HighestBid: Currency AskingPrice: Currency Deleted: Boolean Land PropertyID: Number Acres: Number Quotas: Text ResidenceDetails: text error is: System.InvalidOperationException was unhandled Message="An error occurred creating the form. See Exception.InnerException for details. The error is: No value given for one or more required parameters." Source="AuctioneerProject" StackTrace: at AuctioneerProject.My.MyProject.MyForms.Create__Instance__[T](T Instance) in 17d14f5c-a337-4978-8281-53493378c1071.vb:line 190 at AuctioneerProject.My.MyProject.MyForms.get_LandReport() at AuctioneerProject.ReportsMenu.LandButton_Click(Object sender, EventArgs e) in C:\Users\admin\Desktop\Auctioneers\AuctioneerProject\AuctioneerProject\ReportsMenu.vb:line 4 at System.Windows.Forms.Control.OnClick(EventArgs e) at System.Windows.Forms.Button.OnClick(EventArgs e) at System.Windows.Forms.Button.OnMouseUp(MouseEventArgs mevent) at System.Windows.Forms.Control.WmMouseUp(Message& m, MouseButtons button, Int32 clicks) at System.Windows.Forms.Control.WndProc(Message& m) at System.Windows.Forms.ButtonBase.WndProc(Message& m) at System.Windows.Forms.Button.WndProc(Message& m) at System.Windows.Forms.Control.ControlNativeWindow.OnMessage(Message& m) at System.Windows.Forms.Control.ControlNativeWindow.WndProc(Message& m) at System.Windows.Forms.NativeWindow.DebuggableCallback(IntPtr hWnd, Int32 msg, IntPtr wparam, IntPtr lparam) at System.Windows.Forms.UnsafeNativeMethods.DispatchMessageW(MSG& msg) at System.Windows.Forms.Application.ComponentManager.System.Windows.Forms.UnsafeNativeMethods.IMsoComponentManager.FPushMessageLoop(Int32 dwComponentID, Int32 reason, Int32 pvLoopData) at System.Windows.Forms.Application.ThreadContext.RunMessageLoopInner(Int32 reason, ApplicationContext context) at System.Windows.Forms.Application.ThreadContext.RunMessageLoop(Int32 reason, ApplicationContext context) at System.Windows.Forms.Application.Run(ApplicationContext context) at Microsoft.VisualBasic.ApplicationServices.WindowsFormsApplicationBase.OnRun() at Microsoft.VisualBasic.ApplicationServices.WindowsFormsApplicationBase.DoApplicationModel() at Microsoft.VisualBasic.ApplicationServices.WindowsFormsApplicationBase.Run(String[] commandLine) at AuctioneerProject.My.MyApplication.Main(String[] Args) in 17d14f5c-a337-4978-8281-53493378c1071.vb:line 81 at System.AppDomain._nExecuteAssembly(Assembly assembly, String[] args) at System.AppDomain.ExecuteAssembly(String assemblyFile, Evidence assemblySecurity, String[] args) at Microsoft.VisualStudio.HostingProcess.HostProc.RunUsersAssembly() at System.Threading.ThreadHelper.ThreadStart_Context(Object state) at System.Threading.ExecutionContext.Run(ExecutionContext executionContext, ContextCallback callback, Object state) at System.Threading.ThreadHelper.ThreadStart() InnerException: System.Data.OleDb.OleDbException ErrorCode=-2147217904 Message="No value given for one or more required parameters." Source="Microsoft Office Access Database Engine" StackTrace: at System.Data.OleDb.OleDbCommand.ExecuteCommandTextErrorHandling(OleDbHResult hr) at System.Data.OleDb.OleDbCommand.ExecuteCommandTextForSingleResult(tagDBPARAMS dbParams, Object& executeResult) at System.Data.OleDb.OleDbCommand.ExecuteCommandText(Object& executeResult) at System.Data.OleDb.OleDbCommand.ExecuteCommand(CommandBehavior behavior, Object& executeResult) at System.Data.OleDb.OleDbCommand.ExecuteReaderInternal(CommandBehavior behavior, String method) at System.Data.OleDb.OleDbCommand.ExecuteReader(CommandBehavior behavior) at System.Data.OleDb.OleDbCommand.ExecuteReader() at AuctioneerProject.LandReport.load_Land() in C:\Users\admin\Desktop\Auctioneers\AuctioneerProject\AuctioneerProject\LandReport.vb:line 37 at AuctioneerProject.LandReport.PriceRadioButton_CheckedChanged(Object sender, EventArgs e) in C:\Users\admin\Desktop\Auctioneers\AuctioneerProject\AuctioneerProject\LandReport.vb:line 79 at System.Windows.Forms.RadioButton.OnCheckedChanged(EventArgs e) at System.Windows.Forms.RadioButton.set_Checked(Boolean value) at AuctioneerProject.LandReport.InitializeComponent() in C:\Users\admin\Desktop\Auctioneers\AuctioneerProject\AuctioneerProject\LandReport.designer.vb:line 40 at AuctioneerProject.LandReport..ctor() in C:\Users\admin\Desktop\Auctioneers\AuctioneerProject\AuctioneerProject\LandReport.vb:line 5 InnerException:

