Search Results

Search found 38457 results on 1539 pages for 'parse string'.

Page 62/1539 | < Previous Page | 58 59 60 61 62 63 64 65 66 67 68 69  | Next Page >

  • JSON.parse vs. eval()

    - by Kevin Major
    My Spider Sense warns me that using eval() to parse incoming JSON is a bad idea. I'm just wondering if JSON.parse() - which I assume is a part of JavaScript and not a browser-specific function - is more secure.

    Read the article

  • Module Adminhtml blocks not loading

    - by David Tay
    I was working on a Magento module and it was working fine. At some point, I was trying to enable WYSIWYG in an edit form 'content' field and suddenly, my adminhtml grid and edit blocks stopped being generated. On my system are TinyMCE and Fontis FCKEditor WYSIWYG editors extensions. I'm not sure what I did wrong but my adminhtml blocks will no longer generate. Here's a dump of all the blocks from my module's adminhtml layout: array(17) { [0]=> string(4) "root" [1]=> string(4) "head" [2]=> string(13) "head.calendar" [3]=> string(14) "global_notices" [4]=> string(6) "header" [5]=> string(4) "menu" [6]=> string(11) "breadcrumbs" [7]=> string(7) "formkey" [8]=> string(12) "js_translate" [9]=> string(4) "left" [10]=> string(7) "content" [11]=> string(8) "messages" [12]=> string(2) "js" [13]=> string(6) "footer" [14]=> string(8) "profiler" [15]=> string(15) "before_body_end" [16]=> string(7) "wysiwyg" } As you can see, the last item is "wysiwyg" but on the layout output of other magento modules, there are more blocks. For example, on MathieuF's calendar extension, these are all the layout blocks: array(26) { [0]=> string(4) "root" [1]=> string(4) "head" [2]=> string(13) "head.calendar" [3]=> string(14) "global_notices" [4]=> string(6) "header" [5]=> string(4) "menu" [6]=> string(11) "breadcrumbs" [7]=> string(7) "formkey" [8]=> string(12) "js_translate" [9]=> string(4) "left" [10]=> string(7) "content" [11]=> string(8) "messages" [12]=> string(2) "js" [13]=> string(6) "footer" [14]=> string(8) "profiler" [15]=> string(15) "before_body_end" [16]=> string(7) "wysiwyg" [17]=> string(27) "adminhtml_event.grid.child0" [18]=> string(12) "ANONYMOUS_19" [19]=> string(27) "adminhtml_event.grid.child1" [20]=> string(12) "ANONYMOUS_21" [21]=> string(27) "adminhtml_event.grid.child2" [22]=> string(20) "adminhtml_event.grid" [23]=> string(12) "ANONYMOUS_24" [24]=> string(19) "ANONYMOUS_17.child1" [25]=> string(14) "content.child0" } Does anyone have any idea what's wrong? I've already tried Alan Storm's Layout and Config Viewers and cannot find any clues as to what I did wrong. Any help would be greatly appreciated.

    Read the article

  • Powershell variables to string

    - by Mike Koerner
    I'm new to powershell. I'm trying to write an error handler to wrap around my script.  Part of the error handler is dumping out some variable settings.  I spent a while trying to do this and couldn't google a complete solution so I thought I'd post something. I want to display the $myinvocation variable. In powershell you can do this PS C:\> $myInvocation for my purpose I want to create a stringbuilder object and append the $myinvocation info.  I tried this $sbOut = new-object System.Text.Stringbuilder $sbOut.appendLine($myinvocation) $sbOut.ToString() This produces                                    Capacity                                MaxCapacity                                     Length                                    --------                                -----------                                     ------                                          86                                 2147483647                                         45 System.Management.Automation.InvocationInfo This is not what I wanted so I tried $sbOut.appendLine(($myinvocation|format-list *)) This produced                                    Capacity                                MaxCapacity                                     Length                                    --------                                -----------                                     ------                                         606                                 2147483647                                        305 Microsoft.PowerShell.Commands.Internal.Format.FormatStartData Microsoft.PowerShell.Commands.Internal.Format.GroupStartData Micros oft.PowerShell.Commands.Internal.Format.FormatEntryData Microsoft.PowerShell.Commands.Internal.Format.GroupEndData Microsoft.Powe rShell.Commands.Internal.Format.FormatEndData Finally I figured out how to produce what I wanted: $sbOut = new-object System.Text.Stringbuilder [void]$sbOut.appendLine(($myinvocation|out-string)) $sbOut.ToString() MyCommand        : $sbOut = new-object System.Text.Stringbuilder                                    [void]$sbOut.appendLine(($myinvocation|out-string))                                      $sbOut.ToString()                    BoundParameters  : {} UnboundArguments : {} ScriptLineNumber : 0 OffsetInLine     : 0 HistoryId        : 13 ScriptName       : Line             : PositionMessage  : InvocationName   : PipelineLength   : 2 PipelinePosition : 1 ExpectingInput   : False CommandOrigin    : Runspace Note the [void] in front of the stringbuilder variable doesn't show the Capacity,MaxCapacity of the stringbuilder object.  The pipe to out-string makes the output a string. It's not pretty but it works.

