Search Results

Search found 15985 results on 640 pages for 'debug print'.

Page 624/640 | < Previous Page | 620 621 622 623 624 625 626 627 628 629 630 631  | Next Page >

• ASP.NET MVC + MySql Membership Provider, user cannot login

  - by Jason Miesionczek

  Hello, I've been playing around with using MySql as the membership provider for asp.net mvc forms authentication. I've got things configured correctly as far as i can tell, and i can create users via both the register action and asp.net web config site. however, when i try to login with one of the users, it does not work. it returns an error as if i had entered a wrong password, or if the account doesn't exist. i have verified in the database that the account does exist. I've followed the instructions here for reference: http://blog.tchami.com/post/ASPNET-MVC-2-and-MySQL-Membership-Provider.aspx here is my web.config: <?xml version="1.0"?> <!-- For more information on how to configure your ASP.NET application, please visit http://go.microsoft.com/fwlink/?LinkId=152368 --> <configuration> <connectionStrings> <add name="MySQLConn" connectionString="Server=localhost;Database=intereditor;Uid=<user>;Pwd=<password>;"/> </connectionStrings> <system.web> <compilation debug="true" targetFramework="4.0"> <assemblies> <add assembly="System.Web.Abstractions, Version=4.0.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" /> <add assembly="System.Web.Routing, Version=4.0.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" /> <add assembly="System.Web.Mvc, Version=2.0.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" /> </assemblies> </compilation> <authentication mode="Forms"> <forms loginUrl="~/Account/LogOn" timeout="2880" name=".ASPXFORM$" path="/" requireSSL="false" slidingExpiration="true" enableCrossAppRedirects="false" /> </authentication> <membership defaultProvider="MySqlMembershipProvider"> <providers> <clear/> <add name="MySqlMembershipProvider" type="MySql.Web.Security.MySQLMembershipProvider,MySql.Web,Version=6.3.4.0, Culture=neutral,PublicKeyToken=c5687fc88969c44d" autogenerateschema="true" connectionStringName="MySQLConn" enablePasswordRetrieval="false" enablePasswordReset="true" requiresQuestionAndAnswer="false" requiresUniqueEmail="false" passwordFormat="Hashed" maxInvalidPasswordAttempts="5" minRequiredPasswordLength="6" minRequiredNonalphanumericCharacters="0" passwordAttemptWindow="10" passwordStrengthRegularExpression="" applicationName="/" /> </providers> </membership> <profile defaultProvider="MySqlProfileProvider"> <providers> <clear/> <add name="MySqlProfileProvider" type="MySql.Web.Profile.MySQLProfileProvider,MySql.Web,Version=6.3.4.0,Culture=neutral,PublicKeyToken=c5687fc88969c44d" connectionStringName="MySQLConn" applicationName="/" /> </providers> </profile> <roleManager enabled="true" defaultProvider="MySqlRoleProvider"> <providers> <clear /> <add name="MySqlRoleProvider" type="MySql.Web.Security.MySQLRoleProvider,MySql.Web,Version=6.3.4.0,Culture=neutral,PublicKeyToken=c5687fc88969c44d" connectionStringName="MySQLConn" applicationName="/" /> </providers> </roleManager> <pages> <namespaces> <add namespace="System.Web.Mvc" /> <add namespace="System.Web.Mvc.Ajax" /> <add namespace="System.Web.Mvc.Html" /> <add namespace="System.Web.Routing" /> </namespaces> </pages> </system.web> <system.webServer> <validation validateIntegratedModeConfiguration="false"/> <modules runAllManagedModulesForAllRequests="true"/> </system.webServer> <runtime> <assemblyBinding xmlns="urn:schemas-microsoft-com:asm.v1"> <dependentAssembly> <assemblyIdentity name="System.Web.Mvc" publicKeyToken="31bf3856ad364e35" /> <bindingRedirect oldVersion="1.0.0.0" newVersion="2.0.0.0" /> </dependentAssembly> </assemblyBinding> </runtime> </configuration> Can anyone please help me identify what is wrong so that users can login? UPDATE So after debugging the login process in the code of the membership provider itself, i discovered that there is a bug in the provider. There is a discrepancy between the password hash that is stored in the database, and the has that is generated based on the inputted password. As a workaround for my issue, i changed the password format to 'encrpyted' and added a machine key to my web.config. I am still interested in figuring out the issue with the hashed format in the provider, and will spend some more time debugging it, and if i can figure out the problem, i will put together a patch and submit it.