    Read the article

  • jQuery Toggle with Cookie

    - by Cameron
    I have the following toggle system, but I want it to remember what was open/closed using the jQuery cookie plugin. So for example if I open a toggle and then navigate away from the page, when I come back it should be still open. This is code I have so far, but it's becoming rather confusing, some help would be much appreciated thanks. jQuery.cookie = function (name, value, options) { if (typeof value != 'undefined') { options = options || {}; if (value === null) { value = ''; options = $.extend({}, options); options.expires = -1; } var expires = ''; if (options.expires && (typeof options.expires == 'number' || options.expires.toUTCString)) { var date; if (typeof options.expires == 'number') { date = new Date(); date.setTime(date.getTime() + (options.expires * 24 * 60 * 60 * 1000)); } else { date = options.expires; } expires = '; expires=' + date.toUTCString(); } var path = options.path ? '; path=' + (options.path) : ''; var domain = options.domain ? '; domain=' + (options.domain) : ''; var secure = options.secure ? '; secure' : ''; document.cookie = [name, '=', encodeURIComponent(value), expires, path, domain, secure].join(''); } else { var cookieValue = null; if (document.cookie && document.cookie != '') { var cookies = document.cookie.split(';'); for (var i = 0; i < cookies.length; i++) { var cookie = jQuery.trim(cookies[i]); if (cookie.substring(0, name.length + 1) == (name + '=')) { cookieValue = decodeURIComponent(cookie.substring(name.length + 1)); break; } } } return cookieValue; } }; // var showTop = $.cookie('showTop'); if ($.cookie('showTop') == 'collapsed') { $(".toggle_container").hide(); $(".trigger").toggle(function () { $(this).addClass("active"); }, function () { $(this).removeClass("active"); }); $(".trigger").click(function () { $(this).next(".toggle_container").slideToggle("slow,"); }); } else { $(".toggle_container").show(); $(".trigger").toggle(function () { $(this).addClass("active"); }, function () { $(this).removeClass("active"); }); $(".trigger").click(function () { $(this).next(".toggle_container").slideToggle("slow,"); }); }; $(".trigger").click(function () { if ($(".toggle_container").is(":hidden")) { $(this).next(".toggle_container").slideToggle("slow,"); $.cookie('showTop', 'expanded'); } else { $(this).next(".toggle_container").slideToggle("slow,"); $.cookie('showTop', 'collapsed'); } return false; }); and this is a snippet of the HTML it works with: <li> <label for="small"><input type="checkbox" id="small" /> Small</label> <a class="trigger" href="#">Toggle</a> <div class="toggle_container"> <p class="funding"><strong>Funding</strong></p> <ul class="childs"> <li class="child"> <label for="fully-funded1"><input type="checkbox" id="fully-funded1" /> Fully Funded</label> <a class="trigger" href="#">Toggle</a> <div class="toggle_container"> <p class="days"><strong>Days</strong></p> <ul class="days clearfix"> <li><label for="1pre16">Pre 16</label> <input type="text" id="1pre16" /></li> <li><label for="2post16">Post 16</label> <input type="text" id="2post16" /></li> <li><label for="3teacher">Teacher</label> <input type="text" id="3teacher" /></li> </ul> </div> </li>

    Read the article

  • Arduino - AdHoc Network Setup

    - by methodMan
    I`m currently working with an arduino trying to build an adhoc network to which a device can connect to and send web request to. The problem I am currently having is that I can only set up one connection and then when that connection is terminated (client.stop()) all subsequent connections are not picked up by the server, even a curl command just sits there spinning. The first connection I start when I reset the server works fine and I am able to talk to the server; but after that, the arduino can no longer find new clients (even though it's trying with the library given). I`m using the sparkfun library for the wifly shield cloned from github, along with an Arduino Uno. My current code is based off their default example 'WiFly_AdHoc_Example' but I had to remove a few things to get the network to start up which might be the cause of this problem. Here is the .ino file that I am running. #include <SPI.h> #include <WiFly.h> //#include <SoftwareSerial.h> //SoftwareSerial mySerial( 5, 4); //Part from example not used(see below) WiFlyServer server(80); void setup() { Serial.begin(9600); //The code below is from the example but when I run it the WiFly will hang // on Wifly.begin(). Without it the WiFly starts up fine but only works for // one request. //mySerial.begin(9600); //WiFly.setUart(&mySerial); // Tell the WiFly library that we are not //using the SPIUart Serial.println("**************Starting WiFly**************"); // Enable Adhoc mod WiFly.begin(true); Serial.println("WiFly started, creating network."); if (!WiFly.createAdHocNetwork("wifly")) { Serial.print("Failed to create ad hoc network."); while (1) { // Hang on failure. } } Serial.println("Network created"); Serial.print("IP: "); Serial.println(WiFly.ip()); Serial.println("Starting Server..."); server.begin(); Serial.print("Server started, waiting for client."); } void loop() { delay(200); WiFlyClient client = server.available(); if (client) { Serial.println("Client Found."); // a string to store received commands String current_command = ""; while (client.connected()) { if (client.available()) { //Gets a character from the sent request. char c = client.read(); if (c=='#' || c=='\n') //End of extraneous output { current_command = ""; } else if(c!= '\n') { current_command+=c; } if (current_command== "get") { // output the value of each analog input pin for (int i = 0; i < 6; i++) { client.print("analog input "); client.print(i); client.print(" is "); client.print(analogRead(i)); client.println("<br />"); } } else if(current_command== "hello") { client.println("Hello there, I'm still here."); } else if (current_command== "quit") { client.println("Goodbye..."); client.stop(); current_command == ""; break; } else if (current_command == "*OPEN*") { current_command == ""; } } } // give the web browser time to receive the data delay(200); // close the connection client.stop(); } } If anyone understands this better then I (I`m new to arduino) please leave some helpful comments. Or just help me out on getting this little web server up and running so that I can hit it with more then one request. If there is any other helpful information I can provide please let me know. Thanks for reading and hope you can help. EDIT: Using telnet I can successfully connect (the first time) and send commands to the arduino including one to terminate the connection (calls the client.stop() method). But when I try to reconnect though telnet, it says the connection was successful but on the arduino it's still looping thinking the client is still false. WHAT??? I know right, I'm getting mixed messages from telnet vs arduino. None of the commands work obviously since the ardunio is still looping waiting for a client that evaluates to true. I'm gonna take a look at WiFlyServer from the library I imported and see if I can dig up the problem because somehow that server.available() method isn't finding new clients. Noticing a lot of TODO's in the library code.... EDIT: So I found the reason for the problem, it was in WiFlyServer.cpp file from the sparkfun library. The code that was causing the reconnect issue was infact in the server.availible() method. Right at the top of the method, there is a check: // TODO: Ensure no active non-server client connection. if (!WiFly.serverConnectionActive) { activeClient._port = 0; } For some reason when I comment this out, I can reconnect fine and everything works as it should. I will now dive into the library and see if I can fix this, I'm not exactly sure what this is doing but it gets called when the server connection is not active and is somehow blocking subsequent connections. Does anyone have any ideas how I might get to the root of this problem without using this commenting hack? Please help, no-one has commented or answered yet! Don't you want to join in on the fun???