    Read the article

  • Find non-ascii characters from a UTF-8 string

    - by user10607
    I need to find the non-ASCII characters from a UTF-8 string. my understanding: UTF-8 is a superset of character encoding in which 0-127 are ascii characters. So if in a UTF-8 string , a characters value is Not between 0-127, then it is not a ascii character , right? Please correct me if i'm wrong here. On the above understanding i have written following code in C : Note: I'm using the Ubuntu gcc compiler to run C code utf-string is xvab c long i; char arr[] = "xvab c"; printf("length : %lu \n", sizeof(arr)); for(i=0; i<sizeof(arr); i++){ char ch = arr[i]; if (isascii(ch)) printf("Ascii character %c\n", ch); else printf("Not ascii character %c\n", ch); } Which prints the output like: length : 9 Ascii character x Not ascii character Not ascii character ? Not ascii character ? Ascii character a Ascii character b Ascii character Ascii character c Ascii character To naked eye length of xvab c seems to be 6, but in code it is coming as 9 ? Correct answer for the xvab c is 1 ...i.e it has only 1 non-ascii character , but in above output it is coming as 3 (times Not ascii character). How can i find the non-ascii character from UTF-8 string, correctly. Please guide on the subject.

    Read the article

  • LINQ 4 XML - What is the proper way to query deep in the tree structure?