  Read the article

• h:commandButton not working within PrimeFaces p:dataTable

  - by JamesB

  I have a PrimeFaces datatable. For each row in this table, I want to allow the user to update/delete the row entry (a user). <html xmlns="http://www.w3.org/1999/xhtml" xmlns:f="http://java.sun.com/jsf/core" xmlns:h="http://java.sun.com/jsf/html" xmlns:p="http://primefaces.prime.com.tr/ui"> <h:head> <link type="text/css" rel="stylesheet" href="themes/bluesky/skin.css" /> </h:head> <h:body> <center> <h:form> <p:panel id="viewUsersPanel" header="View Users"> <p:dataTable var="user" value="#{uController.users}" emptyMessage="No Users Found."> <p:column style="text-align: center;"> <f:facet name="header"> <h:outputText value="Name" /> </f:facet> <h:outputText value="#{user.name}" /> </p:column> <p:column style="text-align: center;"> <f:facet name="header"> <h:outputText value="Postal Address" /> </f:facet> <h:outputText value="#{user.address}" /> </p:column> <p:column style="text-align: center;"> <f:facet name="header"> <h:outputText value="Phone Number" /> </f:facet> <h:outputText value="#{user.phone}" /> </p:column> <p:column style="text-align: center;"> <f:facet name="header"> <h:outputText value="Email Address" /> </f:facet> <h:outputText value="#{user.email}" /> </p:column> <p:column style="text-align: center;"> <f:facet name="header"> <h:outputText value="DOB" /> </f:facet> <h:outputText value="#{user.dob}"> <f:convertDateTime pattern="dd-MMM-yyyy" /> </h:outputText> </p:column> <p:column style="text-align: center;"> <f:facet name="header"> <h:outputText value="No. Memberships" /> </f:facet> <h:outputText value="#{user.numberOfMemberships}" /> </p:column> <p:column style="text-align: center;"> <f:facet name="header"> <h:outputText value="Actions" /> </f:facet> <h:commandButton value="Update" action="#{uController.update}" /> <h:commandButton value="Delete" action="#{uController.delete}" /> </p:column> </p:dataTable> <h:panelGrid columns="2" cellpadding="2" id="footerPanelGrid" border="0"> <h:commandButton action="#{uController.home}" value="Home Page" /> </h:panelGrid> </p:panel> </h:form> </center> </h:body> </html> However, neither of the buttons work. Instead they appear to simply refresh the view page. I have ran the app in debug and neither update or delete method is hit. I suspect this may be due to using h:commandButton within a p:dataTable. However, I have also tried p:commandButton but to no avail. For reference, here is a snippet of the UserController class: @ManagedBean(name="uController") public class UserController extends AbstractController { private Collection<User> users; ... public String update() { System.out.println("Ready for update"); return "update-user"; } public String delete() { System.out.println("Ready for delete"); return "delete-user"; } ... }

  Read the article

• Jquery Live Function

  - by marharépa

  Hi! I want to make this script to work as LIVE() function. Please help me! $(".img img").each(function() { $(this).cjObjectScaler({ destElem: $(this).parent(), method: "fit" }); }); the cjObjectScaler script (called in the html header) is this: (thanks for Doug Jones) (function ($) { jQuery.fn.imagesLoaded = function (callback) { var elems = this.filter('img'), len = elems.length; elems.bind('load', function () { if (--len <= 0) { callback.call(elems, this); } }).each(function () { // cached images don't fire load sometimes, so we reset src. if (this.complete || this.complete === undefined) { var src = this.src; // webkit hack from http://groups.google.com/group/jquery-dev/browse_thread/thread/eee6ab7b2da50e1f this.src = '#'; this.src = src; } }); }; })(jQuery); /* CJ Object Scaler */ (function ($) { jQuery.fn.cjObjectScaler = function (options) { /* user variables (settings) ***************************************/ var settings = { // must be a jQuery object method: "fill", // the parent object to scale our object into destElem: null, // fit|fill fade: 0 // if positive value, do hide/fadeIn }; /* system variables ***************************************/ var sys = { // function parameters version: '2.1.1', elem: null }; /* scale the image ***************************************/ function scaleObj(obj) { // declare some local variables var destW = jQuery(settings.destElem).width(), destH = jQuery(settings.destElem).height(), ratioX, ratioY, scale, newWidth, newHeight, borderW = parseInt(jQuery(obj).css("borderLeftWidth"), 10) + parseInt(jQuery(obj).css("borderRightWidth"), 10), borderH = parseInt(jQuery(obj).css("borderTopWidth"), 10) + parseInt(jQuery(obj).css("borderBottomWidth"), 10), objW = jQuery(obj).width(), objH = jQuery(obj).height(); // check for valid border values. IE takes in account border size when calculating width/height so just set to 0 borderW = isNaN(borderW) ? 0 : borderW; borderH = isNaN(borderH) ? 0 : borderH; // calculate scale ratios ratioX = destW / jQuery(obj).width(); ratioY = destH / jQuery(obj).height(); // Determine which algorithm to use if (!jQuery(obj).hasClass("cf_image_scaler_fill") && (jQuery(obj).hasClass("cf_image_scaler_fit") || settings.method === "fit")) { scale = ratioX < ratioY ? ratioX : ratioY; } else if (!jQuery(obj).hasClass("cf_image_scaler_fit") && (jQuery(obj).hasClass("cf_image_scaler_fill") || settings.method === "fill")) { scale = ratioX < ratioY ? ratioX : ratioY; } // calculate our new image dimensions newWidth = parseInt(jQuery(obj).width() * scale, 10) - borderW; newHeight = parseInt(jQuery(obj).height() * scale, 10) - borderH; // Set new dimensions & offset jQuery(obj).css({ "width": newWidth + "px", "height": newHeight + "px"//, // "position": "absolute", // "top": (parseInt((destH - newHeight) / 2, 10) - parseInt(borderH / 2, 10)) + "px", // "left": (parseInt((destW - newWidth) / 2, 10) - parseInt(borderW / 2, 10)) + "px" }).attr({ "width": newWidth, "height": newHeight }); // do our fancy fade in, if user supplied a fade amount if (settings.fade > 0) { jQuery(obj).fadeIn(settings.fade); } } /* set up any user passed variables ***************************************/ if (options) { jQuery.extend(settings, options); } /* main ***************************************/ return this.each(function () { sys.elem = this; // if they don't provide a destObject, use parent if (settings.destElem === null) { settings.destElem = jQuery(sys.elem).parent(); } // need to make sure the user set the parent's position. Things go bonker's if not set. // valid values: absolute|relative|fixed if (jQuery(settings.destElem).css("position") === "static") { jQuery(settings.destElem).css({ "position": "relative" }); } // if our object to scale is an image, we need to make sure it's loaded before we continue. if (typeof sys.elem === "object" && typeof settings.destElem === "object" && typeof settings.method === "string") { // if the user supplied a fade amount, hide our image if (settings.fade > 0) { jQuery(sys.elem).hide(); } if (sys.elem.nodeName === "IMG") { // to fix the weird width/height caching issue we set the image dimensions to be auto; jQuery(sys.elem).width("auto"); jQuery(sys.elem).height("auto"); // wait until the image is loaded before scaling jQuery(sys.elem).imagesLoaded(function () { scaleObj(this); }); } else { scaleObj(jQuery(sys.elem)); } } else { console.debug("CJ Object Scaler could not initialize."); return; } }); }; })(jQuery);