    Read the article

  • NServiceBus pipeline with Distributors

    - by David
    I'm building a processing pipeline with NServiceBus but I'm having trouble with the configuration of the distributors in order to make each step in the process scalable. Here's some info: The pipeline will have a master process that says "OK, time to start" for a WorkItem, which will then start a process like a flowchart. Each step in the flowchart may be computationally expensive, so I want the ability to scale out each step. This tells me that each step needs a Distributor. I want to be able to hook additional activities onto events later. This tells me I need to Publish() messages when it is done, not Send() them. A process may need to branch based on a condition. This tells me that a process must be able to publish more than one type of message. A process may need to join forks. I imagine I should use Sagas for this. Hopefully these assumptions are good otherwise I'm in more trouble than I thought. For the sake of simplicity, let's forget about forking or joining and consider a simple pipeline, with Step A followed by Step B, and ending with Step C. Each step gets its own distributor and can have many nodes processing messages. NodeA workers contain a IHandleMessages processor, and publish EventA NodeB workers contain a IHandleMessages processor, and publish Event B NodeC workers contain a IHandleMessages processor, and then the pipeline is complete. Here are the relevant parts of the config files, where # denotes the number of the worker, (i.e. there are input queues NodeA.1 and NodeA.2): NodeA: <MsmqTransportConfig InputQueue="NodeA.#" ErrorQueue="error" NumberOfWorkerThreads="1" MaxRetries="5" /> <UnicastBusConfig DistributorControlAddress="NodeA.Distrib.Control" DistributorDataAddress="NodeA.Distrib.Data" > <MessageEndpointMappings> </MessageEndpointMappings> </UnicastBusConfig> NodeB: <MsmqTransportConfig InputQueue="NodeB.#" ErrorQueue="error" NumberOfWorkerThreads="1" MaxRetries="5" /> <UnicastBusConfig DistributorControlAddress="NodeB.Distrib.Control" DistributorDataAddress="NodeB.Distrib.Data" > <MessageEndpointMappings> <add Messages="Messages.EventA, Messages" Endpoint="NodeA.Distrib.Data" /> </MessageEndpointMappings> </UnicastBusConfig> NodeC: <MsmqTransportConfig InputQueue="NodeC.#" ErrorQueue="error" NumberOfWorkerThreads="1" MaxRetries="5" /> <UnicastBusConfig DistributorControlAddress="NodeC.Distrib.Control" DistributorDataAddress="NodeC.Distrib.Data" > <MessageEndpointMappings> <add Messages="Messages.EventB, Messages" Endpoint="NodeB.Distrib.Data" /> </MessageEndpointMappings> </UnicastBusConfig> And here are the relevant parts of the distributor configs: Distributor A: <add key="DataInputQueue" value="NodeA.Distrib.Data"/> <add key="ControlInputQueue" value="NodeA.Distrib.Control"/> <add key="StorageQueue" value="NodeA.Distrib.Storage"/> Distributor B: <add key="DataInputQueue" value="NodeB.Distrib.Data"/> <add key="ControlInputQueue" value="NodeB.Distrib.Control"/> <add key="StorageQueue" value="NodeB.Distrib.Storage"/> Distributor C: <add key="DataInputQueue" value="NodeC.Distrib.Data"/> <add key="ControlInputQueue" value="NodeC.Distrib.Control"/> <add key="StorageQueue" value="NodeC.Distrib.Storage"/> I'm testing using 2 instances of each node, and the problem seems to come up in the middle at Node B. There are basically 2 things that might happen: Both instances of Node B report that it is subscribing to EventA, and also that NodeC.Distrib.Data@MYCOMPUTER is subscribing to the EventB that Node B publishes. In this case, everything works great. Both instances of Node B report that it is subscribing to EventA, however, one worker says NodeC.Distrib.Data@MYCOMPUTER is subscribing TWICE, while the other worker does not mention it. In the second case, which seem to be controlled only by the way the distributor routes the subscription messages, if the "overachiever" node processes an EventA, all is well. If the "underachiever" processes EventA, then the publish of EventB has no subscribers and the workflow dies. So, my questions: Is this kind of setup possible? Is the configuration correct? It's hard to find any examples of configuration with distributors beyond a simple one-level publisher/2-worker setup. Would it make more sense to have one central broker process that does all the non-computationally-intensive traffic cop operations, and only sends messages to processes behind distributors when the task is long-running and must be load balanced? Then the load-balanced nodes could simply reply back to the central broker, which seems easier. On the other hand, that seems at odds with the decentralization that is NServiceBus's strength. And if this is the answer, and the long running process's done event is a reply, how do you keep the Publish that enables later extensibility on published events?