    - by Keith Barrows
    I have an XML structure that is 4 deep: <?xml version="1.0" encoding="utf-8"?> <EmailRuleList xmlns:xsd="EmailRules.xsd"> <TargetPST name="Tech Communities"> <Parse emailAsList="true" useJustDomain="false" fromAddress="false" toAddress="true"> <EmailRule address="@aspadvice.com" folder="Lists, ASP" saveAttachments="false" /> <EmailRule address="@sqladvice.com" folder="Lists, SQL" saveAttachments="false" /> <EmailRule address="@xmladvice.com" folder="Lists, XML" saveAttachments="false" /> </Parse> <Parse emailAsList="false" useJustDomain="false" fromAddress="false" toAddress="true"> <EmailRule address="[email protected]" folder="Special Interest Groups|Northern Colorado Architects Group" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Support|SpamBayes" saveAttachments="false" /> </Parse> <Parse emailAsList="false" useJustDomain="false" fromAddress="true" toAddress="false"> <EmailRule address="[email protected]" folder="Support|GoDaddy" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Support|No-IP.com" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Discussions|Orchard Project" saveAttachments="false" /> </Parse> <Parse emailAsList="false" useJustDomain="true" fromAddress="true" toAddress="false"> <EmailRule address="@agilejournal.com" folder="Newsletters|Agile Journal" saveAttachments="false"/> <EmailRule address="@axosoft.ccsend.com" folder="Newsletters|Axosoft Newsletter" saveAttachments="false"/> <EmailRule address="@axosoft.com" folder="Newsletters|Axosoft Newsletter" saveAttachments="false"/> <EmailRule address="@cmcrossroads.com" folder="Newsletters|CM Crossroads" saveAttachments="false" /> <EmailRule address="@urbancode.com" folder="Newsletters|Urbancode" saveAttachments="false" /> <EmailRule address="@urbancode.ccsend.com" folder="Newsletters|Urbancode" saveAttachments="false" /> <EmailRule address="@Infragistics.com" folder="Newsletters|Infragistics" saveAttachments="false" /> <EmailRule address="@zdnet.online.com" folder="Newsletters|ZDNet Tech Update Today" saveAttachments="false" /> <EmailRule address="@sqlservercentral.com" folder="Newsletters|SQLServerCentral.com" saveAttachments="false" /> <EmailRule address="@simple-talk.com" folder="Newsletters|Simple-Talk Newsletter" saveAttachments="false" /> </Parse> </TargetPST> <TargetPST name="[Sharpen the Saw]"> <Parse emailAsList="false" useJustDomain="false" fromAddress="false" toAddress="true"> <EmailRule address="[email protected]" folder="Head Geek|Job Alerts" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Social|LinkedIn USMC" saveAttachments="false"/> </Parse> <Parse emailAsList="false" useJustDomain="false" fromAddress="true" toAddress="false"> <EmailRule address="[email protected]" folder="Head Geek|Job Alerts" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Head Geek|Job Alerts" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Social|Cruise Critic" saveAttachments="false"/> </Parse> <Parse emailAsList="false" useJustDomain="true" fromAddress="true" toAddress="false"> <EmailRule address="@moody.edu" folder="Social|5 Love Languages" saveAttachments="false" /> <EmailRule address="@postmaster.twitter.com" folder="Social|Twitter" saveAttachments="false"/> <EmailRule address="@diabetes.org" folder="Physical|American Diabetes Association" saveAttachments="false"/> <EmailRule address="@membership.webshots.com" folder="Social|Webshots" saveAttachments="false"/> </Parse> </TargetPST> </EmailRuleList> Now, I have both an FromAddress and a ToAddress that is parsed from an incoming email. I would like to do a LINQ query against a class set that was deserialized from this XML. For instance: ToAddress = [email protected] FromAddress = [email protected] Query: Get EmailRule.Include(Parse).Include(TargetPST) where address == ToAddress AND Parse.ToAddress==true AND Parse.useJustDomain==false Get EmailRule.Include(Parse).Include(TargetPST) where address == [ToAddress Domain Only] AND Parse.ToAddress==true AND Parse.useJustDomain==true Get EmailRule.Include(Parse).Include(TargetPST) where address == FromAddress AND Parse.FromAddress==true AND Parse.useJustDomain==false Get EmailRule.Include(Parse).Include(TargetPST) where address == [FromAddress Domain Only] AND Parse.FromAddress==true AND Parse.useJustDomain==true I am having a hard time figuring this LINQ query out. I can, of course, loop on all the bits in the XML like so (includes deserialization into objects): XmlSerializer s = new XmlSerializer(typeof(EmailRuleList)); TextReader r = new StreamReader(path); _emailRuleList = (EmailRuleList)s.Deserialize(r); TargetPST[] PSTList = _emailRuleList.Items; foreach (TargetPST targetPST in PSTList) { olRoot = GetRootFolder(targetPST.name); if (olRoot != null) { Parse[] ParseList = targetPST.Items; foreach (Parse parseRules in ParseList) { EmailRule[] EmailRuleList = parseRules.Items; foreach (EmailRule targetFolders in EmailRuleList) { } } } } However, this means going through all these loops for each and every address. It makes more sense to me to query against the Objects. Any tips appreciated!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Boost::Spirit::Qi autorules -- avoiding repeated copying of AST data structures

    - by phooji
    I've been using Qi and Karma to do some processing on several small languages. Most of the grammars are pretty small (20-40 rules). I've been able to use autorules almost exclusively, so my parse trees consist entirely of variants, structs, and std::vectors. This setup works great for the common case: 1) parse something (Qi), 2) make minor manipulations to the parse tree (visitor), and 3) output something (Karma). However, I'm concerned about what will happen if I want to make complex structural changes to a syntax tree, like moving big subtrees around. Consider the following toy example: A grammar for s-expr-style logical expressions that uses autorules... // Inside grammar class; rule names match struct names... pexpr %= pand | por | var | bconst; pand %= lit("(and ") >> (pexpr % lit(" ")) >> ")"; por %= lit("(or ") >> (pexpr % lit(" ")) >> ")"; pnot %= lit("(not ") >> pexpr >> ")"; ... which leads to parse tree representation that looks like this... struct var { std::string name; }; struct bconst { bool val; }; struct pand; struct por; struct pnot; typedef boost::variant<bconst, var, boost::recursive_wrapper<pand>, boost::recursive_wrapper<por>, boost::recursive_wrapper<pnot> > pexpr; struct pand { std::vector<pexpr> operands; }; struct por { std::vector<pexpr> operands; }; struct pnot { pexpr victim; }; // Many Fusion Macros here Suppose I have a parse tree that looks something like this: pand / ... \ por por / \ / \ var var var var (The ellipsis means 'many more children of similar shape for pand.') Now, suppose that I want negate each of the por nodes, so that the end result is: pand / ... \ pnot pnot | | por por / \ / \ var var var var The direct approach would be, for each por subtree: - create pnot node (copies por in construction); - re-assign the appropriate vector slot in the pand node (copies pnot node and its por subtree). Alternatively, I could construct a separate vector, and then replace (swap) the pand vector wholesale, eliminating a second round of copying. All of this seems cumbersome compared to a pointer-based tree representation, which would allow for the pnot nodes to be inserted without any copying of existing nodes. My question: Is there a way to avoid copy-heavy tree manipulations with autorule-compliant data structures? Should I bite the bullet and just use non-autorules to build a pointer-based AST (e.g., http://boost-spirit.com/home/2010/03/11/s-expressions-and-variants/)?