  Read the article

• capturing video from ip camera

  - by Ruby

  I am trying to capture video from ip camera into my application , its giving exception com.sun.image.codec.jpeg.ImageFormatException: Not a JPEG file: starts with 0x0d 0x0a at sun.awt.image.codec.JPEGImageDecoderImpl.readJPEGStream(Native Method) at sun.awt.image.codec.JPEGImageDecoderImpl.decodeAsBufferedImage(Unknown Source) at test.AxisCamera1.readJPG(AxisCamera1.java:130) at test.AxisCamera1.readMJPGStream(AxisCamera1.java:121) at test.AxisCamera1.readStream(AxisCamera1.java:100) at test.AxisCamera1.run(AxisCamera1.java:171) at java.lang.Thread.run(Unknown Source) its giving exception at image = decoder.decodeAsBufferedImage(); Here is the code i am trying private static final long serialVersionUID = 1L; public boolean useMJPGStream = true; public String jpgURL = "http://ip here/video.cgi/jpg/image.cgi?resolution=640×480"; public String mjpgURL = "http://ip here /video.cgi/mjpg/video.cgi?resolution=640×480"; DataInputStream dis; private BufferedImage image = null; public Dimension imageSize = null; public boolean connected = false; private boolean initCompleted = false; HttpURLConnection huc = null; Component parent; /** Creates a new instance of AxisCamera */ public AxisCamera1(Component parent_) { parent = parent_; } public void connect() { try { URL u = new URL(useMJPGStream ? mjpgURL : jpgURL); huc = (HttpURLConnection) u.openConnection(); // System.out.println(huc.getContentType()); InputStream is = huc.getInputStream(); connected = true; BufferedInputStream bis = new BufferedInputStream(is); dis = new DataInputStream(bis); if (!initCompleted) initDisplay(); } catch (IOException e) { // incase no connection exists wait and try // again, instead of printing the error try { huc.disconnect(); Thread.sleep(60); } catch (InterruptedException ie) { huc.disconnect(); connect(); } connect(); } catch (Exception e) { ; } } public void initDisplay() { // setup the display if (useMJPGStream) readMJPGStream(); else { readJPG(); disconnect(); } imageSize = new Dimension(image.getWidth(this), image.getHeight(this)); setPreferredSize(imageSize); parent.setSize(imageSize); parent.validate(); initCompleted = true; } public void disconnect() { try { if (connected) { dis.close(); connected = false; } } catch (Exception e) { ; } } public void paint(Graphics g) { // used to set the image on the panel if (image != null) g.drawImage(image, 0, 0, this); } public void readStream() { // the basic method to continuously read the // stream try { if (useMJPGStream) { while (true) { readMJPGStream(); parent.repaint(); } } else { while (true) { connect(); readJPG(); parent.repaint(); disconnect(); } } } catch (Exception e) { ; } } public void readMJPGStream() { // preprocess the mjpg stream to remove the // mjpg encapsulation readLine(3, dis); // discard the first 3 lines readJPG(); readLine(2, dis); // discard the last two lines } public void readJPG() { // read the embedded jpeg image try { JPEGImageDecoder decoder = JPEGCodec.createJPEGDecoder(dis); image = decoder.decodeAsBufferedImage(); } catch (Exception e) { e.printStackTrace(); disconnect(); } } public void readLine(int n, DataInputStream dis) { // used to strip out the // header lines for (int i = 0; i < n; i++) { readLine(dis); } } public void readLine(DataInputStream dis) { try { boolean end = false; String lineEnd = "\n"; // assumes that the end of the line is marked // with this byte[] lineEndBytes = lineEnd.getBytes(); byte[] byteBuf = new byte[lineEndBytes.length]; while (!end) { dis.read(byteBuf, 0, lineEndBytes.length); String t = new String(byteBuf); System.out.print(t); // uncomment if you want to see what the // lines actually look like if (t.equals(lineEnd)) end = true; } } catch (Exception e) { e.printStackTrace(); } } public void run() { System.out.println("in Run..................."); connect(); readStream(); } @SuppressWarnings("deprecation") public static void main(String[] args) { JFrame jframe = new JFrame(); jframe.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); AxisCamera1 axPanel = new AxisCamera1(jframe); new Thread(axPanel).start(); jframe.getContentPane().add(axPanel); jframe.pack(); jframe.show(); } } Any suggestions what I am doing wrong here??