    Read the article

  • Rails multiple select box issue for search

    - by Reido
    First off here is my model, controller, view: My model, this is where I have my search code:--------------------------- def self.find_by_lcc(params) where = [] where << "category = 'Land'" unless params[:mls].blank? where << "mls = :mls" end unless params[:county].blank? where << "county = :county" end unless params[:acreage_range].blank? where << "acreage_range = :acreage_range" end unless params[:landtype].blank? where << "landtype = :landtype" end unless params[:price_range].blank? where << "price_range = :price_range" end if where.empty? [] else find(:all, :conditions => [where.join(" AND "), params], :order => "county, price desc") end end My controller:---------------- def land @counties = ['Adams', 'Alcorn', 'Amite', 'Attala'] @title = "Browse" return if params[:commit].nil? @properties = Property.find_by_lcc(params) else 'No properties were found' render :action = 'land_table' end My View: ---------------------- <table width="900"> <tr> <td> <% form_tag({ :action => "land" }, :method => "get") do %> <fieldset> <legend>Search our Land Properties</legend> <div class="form_row"><p>&nbsp;</p></div> <div class="form_row"> <label for="mls">MLS Number:</label>&nbsp; <%= text_field_tag 'mls', params[:mls] %> </div> <div class="form_row"> <label for "county"><font color="#ff0000">*County:</font></label>&nbsp; <%= select_tag "county", options_for_select(@counties), :multiple => true, :size => 6 %> </div> <div class="form_row"> <label for "acreage_range">Acreage:</label>&nbsp; <%= select_tag "acreage_range", options_for_select([['All',''],['1-10','1-10'],['11-25','11-25'],['26-50','26-50'],['51-100','51-100']]) %> </div> <div class="form_row"> <label for "landtype">Type:</label>&nbsp; <%= select_tag "landtype", options_for_select([['All',''],['Waterfront','Waterfront'],['Wooded','Wooded'],['Pasture','Pasture'],['Woods/Pasture','Woods/Pasture'],['Lot','Lot']]) %> </div> <div class="form_row"> <label for="price_range"><font color="#ff0000">*Price:</font></label>&nbsp; <%= select_tag "price_range", options_for_select([['All',''],['0-1,000','0-1,000'],['1,001-10,000','1,001-10,000'],['10,001-50,000','10,001-50,000'],['50,001-100,000','50,001-100,000'],['100,001-150,000']])%> </div> <input type="text" style="display: none;" disabled="disabled" size="1" /> <%= submit_tag "Search", :class => "submit" %> </fieldset> <% end%> </td> </tr> </table> The search works fine until I add ", :multiple = true, :size = 6" to make the county field multiple select. Then I get the error: Processing PublicController#land (for 65.0.81.83 at 2010-04-01 13:11:30) [GET] Parameters: {"acreage_range"=>"", "commit"=>"Search", "county"=>["Adams", "Amite"], "landtype"=>"", "price_range"=>"", "mls"=>""} ActiveRecord::StatementInvalid (Mysql::Error: Operand should contain 1 column(s): SELECT * FROM `properties` WHERE (category = 'Land' AND county = 'Adams','Amite') ORDER BY county, price desc): app/models/property.rb:93:in `find_by_lcc' app/controllers/public_controller.rb:84:in `land' /usr/lib/ruby/1.8/thread.rb:135:in `synchronize' fcgi (0.8.7) lib/fcgi.rb:117:in `session' fcgi (0.8.7) lib/fcgi.rb:104:in `each_request' fcgi (0.8.7) lib/fcgi.rb:36:in `each' dispatch.fcgi:24 I've tried to make the county, acreage_range, and price_range fields into multiple select boxes numerous ways, but can not get any method to work correctly. Any help would be greatly appreciated. Thanks,