    Read the article

  • Getting information from an XML object in PHP

    - by errata
    Hi! I am using some XML parser to get some information from API, blah blah... :) In one place in my script, I need to convert string to int but I'm not sure how... Here is my object: object(parserXMLElement)#45 (4) { ["name:private"]=> string(7) "balance" ["data:private"]=> object(SimpleXMLElement)#46 (1) { [0]=> string(12) "11426.46" } ["children:private"]=> NULL ["rows:private"]=> NULL } I need to have this string "11426.46" stored in some var as integer. When I echo $parsed->result->balance I get that string, but if I want to cast it as int, the result is: 1. Please help! Thanks a lot!

    Read the article

  • Ways to parse NCSA combined based log files

    - by Kyle
    I've done a bit of site: searching with Google on Server Fault, Super User and Stack Overflow. I also checked non site specific results and and didn't really see a question like this, so here goes... I did spot this question, related to grep and awk which has some great knowledge but I don't feel the text qualification challenge was addressed. This question also broadens the scope to any platform and any program. I've got squid or apache logs based on the NCSA combined format. When I say based, meaning the first n col's in the file are per NCSA combined standards, there might be more col's with custom stuff. Here is an example line from a squid combined log: 1.1.1.1 - - [11/Dec/2010:03:41:46 -0500] "GET http://yourdomain.com:8080/en/some-page.html HTTP/1.1" 200 2142 "-" "Mozilla/5.0 (Windows; U; Windows NT 6.1; C) AppleWebKit/532.4 (KHTML, like Gecko)" TCP_MEM_HIT:NONE I'd like to be able to parse n logs and output specific columns, for sorting, counting, finding unique values etc The main challenge and what makes it a little tricky and also why I feel this question hasn't yet been asked or answered, is the text qualification conundrum. When I spotted asql from the grep/awk question, I was very excited but then realised that it didn't support combined out of the box, something I'll look at extending I guess. Looking forward to answers, and learning new stuff! Answers doesn't have to be limited to platform or program/language. For the context of this question, the platforms I use the most are Linux or OSX. Cheers

    Read the article

  • Find all substrings of a string - StringIndexOutOfBoundsException

    - by nazar_art
    I created class Word. Word has a constructor that takes a string argument and one method getSubstrings which returns a String containing all substring of word, sorted by length. For example, if the user provides the input "rum", the method returns a string that will print like this: r u m ru um rum I want to concatenate the substrings in a String, separating them with a newline ("\n"). Then return the string. Code: public class Word { String word; public Word(String word) { this.word = word; } /** * Gets all the substrings of this Word. * @return all substrings of this Word separated by newline */ public String getSubstrings() { String str = ""; int i, j; for (i = 0; i < word.length(); i++) { for (j = 0; j < word.length(); j++) { str = word.substring(i, i + j); str += "\n"; } } return str; } But it throws exception: java.lang.StringIndexOutOfBoundsException: String index out of range: -1 at java.lang.String.substring(String.java:1911) I stuck at this point. Maybe, you have other suggestions according this method signature public String getSubstrings(). How to solve this issue?