  Read the article

• How to get predecessor and successors from an adjacency matrix

  - by NickTFried

  Hi I am am trying to complete an assignment, where it is ok to consult the online community. I have to create a graph class that ultimately can do Breadth First Search and Depth First Search. I have been able to implement those algorithms successfully however another requirement is to be able to get the successors and predecessors and detect if two vertices are either predecessors or successors for each other. I'm having trouble thinking of a way to do this. I will post my code below, if anyone has any suggestions it would be greatly appreciated. import java.util.ArrayList; import java.util.Iterator; import java.util.LinkedList; import java.util.Queue; import java.util.Stack; public class Graph<T> { public Vertex<T> root; public ArrayList<Vertex<T>> vertices=new ArrayList<Vertex<T>>(); public int[][] adjMatrix; int size; private ArrayList<Vertex<T>> dfsArrList; private ArrayList<Vertex<T>> bfsArrList; public void setRootVertex(Vertex<T> n) { this.root=n; } public Vertex<T> getRootVertex() { return this.root; } public void addVertex(Vertex<T> n) { vertices.add(n); } public void removeVertex(int loc){ vertices.remove(loc); } public void addEdge(Vertex<T> start,Vertex<T> end) { if(adjMatrix==null) { size=vertices.size(); adjMatrix=new int[size][size]; } int startIndex=vertices.indexOf(start); int endIndex=vertices.indexOf(end); adjMatrix[startIndex][endIndex]=1; adjMatrix[endIndex][startIndex]=1; } public void removeEdge(Vertex<T> v1, Vertex<T> v2){ int startIndex=vertices.indexOf(v1); int endIndex=vertices.indexOf(v2); adjMatrix[startIndex][endIndex]=1; adjMatrix[endIndex][startIndex]=1; } public int countVertices(){ int ver = vertices.size(); return ver; } /* public boolean isPredecessor( Vertex<T> a, Vertex<T> b){ for() return true; }*/ /* public boolean isSuccessor( Vertex<T> a, Vertex<T> b){ for() return true; }*/ public void getSuccessors(Vertex<T> v1){ } public void getPredessors(Vertex<T> v1){ } private Vertex<T> getUnvisitedChildNode(Vertex<T> n) { int index=vertices.indexOf(n); int j=0; while(j<size) { if(adjMatrix[index][j]==1 && vertices.get(j).visited==false) { return vertices.get(j); } j++; } return null; } public Iterator<Vertex<T>> bfs() { Queue<Vertex<T>> q=new LinkedList<Vertex<T>>(); q.add(this.root); printVertex(this.root); root.visited=true; while(!q.isEmpty()) { Vertex<T> n=q.remove(); Vertex<T> child=null; while((child=getUnvisitedChildNode(n))!=null) { child.visited=true; bfsArrList.add(child); q.add(child); } } clearVertices(); return bfsArrList.iterator(); } public Iterator<Vertex<T>> dfs() { Stack<Vertex<T>> s=new Stack<Vertex<T>>(); s.push(this.root); root.visited=true; printVertex(root); while(!s.isEmpty()) { Vertex<T> n=s.peek(); Vertex<T> child=getUnvisitedChildNode(n); if(child!=null) { child.visited=true; dfsArrList.add(child); s.push(child); } else { s.pop(); } } clearVertices(); return dfsArrList.iterator(); } private void clearVertices() { int i=0; while(i<size) { Vertex<T> n=vertices.get(i); n.visited=false; i++; } } private void printVertex(Vertex<T> n) { System.out.print(n.label+" "); } }