    Read the article

  • Trouble updating my datagrid in WPF

    - by wrigley06
    As the title indicates, I'm having trouble updating a datagrid in WPF. Basically what I'm trying to accomplish is a datagrid, that is connected to a SQL Server database, that updates automatically once a user enters information into a few textboxes and clicks a submit button. You'll notice that I have a command that joins two tables. The data from the Quote_Data table will be inserted by a different user at a later time. For now my only concern is getting the information from the textboxes and into the General_Info table, and from there into my datagrid. The code, which I'll include below compiles fine, but when I hit the submit button, nothing happens. This is the first application I've ever built working with a SQL Database so many of these concepts are new to me, which is why you'll probably look at my code and wonder what is he thinking. public partial class MainWindow : Window { public MainWindow() { InitializeComponent(); } public DataSet mds; // main data set (mds) private void Window_Loaded_1(object sender, RoutedEventArgs e) { try { string connectionString = Sqtm.Properties.Settings.Default.SqtmDbConnectionString; using (SqlConnection connection = new SqlConnection(connectionString)) { connection.Open(); //Merging tables General_Info and Quote_Data SqlCommand cmd = new SqlCommand("SELECT General_Info.Quote_ID, General_Info.Open_Quote, General_Info.Customer_Name," + "General_Info.OEM_Name, General_Info.Qty, General_Info.Quote_Num, General_Info.Fab_Drawing_Num, " + "General_Info.Rfq_Num, General_Info.Rev_Num, Quote_Data.MOA, Quote_Data.MOQ, " + "Quote_Data.Markup, Quote_Data.FOB, Quote_Data.Shipping_Method, Quote_Data.Freight, " + "Quote_Data.Vendor_Price, Unit_Price, Quote_Data.Difference, Quote_Data.Vendor_NRE_ET, " + "Quote_Data.NRE, Quote_Data.ET, Quote_Data.STI_NET, Quote_Data.Mfg_Time, Quote_Data.Delivery_Time, " + "Quote_Data.Mfg_Name, Quote_Data.Mfg_Location " + "FROM General_Info INNER JOIN dbo.Quote_Data ON General_Info.Quote_ID = Quote_Data.Quote_ID", connection); SqlDataAdapter da = new SqlDataAdapter(cmd); DataTable dt = new DataTable(); da.Fill(dt); MainGrid.ItemsSource = dt.DefaultView; mds = new DataSet(); da.Fill(mds, "General_Info"); MainGrid.DataContext = mds.Tables["General_Info"]; } } catch (Exception ex) { MessageBox.Show(ex.Message); } // renaming column names from the database so they are easier to read in the datagrid MainGrid.Columns[0].Header = "#"; MainGrid.Columns[1].Header = "Date"; MainGrid.Columns[2].Header = "Customer"; MainGrid.Columns[3].Header = "OEM"; MainGrid.Columns[4].Header = "Qty"; MainGrid.Columns[5].Header = "Quote Number"; MainGrid.Columns[6].Header = "Fab Drawing Num"; MainGrid.Columns[7].Header = "RFQ Number"; MainGrid.Columns[8].Header = "Rev Number"; MainGrid.Columns[9].Header = "MOA"; MainGrid.Columns[10].Header = "MOQ"; MainGrid.Columns[11].Header = "Markup"; MainGrid.Columns[12].Header = "FOB"; MainGrid.Columns[13].Header = "Shipping"; MainGrid.Columns[14].Header = "Freight"; MainGrid.Columns[15].Header = "Vendor Price"; MainGrid.Columns[16].Header = "Unit Price"; MainGrid.Columns[17].Header = "Difference"; MainGrid.Columns[18].Header = "Vendor NRE/ET"; MainGrid.Columns[19].Header = "NRE"; MainGrid.Columns[20].Header = "ET"; MainGrid.Columns[21].Header = "STINET"; MainGrid.Columns[22].Header = "Mfg. Time"; MainGrid.Columns[23].Header = "Delivery Time"; MainGrid.Columns[24].Header = "Manufacturer"; MainGrid.Columns[25].Header = "Mfg. Location"; } private void submitQuotebtn_Click(object sender, RoutedEventArgs e) { CustomerData newQuote = new CustomerData(); int quantity; quantity = Convert.ToInt32(quantityTxt.Text); string theDate = System.DateTime.Today.Date.ToString("d"); newQuote.OpenQuote = theDate; newQuote.CustomerName = customerNameTxt.Text; newQuote.OEMName = oemNameTxt.Text; newQuote.Qty = quantity; newQuote.QuoteNumber = quoteNumberTxt.Text; newQuote.FdNumber = fabDrawingNumberTxt.Text; newQuote.RfqNumber = rfqNumberTxt.Text; newQuote.RevNumber = revNumberTxt.Text; try { string insertConString = Sqtm.Properties.Settings.Default.SqtmDbConnectionString; using (SqlConnection insertConnection = new SqlConnection(insertConString)) { insertConnection.Open(); SqlDataAdapter adapter = new SqlDataAdapter(Sqtm.Properties.Settings.Default.SqtmDbConnectionString, insertConnection); SqlCommand updateCmd = new SqlCommand("UPDATE General_Info " + "Quote_ID = @Quote_ID, " + "Open_Quote = @Open_Quote, " + "OEM_Name = @OEM_Name, " + "Qty = @Qty, " + "Quote_Num = @Quote_Num, " + "Fab_Drawing_Num = @Fab_Drawing_Num, " + "Rfq_Num = @Rfq_Num, " + "Rev_Num = @Rev_Num " + "WHERE Quote_ID = @Quote_ID"); updateCmd.Connection = insertConnection; System.Data.SqlClient.SqlParameterCollection param = updateCmd.Parameters; // // Add new SqlParameters to the command. // param.AddWithValue("Open_Quote", newQuote.OpenQuote); param.AddWithValue("Customer_Name", newQuote.CustomerName); param.AddWithValue("OEM_Name", newQuote.OEMName); param.AddWithValue("Qty", newQuote.Qty); param.AddWithValue("Quote_Num", newQuote.QuoteNumber); param.AddWithValue("Fab_Drawing_Num", newQuote.FdNumber); param.AddWithValue("Rfq_Num", newQuote.RfqNumber); param.AddWithValue("Rev_Num", newQuote.RevNumber); adapter.UpdateCommand = updateCmd; adapter.Update(mds.Tables[0]); mds.AcceptChanges(); } } catch (Exception ex) { MessageBox.Show(ex.Message); } } Thanks in advance to anyone who can help, I really appreciate it, Andrew

    Read the article

  • Am I crazy? (How) should I create a jQuery content editor?

    - by Brendon Muir
    Ok, so I created a CMS mainly aimed at Primary Schools. It's getting fairly popular in New Zealand but the one thing I hate with a passion is the largely bad quality of in browser WYSIWYG editors. I've been using KTML (made by InterAKT which was purchased by Adobe a few years ago). In my opinion this editor does a lot of great things (image editing/management, thumbnailing and pretty good content editing). Unfortunately time has had its nasty way with this product and new browsers are beginning to break features and generally degrade the performance of this tool. It's also quite scary basing my livelihood on a defunct product! I've been hunting, in fact I regularly hunt around to see if anything has changed in the WYSIWYG arena. The closest thing I've seen that excites me is the WYSIHAT framework, but they've decided to ignore a pretty relevant editing paradigm which I'm going to outline below. This is the idea for my proposed editor, and I don't know of any existing products that can do this properly: Right, so the traditional model for editing let's say a Page in a CMS is to log into a 'back end' and click edit on the page. This will then load another screen with the editor in it and perhaps a few other fields. More advanced CMS's will maybe have several editing boxes that are for different portions of the page. Anyway, the big problem with this way of doing things is that the user is editing a document outside of the final context it will appear in. In the simplest terms, this means the page template. Many things can be wrong, e.g. the with of the editing area might be different to the width of the actual template area. The height is nearly always fixed because existing editors always seem to use IFRAMES for backward compatibility. And there are plenty of other beefs which I'm sure you're quite aware of if you're in this development area. Here's my editor utopia: You click 'Edit Page': The actual page (with its actual template) displays. Portions of the page have been marked as editable via a class name. You click on one of these areas (in my case it'd just be the big 'body' area in the middle of the template) and a editing bar drops down from the top of the screen with all your standard controls (bold, italic, insert image etc...). Iframes are never used, instead we rely on setting contentEditable to true on the DIV's in question. Firefox 2 and IE6 can go away, let's move on. You can edit the page knowing exactly how it will look when you save it. Because all the styles for this template are loaded, your headings will look correct, everything will be just dandy. Is this such a radical concept? Why are we still content with TinyMCE and that other editor that is too embarrassing to use because it sounds like a swear word!? Let's face the facts: I'm a JavaScript novice. I did once play around in this area using the Javascript Anthology from SitePoint as a guide. It was quite a cool learning experience, but they of course used the IFRAME to make their lives easier. I tried to go a different route and just use contentEditable and even tried to sidestep the native content editing routines (execCommand) and instead wrote my own. They kind of worked but there were always issues. Now we have jQuery, and a few libraries that abstract things like IE's lack of Range support. I'm wondering, am I crazy, or is it actually a good idea to try and build an editor around this editing paradigm using jQuery and relevant plugins to make the job easier? My actual questions: Where would you start? What plugins do you know of that would help the most? Is it worth it, or is there a magical project that already exists that I should join in on? What are the biggest hurdles to overcome in a project like this? Am I crazy? I hope this question has been posted on the right board. I figured it is a technical question as I'm wanting to know specific hurdles and pitfalls to watch out for and also if it is technically feasible with todays technology. Looking forward to hearing peoples thoughts and opinions.