    Read the article

  • XSLT multiple string replacement with recursion

    - by John Terry
    I have been attempting to perform multiple (different) string replacement with recursion and I have hit a roadblock. I have sucessfully gotten the first replacement to work, but the subsequent replacements never fire. I know this has to do with the recursion and how the with-param string is passed back into the call-template. I see my error and why the next xsl:when never fires, but I just cant seem to figure out exactly how to pass the complete modified string from the first xsl:when to the second xsl:when. Any help is greatly appreciated. <xsl:template name="replace"> <xsl:param name="string" select="." /> <xsl:choose> <xsl:when test="contains($string, '&#13;&#10;')"> <xsl:value-of select="substring-before($string, '&#13;&#10;')" /> <br/> <xsl:call-template name="replace"> <xsl:with-param name="string" select="substring-after($string, '&#13;&#10;')"/> </xsl:call-template> </xsl:when> <xsl:when test="contains($string, 'TXT')"> <xsl:value-of select="substring-before($string, '&#13;TXT')" /> <xsl:call-template name="replace"> <xsl:with-param name="string" select="substring-after($string, '&#13;')" /> </xsl:call-template> </xsl:when> <xsl:otherwise> <xsl:value-of select="$string"/> </xsl:otherwise> </xsl:choose> </xsl:template>

    Read the article

  • What's wrong with this code to un-camel-case a string?

    - by omair iqbal
    Here is my attempt to solve the About.com Delphi challenge to un-camel-case a string. unit challenge1; interface uses Windows, Messages, SysUtils, Variants, Classes, Graphics, Controls, Forms, Dialogs, StdCtrls; type check = 65..90; TForm1 = class(TForm) Edit1: TEdit; Button1: TButton; procedure Button1Click(Sender: TObject); private { Private declarations } public { Public declarations } end; var Form1: TForm1; var s1,s2 :string; int : integer; implementation {$R *.dfm} procedure TForm1.Button1Click(Sender: TObject); var i: Integer; checks : set of check; begin s1 := edit1.Text; for i := 1 to 20 do begin int :=ord(s1[i]) ; if int in checks then insert(' ',s1,i-1); end; showmessage(s1); end; end. check is a set that contains capital letters so basically whenever a capital letter is encountered the insert function adds space before its encountered (inside the s1 string), but my code does nothing. ShowMessage just shows text as it was entered in Edit1. What have I done wrong?

    Read the article

  • How to split this string and identify first sentence after last '*'?

    - by DaveDev
    I have to get a quick demo for a client, so this is a bit hacky. Please don't flame me too much! :-) I'm getting a string similar to the following back from the database: The object of the following is to do: * blah 1 * blah 2 * blah 3 * blah 4. Some more extremely uninteresting text. Followed by yet another sentence full of extrememly uninteresting text. Thankfully this is the last sentence. I need to format this so that each * represents a bullet point, and the sentence after the last * goes onto a new line, ideally as follows: The object of the following is to do: blah 1 (StackOverflow wants to add bullet points here, but I just need '*') blah 2 blah 3 blah 4. Some more extremely uninteresting text. Followed by yet another sentence full of extrememly uninteresting text. Thankfully this is the last sentence. It's easy enough to split the string by the * character and replace that with <br /> *. I'm using the following for that: string description = GetDescription(); description = description.Replace("*", "<br />*"); // it's going onto a web page. but the result this gives me is: The object of the following is to do: blah 1 blah 2 blah 3 blah 4. Some more extremely uninteresting text. Followed by yet another sentence full of extrememly uninteresting text. Thankfully this is the last sentence. I'm having a bit of difficulty identifying the fist sentence after the last '*' so I can put a break there too. Can somebody show me how to do this?