  Read the article

• Can't get Zend Studio and PHPunit to work together

  - by dimbo

  I have a created a simple doctrine2/zend skeleton project and am trying to get unit testing working with zend studio. The tests work perfectly through the PHPunit CLI but I just can't get them to work in zend studio. It comes up with an error saying : 'No Tests was executed' and the following output in the debug window : X-Powered-By: PHP/5.2.14 ZendServer/5.0 Set-Cookie: ZendDebuggerCookie=127.0.0.1%3A10137%3A0||084|77742D65|1016; path=/ Content-type: text/html <br /> <b>Warning</b>: Unexpected character in input: '\' (ASCII=92) state=1 in <b>/var/www/z2d2/tests/application/models/UserModelTest.php</b> on line <b>8</b><br /> <br /> <b>Warning</b>: Unexpected character in input: '\' (ASCII=92) state=1 in <b>/var/www/z2d2/tests/application/models/UserModelTest.php</b> on line <b>8</b><br /> <br /> <b>Parse error</b>: syntax error, unexpected T_STRING in <b>/var/www/z2d2/tests/application/models/UserModelTest.php</b> on line <b>8</b><br /> The test is as follows: <?php require_once 'Zend/Application.php'; require_once 'Zend/Test/PHPUnit/ControllerTestCase.php'; abstract class ControllerTestCase extends Zend_Test_PHPUnit_ControllerTestCase { public function setUp() { $this->bootstrap = new Zend_Application( 'testing', APPLICATION_PATH . '/configs/application.ini' ); parent::setUp(); } public function tearDown() { parent::tearDown(); } } <?php class IndexControllerTest extends ControllerTestCase { public function testDoesHomePageExist() { $this->dispatch('/'); $this->assertController('index'); $this->assertAction('index'); } } <?php class ModelTestCase extends PHPUnit_Framework_TestCase { protected $em; public function setUp() { $application = new Zend_Application( 'testing', APPLICATION_PATH . '/configs/application.ini' ); $bootstrap = $application->bootstrap()->getBootstrap(); $this->em = $bootstrap->getResource('entityManager'); parent::setUp(); } public function tearDown() { parent::tearDown(); } } <?php class UserModelTest extends ModelTestCase { public function testCanInstantiateUser() { $this->assertInstanceOf('\Entities\User', new \Entities\User); } public function testCanSaveAndRetrieveUser() { $user = new \Entities\User; $user->setFirstname('wjgilmore-test'); $user->setemail('[email protected]'); $user->setpassword('jason'); $user->setAddress1('calle san antonio'); $user->setAddress2('albayzin'); $user->setSurname('testman'); $user->setConfirmed(TRUE); $this->em->persist($user); $this->em->flush(); $user = $this->em->getRepository('Entities\User')->findOneByFirstname('wjgilmore-test'); $this->assertEquals('wjgilmore-test', $user->getFirstname()); } public function testCanDeleteUser() { $user = new \Entities\User; $user = $this->em->getRepository('Entities\User')->findOneByFirstname('wjgilmore-test'); $this->em->remove($user); $this->em->flush(); } } And the bootstrap: <?php define('BASE_PATH', realpath(dirname(__FILE__) . '/../../')); define('APPLICATION_PATH', BASE_PATH . '/application'); set_include_path( '.' . PATH_SEPARATOR . BASE_PATH . '/library' . PATH_SEPARATOR . get_include_path() ); require_once 'controllers/ControllerTestCase.php'; require_once 'models/ModelTestCase.php'; Here is the new error after setting PHP Executable to 5.3 as Gordon suggested: X-Powered-By: PHP/5.3.3 ZendServer/5.0 Set-Cookie: ZendDebuggerCookie=127.0.0.1%3A10137%3A0||084|77742D65|1000; path=/ Content-type: text/html <br /> <b>Fatal error</b>: Class 'ModelTestCase' not found in <b>/var/www/z2d2/tests/application/models/UserModelTest.php</b> on line <b>4</b><br />

  Read the article

• Ignoring focusLost(), SWT.Verify, or other SWT listeners in Java code.