    Read the article

  • retriving hearders in all pages of word

    - by udaya
    Hi I am exporting data from php page to word,, there i get 'n' number of datas in each page .... How to set the maximum number of data that a word page can contain ,,,, I want only 20 datas in a single page This is the coding i use to export the data to word i got the data in word format but the headers are not available for all the pages ex: Page:1 slno name country state Town 1 vivek india tamilnadu trichy 2 uday india kerala coimbatore like this i am getting many details but in my page:2 i dont get the headers like name country state and town....But i can get the details like kumar america xxxx yyyy i want the result to be like slno name country state town n chris newzealand ghgg jkgj Can i get the headers If it is not possible Is there anyway to limit the number of details being displayed in each page //EDIT YOUR MySQL Connection Info: $DB_Server = "localhost"; //your MySQL Server $DB_Username = "root"; //your MySQL User Name $DB_Password = ""; //your MySQL Password $DB_DBName = "cms"; //your MySQL Database Name $DB_TBLName = ""; //your MySQL Table Name $sql = "SELECT (SELECT COUNT(*) FROM tblentercountry t2 WHERE t2.dbName <= t1.dbName and t1.dbIsDelete='0') AS SLNO ,dbName as Namee,t3.dbCountry as Country,t4.dbState as State,t5.dbTown as Town FROM tblentercountry t1 join tablecountry as t3, tablestate as t4, tabletown as t5 where t1.dbIsDelete='0' and t1.dbCountryId=t3.dbCountryId and t1.dbStateId=t4.dbStateId and t1.dbTownId=t5.dbTownId order by dbName limit 0,50"; //Optional: print out title to top of Excel or Word file with Timestamp //for when file was generated: //set $Use_Titel = 1 to generate title, 0 not to use title $Use_Title = 1; //define date for title: EDIT this to create the time-format you need //$now_date = DATE('m-d-Y H:i'); //define title for .doc or .xls file: EDIT this if you want $title = "Country"; /* Leave the connection info below as it is: just edit the above. (Editing of code past this point recommended only for advanced users.) */ //create MySQL connection $Connect = @MYSQL_CONNECT($DB_Server, $DB_Username, $DB_Password) or DIE("Couldn't connect to MySQL:" . MYSQL_ERROR() . "" . MYSQL_ERRNO()); //select database $Db = @MYSQL_SELECT_DB($DB_DBName, $Connect) or DIE("Couldn't select database:" . MYSQL_ERROR(). "" . MYSQL_ERRNO()); //execute query $result = @MYSQL_QUERY($sql,$Connect) or DIE("Couldn't execute query:" . MYSQL_ERROR(). "" . MYSQL_ERRNO()); //if this parameter is included ($w=1), file returned will be in word format ('.doc') //if parameter is not included, file returned will be in excel format ('.xls') IF (ISSET($w) && ($w==1)) { $file_type = "vnd.ms-excel"; $file_ending = "xls"; }ELSE { $file_type = "msword"; $file_ending = "doc"; } //header info for browser: determines file type ('.doc' or '.xls') HEADER("Content-Type: application/$file_type"); HEADER("Content-Disposition: attachment; filename=database_dump.$file_ending"); HEADER("Pragma: no-cache"); HEADER("Expires: 0"); /* Start of Formatting for Word or Excel */ IF (ISSET($w) && ($w==1)) //check for $w again { /* FORMATTING FOR WORD DOCUMENTS ('.doc') */ //create title with timestamp: IF ($Use_Title == 1) { ECHO("$title\n\n"); } //define separator (defines columns in excel & tabs in word) $sep = "\n"; //new line character WHILE($row = MYSQL_FETCH_ROW($result)) { //set_time_limit(60); // HaRa $schema_insert = ""; FOR($j=0; $j<mysql_num_fields($result);$j++) { //define field names $field_name = MYSQL_FIELD_NAME($result,$j); //will show name of fields $schema_insert .= "$field_name:\t"; IF(!ISSET($row[$j])) { $schema_insert .= "NULL".$sep; } ELSEIF ($row[$j] != "") { $schema_insert .= "$row[$j]".$sep; } ELSE { $schema_insert .= "".$sep; } } $schema_insert = STR_REPLACE($sep."$", "", $schema_insert); $schema_insert .= "\t"; PRINT(TRIM($schema_insert)); //end of each mysql row //creates line to separate data from each MySQL table row PRINT "\n----------------------------------------------------\n"; } }ELSE{ /* FORMATTING FOR EXCEL DOCUMENTS ('.xls') */ //create title with timestamp: IF ($Use_Title == 1) { ECHO("$title\n"); } //define separator (defines columns in excel & tabs in word) $sep = "\t"; //tabbed character //start of printing column names as names of MySQL fields FOR ($i = 0; $i < MYSQL_NUM_FIELDS($result); $i++) { ECHO MYSQL_FIELD_NAME($result,$i) . "\t"; } PRINT("\n"); //end of printing column names //start while loop to get data WHILE($row = MYSQL_FETCH_ROW($result)) { //set_time_limit(60); // HaRa $schema_insert = ""; FOR($j=0; $j<mysql_num_fields($result);$j++) { IF(!ISSET($row[$j])) $schema_insert .= "NULL".$sep; ELSEIF ($row[$j] != "") $schema_insert .= "$row[$j]".$sep; ELSE $schema_insert .= "".$sep; } $schema_insert = STR_REPLACE($sep."$", "", $schema_insert); //following fix suggested by Josue (thanks, Josue!) //this corrects output in excel when table fields contain \n or \r //these two characters are now replaced with a space $schema_insert = PREG_REPLACE("/\r\n|\n\r|\n|\r/", " ", $schema_insert); $schema_insert .= "\t"; PRINT(TRIM($schema_insert)); PRINT "\n"; } } ?