    Read the article

  • Winforms connection strings from App.config

    - by Geo Ego
    I have a Winforms app that I am developing in C# that will serve as a frontend for a SQL Server 2005 database. I rolled the executable out to a test machine and ran it. It worked perfectly fine on the test machine up until the last round of changes that I made. However, now on the test machine, it throws the following exception immediately upon opening: System.NullReferenceException: Object reference not set to an instance of an object. at PSRD_Specs_Database_Administrat.mainMenu.mainMenu_Load(Object sender, EventArgs e) at System.Windows.Forms.Form.OnLoad(EventArgs e) at System.Windows.Forms.Form.OnCreateControl() at System.Windows.Forms.Control.CreateControl(Boolean fIgnoreVisible) at System.Windows.Forms.Control.CreateControl() at System.Windows.Forms.Control.WmShowWindow(Message& m) at System.Windows.Forms.Control.WndProc(Message& m) at System.Windows.Forms.ScrollableControl.WndProc(Message& m) at System.Windows.Forms.ContainerControl.WndProc(Message& m) at System.Windows.Forms.Form.WmShowWindow(Message& m) at System.Windows.Forms.Form.WndProc(Message& m) at System.Windows.Forms.Control.ControlNativeWindow.OnMessage(Message& m) at System.Windows.Forms.Control.ControlNativeWindow.WndProc(Message& m) at System.Windows.Forms.NativeWindow.Callback(IntPtr hWnd, Int32 msg, IntPtr wparam, IntPtr lparam) The only thing that I changed in this version that pertains to mainMenu_Load is the way that the connection string to the database is called. Previously, I had set a string with the connection string on every form that I needed to call it from, like: string conString = "Data Source = SHAREPOINT;Trusted_Connection = yes;" + "database = CustomerDatabase;connection timeout = 15"; As my app grew and I added forms to it, I decided to add an App.config to the project. I defined the connection string in it: <connectionStrings> <add name="conString" providerName="System.Data.SqlClient" connectionString="Data Source = SHAREPOINT;Trusted_Connection = yes;database = CustomerDatabase;connection timeout = 15" /> </connectionStrings> I then created a static string that would return the conString: public static string GetConnectionString(string conName) { string strReturn = string.Empty; if (!(string.IsNullOrEmpty(conName))) { strReturn = ConfigurationManager.ConnectionStrings[conName].ConnectionString; } else { strReturn = ConfigurationManager.ConnectionStrings["conString"].ConnectionString; } return strReturn; } I removed the conString variable and now call the connection string like so: PublicMethods.GetConnectionString("conString").ToString() It appears that this is giving me the error. I changed these instances to directly call the connection string from App.config without using GetConnectionString. For instance, in a SQLConnection: using (SqlConnection con = new SqlConnection(ConfigurationManager.ConnectionStrings["conString"].ConnectionString)) This also threw the exception. However, when I went back to using the conString variable on each form, I had no issues. What I don't understand is why all three methods work fine on my development machine, while using the App.config directly or via the static string I created throw exceptions.