  - by Zoot

  Outside of the actual SWT listener, is there any way to ignore a listener via code? For example, I have a java program that implements SWT Text Widgets, and the widgets have: SWT.Verify listeners to filter out unwanted text input. ModifyListeners to wait for the correct number of valid input characters and automatically set focus (using setFocus())to the next valid field, skipping the other text widgets in the tab order. focusLost(FocusEvent) FocusListeners that wait for the loss of focus from the text widget to perform additional input verification and execute an SQL query based on the user input. The issue I run into is clearing the text widgets. One of the widgets has the format "####-##" (Four Numbers, a hyphen, then two numbers) and I have implemented this listener, which is a modified version of SWT Snippet Snippet179. The initial text for this text widget is " - " to provide visual feedback to the user as to the expected format. Only numbers are acceptable input, and the program automatically skips past the hyphen at the appropriate point. /* * This listener was adapted from the "verify input in a template (YYYY/MM/DD)" SWT Code * Snippet (also known as Snippet179), from the Snippets page of the SWT Project. * SWT Code Snippets can be found at: * http://www.eclipse.org/swt/snippets/ */ textBox.addListener(SWT.Verify, new Listener() { boolean ignore; public void handleEvent(Event e) { if (ignore) return; e.doit = false; StringBuffer buffer = new StringBuffer(e.text); char[] chars = new char[buffer.length()]; buffer.getChars(0, chars.length, chars, 0); if (e.character == '\b') { for (int i = e.start; i < e.end; i++) { switch (i) { case 0: /* [x]xxx-xx */ case 1: /* x[x]xx-xx */ case 2: /* xx[x]x-xx */ case 3: /* xxx[x]-xx */ case 5: /* xxxx-[x]x */ case 6: /* xxxx-x[x] */ { buffer.append(' '); break; } case 4: /* xxxx[-]xx */ { buffer.append('-'); break; } default: return; } } textBox.setSelection(e.start, e.start + buffer.length()); ignore = true; textBox.insert(buffer.toString()); ignore = false; textBox.setSelection(e.start, e.start); return; } int start = e.start; if (start > 6) return; int index = 0; for (int i = 0; i < chars.length; i++) { if (start + index == 4) { if (chars[i] == '-') { index++; continue; } buffer.insert(index++, '-'); } if (chars[i] < '0' || '9' < chars[i]) return; index++; } String newText = buffer.toString(); int length = newText.length(); textBox.setSelection(e.start, e.start + length); ignore = true; textBox.insert(newText); ignore = false; /* * After a valid key press, verifying if the input is completed * and passing the cursor to the next text box. */ if (7 == textBox.getCaretPosition()) { /* * Attempting to change the text after receiving a known valid input that has no results (0000-00). */ if ("0000-00".equals(textBox.getText())) { // "0000-00" is the special "Erase Me" code for these text boxes. ignore = true; textBox.setText(" - "); ignore = false; } // Changing focus to a different textBox by using "setFocus()" method. differentTextBox.setFocus(); } } } ); As you can see, the only method I've figured out to clear this text widget from a different point in the code is by assigning "0000-00" textBox.setText("000000") and checking for that input in the listener. When that input is received, the listener changes the text back to " - " (four spaces, a hyphen, then two spaces). There is also a focusLost Listener that parses this text widget for spaces, then in order to avoid unnecessary SQL queries, it clears/resets all fields if the input is invalid (i.e contains spaces). // Adding focus listener to textBox to wait for loss of focus to perform SQL statement. textBox.addFocusListener(new FocusAdapter() { @Override public void focusLost(FocusEvent evt) { // Get the contents of otherTextBox and textBox. (otherTextBox must be <= textBox) String boxFour = otherTextBox.getText(); String boxFive = textBox.getText(); // If either text box has spaces in it, don't perform the search. if (boxFour.contains(" ") || boxFive.contains(" ")) { // Don't perform SQL statements. Debug statement. System.out.println("Tray Position input contains spaces. Ignoring."); //Make all previous results invisible, if any. labels.setVisible(false); differentTextBox.setText(""); labelResults.setVisible(false); } else { //... Perform SQL statement ... } } } ); OK. Often, I use SWT MessageBox widgets in this code to communicate to the user, or wish to change the text widgets back to an empty state after verifying the input. The problem is that messageboxes seem to create a focusLost event, and using the .setText(string) method is subject to SWT.Verify listeners that are present on the text widget. Any suggestions as to selectively ignoring these listeners in code, but keeping them present for all other user input? Thank you in advance for your assistance.