    Read the article

  • Android draw using SurfaceView and Thread

    - by Morten Høgseth
    I am trying to draw a ball to my screen using 3 classes. I have read a little about this and I found a code snippet that works using the 3 classes on one page, Playing with graphics in Android I altered the code so that I have a ball that is moving and shifts direction when hitting the wall like the picture below (this is using the code in the link). Now I like to separate the classes into 3 different pages for not making everything so crowded, everything is set up the same way. Here are the 3 classes I have. BallActivity.java Ball.java BallThread.java package com.brick.breaker; import android.app.Activity; import android.os.Bundle; import android.view.Window; import android.view.WindowManager; public class BallActivity extends Activity { private Ball ball; @Override protected void onCreate(Bundle savedInstanceState) { // TODO Auto-generated method stub super.onCreate(savedInstanceState); requestWindowFeature(Window.FEATURE_NO_TITLE); getWindow().setFlags(WindowManager.LayoutParams.FLAG_FULLSCREEN,WindowManager.LayoutParams.FLAG_FULLSCREEN); ball = new Ball(this); setContentView(ball); } @Override protected void onPause() { // TODO Auto-generated method stub super.onPause(); setContentView(null); ball = null; finish(); } } package com.brick.breaker; import android.content.Context; import android.graphics.Bitmap; import android.graphics.BitmapFactory; import android.graphics.Canvas; import android.view.SurfaceHolder; import android.view.SurfaceView; public class Ball extends SurfaceView implements SurfaceHolder.Callback { private BallThread ballThread = null; private Bitmap bitmap; private float x, y; private float vx, vy; public Ball(Context context) { super(context); // TODO Auto-generated constructor stub bitmap = BitmapFactory.decodeResource(getResources(), R.drawable.ball); x = 50.0f; y = 50.0f; vx = 10.0f; vy = 10.0f; getHolder().addCallback(this); ballThread = new BallThread(getHolder(), this); } protected void onDraw(Canvas canvas) { update(canvas); canvas.drawBitmap(bitmap, x, y, null); } public void update(Canvas canvas) { checkCollisions(canvas); x += vx; y += vy; } public void checkCollisions(Canvas canvas) { if(x - vx < 0) { vx = Math.abs(vx); } else if(x + vx > canvas.getWidth() - getBitmapWidth()) { vx = -Math.abs(vx); } if(y - vy < 0) { vy = Math.abs(vy); } else if(y + vy > canvas.getHeight() - getBitmapHeight()) { vy = -Math.abs(vy); } } public int getBitmapWidth() { if(bitmap != null) { return bitmap.getWidth(); } else { return 0; } } public int getBitmapHeight() { if(bitmap != null) { return bitmap.getHeight(); } else { return 0; } } public void surfaceChanged(SurfaceHolder holder, int format, int width, int height) { // TODO Auto-generated method stub } public void surfaceCreated(SurfaceHolder holder) { // TODO Auto-generated method stub ballThread.setRunnable(true); ballThread.start(); } public void surfaceDestroyed(SurfaceHolder holder) { // TODO Auto-generated method stub boolean retry = true; ballThread.setRunnable(false); while(retry) { try { ballThread.join(); retry = false; } catch(InterruptedException ie) { //Try again and again and again } break; } ballThread = null; } } package com.brick.breaker; import android.graphics.Canvas; import android.view.SurfaceHolder; public class BallThread extends Thread { private SurfaceHolder sh; private Ball ball; private Canvas canvas; private boolean run = false; public BallThread(SurfaceHolder _holder,Ball _ball) { sh = _holder; ball = _ball; } public void setRunnable(boolean _run) { run = _run; } public void run() { while(run) { canvas = null; try { canvas = sh.lockCanvas(null); synchronized(sh) { ball.onDraw(canvas); } } finally { if(canvas != null) { sh.unlockCanvasAndPost(canvas); } } } } public Canvas getCanvas() { if(canvas != null) { return canvas; } else { return null; } } } Here is a picture that shows the outcome of these classes. I've tried to figure this out but since I am pretty new to Android development I thought I could ask for help. Does any one know what is causing the ball to be draw like that? The code is pretty much the same as the one in the link and I have tried to experiment to find a solution but no luck. Thx in advance for any help=)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Perl LWP::UserAgent mishandling UTF-8 response