    Read the article

  • StringIndexOutOfBoundsException error in main method

    - by Ro Siv
    I am obtaining a StringIndexOutOfBoundsError when running my main method. Here is the output of my program in the command line. "Please enter the shift, 1 for day, 2 for night" 1 "you entered a number for the shift" "Please enter the hourly pay Rate" 2 "you entered a number for the pay Rate" "Please enter the employees name" brenda "cat6b" "your value you entered is correct 0-9 or a - z" "Please enter the employee number" 100e "cat41" "your value you entered is correct 0-9 or a - z" "Please enter current date in XXYYZZZZ format, X is day, Y is month, Z is year" 10203933 "cat81 " "your value you entered is correct 0-9 or a - z" 90 1 valye of array is 1 81 0 value of array is 0 82 2 value of array is 2 83 0 value of array is 0 84 3 value of array is 3 85 9 value of array is 9 86 3 value of array is 3 87 3 value of array is 3 "Exception in thread "main" java.lang.StringIndexOutOfBoundsException: String index out of range: 8 at java.lang.String.charAt(String.java:658) at ProductionWorker<init>(ProductionWorker.java:66) at labBookFiftyFour.main(labBookFiftyFour.java:58)" "Press any key to continue . . ." Ignore the cat parts in the code, i was using a println statement to test the code. Ignore the value of array output as well, as i wanted to use an array in the program later on. Here is my main method. import java.math.*; import java.text.DecimalFormat; import java.io.*; import java.util.*; public class labBookFiftyFour { public static void main(String[] args) { Scanner myInput = new Scanner(System.in); int shift = -1; double pRate = -2; String name = " "; String number = " "; String date = " "; while(shift < 0 || pRate < 0 ) { System.out.println("Please enter the shift, 1 for day, 2 for night"); if(myInput.hasNextInt()){ System.out.println("you entered a number for the shift"); shift = myInput.nextInt(); } System.out.println("Please enter the hourly pay Rate"); if(myInput.hasNextDouble()){ System.out.println("you entered a number for the pay Rate"); pRate = myInput.nextDouble(); } else if (myInput.hasNext()) { System.out.println("Please enter a proper value"); myInput.next(); } else { System.err.println("No more input"); System.exit(1); } } myInput.nextLine(); //consume newLine System.out.println("Please enter the employees name"); name = myInput.nextLine(); //use your isValid method if(isValid(name)) { System.out.println("your value you entered is correct 0-9 or a - z "); } System.out.println("Please enter the employee number"); number = myInput.nextLine(); //use your isValid method if(isValid(number)) { System.out.println("your value you entered is correct 0-9 or a - z "); } System.out.println("Please enter current date in XXYYZZZZ format, X is day, Y is month, Z is year"); date = myInput.nextLine(); //use your isValid method if(isValid(date)) { System.out.println("your value you entered is correct 0-9 or a - z "); } ProductionWorker myWorker = new ProductionWorker(shift, pRate, name, number, date); //int day and night , double payRate System.out.println("THis is the shift " + myWorker.getShift() + " This is the pay Rate " + myWorker.getPRate() + " " + myWorker.getName() + " " + myWorker.getNumber() + " " + myWorker.getDate()); } //Made this method for testing String input for 0-9 or a - z values , put AFTER main method, but before end of class public static boolean isValid(String stringName) //This method has to be static, for some reason? { System.out.println("cat" + stringName.length() + stringName.charAt(0)); boolean flag = true; int index = 0; while(index < stringName.length()) { if(Character.isLetterOrDigit(stringName.charAt(index))) { flag = true; } else { flag = false; } ++index; } return flag; } } Here is my employeeOne. java Superclass public class employeeOne { private String name; private String number; private String date; public employeeOne(String name, String number, String date) { this.name = name; this.number = number; this.date = date; } public String getName() { return name; } public String getNumber() { return number; } public String getDate() { return date; } } Here is my ProductionWorker.java subclass, which extends employeeOne public class ProductionWorker extends employeeOne { private int shift; //shift represents day or night, day = 1, night = 2 private double pRate; //hourly pay rate public ProductionWorker(int shift, double pRate, String name, String number, String date) { super(name, number, date); this.shift = shift; if(this.shift >= 3 || this.shift <= 0) { System.out.println("You entered an out of bounds shift date, enter 1 for day or 2 for night, else shift will be day"); this.shift = 1; } this.pRate = pRate; boolean goodSoFar = true; int indexNum = 0; int indexDate = 0; if(name.length() <= 10 && number.length() <= 4 && date.length() < 9 ) { goodSoFar = true; } else { goodSoFar = false; } while(goodSoFar && indexNum < 3) //XXXL XXX digits 1-9, L is a letter A -M { if(Character.isDigit(number.charAt(indexNum))) { goodSoFar = true; } else { goodSoFar = false; } ++indexNum; } while(goodSoFar && indexNum < 4) { if(Character.isLetter(number.charAt(indexNum))) { goodSoFar = true; } else if(Character.isDigit(number.charAt(indexNum))) { goodSoFar = false; } else if(Character.isDigit(number.charAt(indexNum)) == false && Character.isLetter(number.charAt(indexNum)) == false) { goodSoFar = false; } ++indexNum; } int[] dateValues = new int[date.length()]; while(goodSoFar && indexDate <= date.length()) //XXYYZZZZ { System.out.println("" + date.length() + indexDate + " " + date.charAt(indexDate)); if(Character.isDigit(date.charAt(indexDate))) { dateValues[indexDate] = Character.getNumericValue(date.charAt(indexDate)); System.out.println("value of array is " + dateValues[indexDate]); ++indexDate; } else { goodSoFar = false; } } if(goodSoFar) { System.out.println("your input is good so far"); } else { System.out.println("your input is wrong for name or number or date"); } } public int getShift() { return shift; } public double getPRate() { return pRate; } }

    Read the article

  • Best practice Java - String array constant and indexing it

    - by Pramod
    For string constants its usual to use a class with final String values. But whats the best practice for storing string array. I want to store different categories in a constant array and everytime a category has been selected, I want to know which category it belongs to and process based on that. Addition : To make it more clear, I have a categories A,B,C,D,E which is a constant array. Whenever a user clicks one of the items(button will have those texts) I should know which item was clicked and do processing on that. I can define an enum(say cat) and everytime do if clickedItem == cat.A .... else if clickedItem = cat.B .... else if .... or even register listeners for each item seperately. But I wanted to know the best practice for doing handling these kind of problems.

    Read the article

  • Regex to String generation

    - by Mifmif
    Let's say that we have a regex and an index i , if we suppose that the set of string that match our regex are sorted in a lexicographical order, how could we get the i element of this list ? Edit : I added this simple example for more explanation : input : regex="[a-c]{1,2}"; index=4; in this case the ordered list of string that matches this regex contains those elements : a aa ab ac b ba bb bc c ca cb cc output : the 4th element which is ac ps: it's known that the string list that match the regex have infinite element, this doesn't have an impact on the proccess of extracting the element in the given index.