  Read the article

• Qt drag & drop button; drop not detecting

  - by Thomas Verbeke

  I'm creating a 2D game in QT and i'm trying to implement a drag & drop into my program. For some reason the drop is not registered: qDebug should print a message on dropping but this doesn't happen. #include "dialog.h" #include "ui_dialog.h" #include "world.h" #include <vector> Dialog::Dialog(QWidget *parent) : QDialog(parent), ui(new Ui::Dialog) { ui->setupUi(this); scene = new QGraphicsScene(this); ui->graphicsView->setScene(scene); MySquare *item; QGraphicsRectItem *enemyItem; World *myWorld = new World(); std::vector<Tile*> tiles = myWorld->createWorld(":/texture.jpg"); int count = 0; foreach (Tile *tile, tiles){ count++; item = new MySquare(tile->getXPos()*4,tile->getYPos()*4,4,4); item->setBrush(QColor(tile->getValue()*255,tile->getValue()*255,tile->getValue()*255)); item->setAcceptDrops(true); scene->addItem(item); } player = new MySquare(10,20,10,10); player->setAcceptDrops(true); scene->addItem(player); //drag & drop part QPushButton *pushButton = new QPushButton("Click Me",this); connect(pushButton,SIGNAL(pressed()),this,SLOT(makeDrag())); setAcceptDrops(true); } void Dialog::makeDrag() { QDrag *dr = new QDrag(this); // The data to be transferred by the drag and drop operation is contained in a QMimeData object QMimeData *data = new QMimeData; data->setText("This is a test"); // Assign ownership of the QMimeData object to the QDrag object. dr->setMimeData(data); // Start the drag and drop operation dr->start(); } mysquare.cpp #include "mysquare.h" MySquare::MySquare(int _x,int _y, int _w, int _h) { isPlayer=false; Pressed=false; setFlag(ItemIsMovable); setFlag(ItemIsFocusable); setAcceptDrops(true); color=Qt::red; color_pressed = Qt::green; x = _x; y = _y; w = _w; h = _h; } QRectF MySquare::boundingRect() const { return QRectF(x,y,w,h); } void MySquare::paint(QPainter *painter, const QStyleOptionGraphicsItem *option, QWidget *widget) { QRectF rec = boundingRect(); QBrush brush(color); if (Pressed){ brush.setColor(color); } else { brush.setColor(color_pressed); } painter->fillRect(rec,brush); painter->drawRect(rec); } void MySquare::mousePressEvent(QGraphicsSceneMouseEvent *event) { Pressed=true; update(); QGraphicsItem::mousePressEvent(event); qDebug() << "mouse Pressed"; } void MySquare::mouseReleaseEvent(QGraphicsSceneMouseEvent *event) { Pressed=false; update(); QGraphicsItem::mousePressEvent(event); qDebug() << "mouse Released"; } void MySquare::keyPressEvent(QKeyEvent *event){ int x = pos().x(); int y = pos().y(); //key handling QGraphicsItem::keyPressEvent(event); } void MySquare::dropEvent(QDropEvent *event) { qDebug("dropEvent - square"); // Unpack dropped data and handle it the way you want qDebug("Contents: %s", event->mimeData()->text().toLatin1().data()); } void MySquare::dragMoveEvent(QDragMoveEvent *event){ qDebug("dragMoveEvent - square "); event->accept(); } void MySquare::dragEnterEvent(QDragEnterEvent *event){ event->setAccepted(true); qDebug("dragEnterEvent - square"); event->acceptProposedAction(); } void MySquare::setBrush(QColor _color){ color = _color; color_pressed = _color; update(); //repaint } edit; there is no problem with qDebug() i'm just using it to test them i'm inside the drag events..which i'm not

  Read the article

• Why can't my main class see the array in my calender class

  - by Rocky Celltick Eadie

  This is a homework problem. I'm already 5 days late and can't figure out what I'm doing wrong.. this is my 1st semester in Java and my first post on this site Here is the assignment.. Create a class called Calendar. The class should contain a variable called events that is a String array. The array should be created to hold 5 elements. Use a constant value to specify the array size. Do not hard code the array size. Initialize the array in the class constructor so that each element contains the string “ – No event planned – “. The class should contain a method called CreateEvent. This method should accept a String argument that contains a one-word user event and an integer argument that represents the day of the week. Monday should be represented by the number 1 and Friday should be represented by the number 5. Populate the events array with the event info passed into the method. Although the user will input one-word events, each event string should prepend the following string to each event: event_dayAppoinment: (where event_day is the day of the week) For example, if the user enters 1 and “doctor” , the first array element should read: Monday Appointment: doctor If the user enters 2 and “PTA” , the second array element should read: Tuesday Appointment: PTA Write a driver program (in a separate class) that creates and calls your Calendar class. Then use a loop to gather user input. Ask for the day (as an integer) and then ask for the event (as a one word string). Pass the integer and string to the Calendar object’s CreateEvent method. The user should be able enter 0 – 5 events. If the user enters -1, the loop should exit and your application should print out all the events in a tabular format. Your program should not allow the user to enter invalid values for the day of the week. Any input other than 1 – 5 or -1 for the day of the week would be considered invalid. Notes: When obtaining an integer from the user, you will need to use the nextInt() method on your Scanner object. When obtaining a string from a user, you will need to use the next() method on your Scanner object. Here is my code so far.. //DRIVER CLASS /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin class driver public class driver { /** * @paramargs the command line arguments */ //begin main method public static void main(String[] args) { //initiates scanner Scanner userInput = new Scanner (System.in); //declare variables int dayOfWeek; String userEvent; //creates object for calender class calendercalenderObject = new calender(); //user prompt System.out.println("Enter day of week for your event in the following format:"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //user prompt System.out.println("Please type in the name of your event"); //collect user input userEvent = userInput.next(); //begin while loop while (dayOfWeek != -1) { //test for valid day of week if ((dayOfWeek>=1) && (dayOfWeek<=5)){ //calls createEvent method in calender class and passes 2 variables calenderObject.createEvent(userEvent,dayOfWeek); } else { //error message System.out.println("You have entered an invalid number"); //user prompts System.out.println("Press -1 to quit or enter another day"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //end data validity test } //end while loop } //prints array to screen int i=0; for (i=0;i<events.length;i++){ System.out.println(events[i]); } //end main method } } /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin calender class public class calender { //creates events array String[] events = new String[5]; //begin calender class constructor public calender() { //Initializes array String[] events = {"-No event planned-","-No event planned-","-No event planned-","-No event planned-","-No event planned-"}; //end calender class constructor } //begin createEvent method public String[] createEvent (String userEvent, int dayOfWeek){ //Start switch test switch (dayOfWeek){ case 1: events[0] = ("Monday Appoinment:") + userEvent; break; case 2: events[1] = ("Tuesday Appoinment:") + userEvent; break; case 3: events[2] = ("WednsdayAppoinment:") + userEvent; break; case 4: events[3] = ("Thursday Appoinment:") + userEvent; break; case 5: events[4] = ("Friday Appoinment:") + userEvent; break; default: break; //End switch test } //returns events array return events; //end create event method } //end calender class }