    - by RedGrittyBrick
    When I use LWP::UserAgent to retrieve content encoded in UTF-8 it seems LWP::UserAgent doesn't handle the encoding correctly. Here's the output after setting the Command Prompt window to Unicode by the command chcp 65001 Note that this initially gives the appearance that all is well, but I think it's just the shell reassembling bytes and decoding UTF-8, From the other output you can see that perl itself is not handling wide characters correctly. C:\perl getutf8.pl ====================================================================== HTTP/1.1 200 OK Connection: close Date: Fri, 31 Dec 2010 19:24:04 GMT Accept-Ranges: bytes Server: Apache/2.2.8 (Win32) PHP/5.2.6 Content-Length: 75 Content-Type: application/xml; charset=utf-8 Last-Modified: Fri, 31 Dec 2010 19:20:18 GMT Client-Date: Fri, 31 Dec 2010 19:24:04 GMT Client-Peer: 127.0.0.1:80 Client-Response-Num: 1 <?xml version="1.0" encoding="UTF-8"? <nameBudejovický Budvar</name ====================================================================== response content length is 33 ....v....1....v....2....v....3....v....4 <nameBudejovický Budvar</name . . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . 3c6e616d653e427564c49b6a6f7669636bc3bd204275647661723c2f6e616d653e < n a m e B u d ? ? j o v i c k ? ? B u d v a r < / n a m e Above you can see the payload length is 31 characters but Perl thinks it is 33. For confirmation, in the hex, we can see that the UTF-8 sequences c49b and c3bd are being interpreted as four separate characters and not as two Unicode characters. Here's the code #!perl use strict; use warnings; use LWP::UserAgent; my $ua = LWP::UserAgent-new(); my $response = $ua-get('http://localhost/Bud.xml'); if (! $response-is_success) { die $response-status_line; } print '='x70,"\n",$response-as_string(), '='x70,"\n"; my $r = $response-decoded_content((charset = 'UTF-8')); $/ = "\x0d\x0a"; # seems to be \x0a otherwise! chomp($r); # Remove any xml prologue $r =~ s/^<\?.*\?\x0d\x0a//; print "Response content length is ", length($r), "\n\n"; print "....v....1....v....2....v....3....v....4\n"; print $r,"\n"; print ". . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . \n"; print unpack("H*", $r), "\n"; print join(" ", split("", $r)), "\n"; Note that Bud.xml is UTF-8 encoded without a BOM. How can I persuade LWP::UserAgent to do the right thing? P.S. Ultimately I want to translate the Unicode data into an ASCII encoding, even if it means replacing each non-ASCII character with one question mark or other marker. I have accepted Ysth's "upgrade" answer - because I know it is the right thing to do when possible. However I am going to use a work-around (which may depress Tom further): $r = encode("cp437", decode("utf8", $r));

    Read the article

  • Transaction issue in java with hibernate - latest entries not pulled from database

    - by Gearóid
    Hi, I'm having what seems to be a transactional issue in my application. I'm using Java 1.6 and Hibernate 3.2.5. My application runs a monthly process where it creates billing entries for a every user in the database based on their monthly activity. These billing entries are then used to create Monthly Bill object. The process is: Get users who have activity in the past month Create the relevant billing entries for each user Get the set of billing entries that we've just created Create a Monthly Bill based on these entries Everything works fine until Step 3 above. The Billing Entries are correctly created (I can see them in the database if I add a breakpoint after the Billing Entry creation method), but they are not pulled out of the database. As a result, an incorrect Monthly Bill is generated. If I run the code again (without clearing out the database), new Billing Entries are created and Step 3 pulls out the entries created in the first run (but not the second run). This, to me, is very confusing. My code looks like the following: for (User user : usersWithActivities) { createBillingEntriesForUser(user.getId()); userBillingEntries = getLastMonthsBillingEntriesForUser(user.getId()); createXMLBillForUser(user.getId(), userBillingEntries); } The methods called look like the following: @Transactional public void createBillingEntriesForUser(Long id) { UserManager userManager = ManagerFactory.getUserManager(); User user = userManager.getUser(id); List<AccountEvent> events = getLastMonthsAccountEventsForUser(id); BillingEntry entry = new BillingEntry(); if (null != events) { for (AccountEvent event : events) { if (event.getEventType().equals(EventType.ENABLE)) { Calendar cal = Calendar.getInstance(); Date eventDate = event.getTimestamp(); cal.setTime(eventDate); double startDate = cal.get(Calendar.DATE); double numOfDaysInMonth = cal.getActualMaximum(Calendar.DAY_OF_MONTH); double numberOfDaysInUse = numOfDaysInMonth - startDate; double fractionToCharge = numberOfDaysInUse/numOfDaysInMonth; BigDecimal amount = BigDecimal.valueOf(fractionToCharge * Prices.MONTHLY_COST); amount.scale(); entry.setAmount(amount); entry.setUser(user); entry.setTimestamp(eventDate); userManager.saveOrUpdate(entry); } } } } @Transactional public Collection<BillingEntry> getLastMonthsBillingEntriesForUser(Long id) { if (log.isDebugEnabled()) log.debug("Getting all the billing entries for last month for user with ID " + id); //String queryString = "select billingEntry from BillingEntry as billingEntry where billingEntry>=:firstOfLastMonth and billingEntry.timestamp<:firstOfCurrentMonth and billingEntry.user=:user"; String queryString = "select be from BillingEntry as be join be.user as user where user.id=:id and be.timestamp>=:firstOfLastMonth and be.timestamp<:firstOfCurrentMonth"; //This parameter will be the start of the last month ie. start of billing cycle SearchParameter firstOfLastMonth = new SearchParameter(); firstOfLastMonth.setTemporalType(TemporalType.DATE); //this parameter holds the start of the CURRENT month - ie. end of billing cycle SearchParameter firstOfCurrentMonth = new SearchParameter(); firstOfCurrentMonth.setTemporalType(TemporalType.DATE); Query query = super.entityManager.createQuery(queryString); query.setParameter("firstOfCurrentMonth", getFirstOfCurrentMonth()); query.setParameter("firstOfLastMonth", getFirstOfLastMonth()); query.setParameter("id", id); List<BillingEntry> entries = query.getResultList(); return entries; } public MonthlyBill createXMLBillForUser(Long id, Collection<BillingEntry> billingEntries) { BillingHistoryManager manager = ManagerFactory.getBillingHistoryManager(); UserManager userManager = ManagerFactory.getUserManager(); MonthlyBill mb = new MonthlyBill(); User user = userManager.getUser(id); mb.setUser(user); mb.setTimestamp(new Date()); Set<BillingEntry> entries = new HashSet<BillingEntry>(); entries.addAll(billingEntries); String xml = createXmlForMonthlyBill(user, entries); mb.setXmlBill(xml); mb.setBillingEntries(entries); MonthlyBill bill = (MonthlyBill) manager.saveOrUpdate(mb); return bill; } Help with this issue would be greatly appreciated as its been wracking my brain for weeks now! Thanks in advance, Gearoid.

    Read the article

< Previous Page | 614 615 616 617 618 619 620 621 622 623 624 625  | Next Page >