    Read the article

  • From the Coalface - 4 - Getting a connection string

    - by TATWORTH
    Creating a connection string by hand is quite difficult, however you create a connection string as follows: 1) Create an empty text file in windows explorer and rename it to X.UDL 2) Double click on it and the datalink provider dialog will appear. 3) Select the provider tab. Find the provider for your data access method and click next. 4) Select your source  5) Test the connection and save it. 6) Open X.UDL with a text editor to see your connections string. You can also look at http://www.connectionstrings.com/ for examples of connection strings.

    Read the article

  • how to use string::find to look for a word rather each character seperately

    - by RubyKing
    Hello how would I look through a string for a word rather then each character in that word. I have my code here and it always seems to find everything that is .obj even if its o or b or j or "." is there anyway to get passed this here is my code? I checked the docuementation here link but nothing returned any results I craved so hard string &str = *it; if(it->find(".obj")) { cout << "Found .Obj" << endl; } I also tried to use string::compare but that failed :(

    Read the article

  • Can not parse tabular information from html document.

    - by Harikrishna
    I am parsing many html documents.I am using html agility pack And I want to parse the tabular information from each document. And there may be any number of tables in each document.But I want to extract only one table from each document which has column header name NAME,PHONE NO,ADDRESS.And this table can be anywhere in the document,like in the document there is ten tables and from ten table there is one table which has many nested tables and from nested table there may be a table what I want to extract means table can be anywhere in the document and I want to find that table from the document by column header name.If I got that table then I want to then extract the information from that table. Now I can find the table which has column header NAME,PHONE NO,ADDRESS and also can extract the information from that.I am doing for that is, first I find the all tables in a document by foreach (var table in doc.DocumentNode.Descendants("table")) then for each table got I find the row for each table like, var rows = table.Descendants("tr"); and then for each row I am checking that row has that header name NAME,ADDRESS,PHONENO and if it is then I skip that row and extract all information after that row foreach (var row in rows.Skip(rowNo)) { var data = new List<string>(); foreach (var column in row.Descendants("td")) { data.Add(properText); } } Such that I am extracting all information from almost many document. But now problem is sometimes what happened that in some document I can not parse the information.Like a document in which there are like 10 tables and from these 10 tables 1 table is like there are many nested tables in that table. And from these nested tables I want to find the table which tabel has column header like NAME,ADDRESS,PHONE NO.So if table may be anywhere in the document even in the nested tables or anywhere it can be find through column header name.So I can parse the information from that table and skip the outer tabular information of that table.

    Read the article

  • Can not parse table information from html document.

    - by Harikrishna
    I am parsing many html documents.I am using html agility pack And I want to parse the tabular information from each document. And there may be any number of tables in each document.But I want to extract only one table from each document which has column header name NAME,PHONE NO,ADDRESS.And this table can be anywhere in the document,like in the document there is ten tables and from ten table there is one table which has many nested tables and from nested table there may be a table what I want to extract means table can be anywhere in the document and I want to find that table from the document by column header name.If I got that table then I want to then extract the information from that table. Now I can find the table which has column header NAME,PHONE NO,ADDRESS and also can extract the information from that.I am doing for that is, first I find the all tables in a document by foreach (var table in doc.DocumentNode.Descendants("table")) then for each table got I find the row for each table like, var rows = table.Descendants("tr"); and then for each row I am checking that row has that header name NAME,ADDRESS,PHONENO and if it is then I skip that row and extract all information after that row foreach (var row in rows.Skip(rowNo)) { var data = new List<string>(); foreach (var column in row.Descendants("td")) { data.Add(properText); } } Such that I am extracting all information from almost many document. But now problem is sometimes what happened that in some document I can not parse the information.Like a document in which there are like 10 tables and from these 10 tables 1 table is like there are many nested tables in that table. And from these nested tables I want to find the table which tabel has column header like NAME,ADDRESS,PHONE NO.So if table may be anywhere in the document even in the nested tables or anywhere it can be find through column header name.So I can parse the information from that table and skip the outer tabular information from that table.

    Read the article

< Previous Page | 58 59 60 61 62 63 64 65 66 67 68 69  | Next Page >