  Read the article

• Very simple, terse and easy GUI programming “frameworks”

  - by jetxee

  Please list GUI programming libraries, toolkits, frameworks which allow to write GUI apps quickly. I mean in such a way, that GUI is described entirely in a human-readable (and human-writable) plain text file (code) code is terse (1 or 2 lines of code per widget/event pair), suitable for scripting structure and operation of the GUI is evident from the code (nesting of widgets and flow of events) details about how to build the GUI are hidden (things like mainloop, attaching event listeners, etc.) auto-layouts are supported (vboxes, hboxes, etc.) As answers suggest, this may be defined as declarative GUI programming, but it is not necessarily such. Any approach is OK if it works, is easy to use and terse. There are some GUI libraries/toolkits like this. They are listed below. Please extend the list if you see a qualifying toolkit missing. Indicate if the project is crossplatform, mature, active, and give an example if possible. Please use this wiki to discuss only Open Source projects. This is the list so far (in alphabetical order): Fudgets Fudgets is a Haskell library. Platform: Unix. Status: Experimental, but still maintained. An example: import Fudgets main = fudlogue (shellF "Hello" (labelF "Hello, world!" >+< quitButtonF)) GNUstep Renaissance Renaissance allows to describe GUI in simple XML. Platforms: OSX/GNUstep. Status: part of GNUstep. An example below: <window title="Example"> <vbox> <label font="big"> Click the button below to quit the application </label> <button title="Quit" action="terminate:"/> </vbox> </window> HTML HTML-based GUI (HTML + JS). Crossplatform, mature. Can be used entirely on the client side. Looking for a nice “helloworld” example. JavaFX JavaFX is usable for standalone (desktop) apps as well as for web applications. Not completely crossplatform, not yet completely open source. Status: 1.0 release. An example: Frame { content: Button { text: "Press Me" action: operation() { System.out.println("You pressed me"); } } visible: true } Screenshot is needed. Phooey Phooey is another Haskell library. Crossplatform (wxWidgets), HTML+JS backend planned. Mature and active. An example (a little more than a helloworld): ui1 :: UI () ui1 = title "Shopping List" $ do a <- title "apples" $ islider (0,10) 3 b <- title "bananas" $ islider (0,10) 7 title "total" $ showDisplay (liftA2 (+) a b) PythonCard PythonCard describes GUI in a Python dictionary. Crossplatform (wxWidgets). Some apps use it, but the project seems stalled. There is an active fork. I skip PythonCard example because it is too verbose for the contest. Shoes Shoes for Ruby. Platforms: Win/OSX/GTK+. Status: Young but active. A minimal app looks like this: Shoes.app { @push = button "Push me" @note = para "Nothing pushed so far" @push.click { @note.replace "Aha! Click!" } } Tcl/Tk Tcl/Tk. Crossplatform (its own widget set). Mature (probably even dated) and active. An example: #!/usr/bin/env wish button .hello -text "Hello, World!" -command { exit } pack .hello tkwait window . tekUI tekUI for Lua (and C). Platforms: X11, DirectFB. Status: Alpha (usable, but API still evolves). An example: #/usr/bin/env lua ui = require "tek.ui" ui.Application:new { Children = { ui.Window:new { Title = "Hello", Children = { ui.Text:new { Text = "_Hello, World!", Style = "button", Mode = "button", }, }, }, }, }:run() Treethon Treethon for Python. It describes GUI in a YAML file (Python in a YAML tree). Platform: GTK+. Status: work in proress. A simple app looks like this: _import: gtk view: gtk.Window() add: - view: gtk.Button('Hello World') on clicked: print view.get_label() Yet unnamed Python library by Richard Jones: This one is not released yet. The idea is to use Python context managers (with keyword) to structure GUI code. See Richard Jones' blog for details. with gui.vertical: text = gui.label('hello!') items = gui.selection(['one', 'two', 'three']) with gui.button('click me!'): def on_click(): text.value = items.value text.foreground = red XUL XUL + Javascript may be used to create stand-alone desktop apps with XULRunner as well as Mozilla extensions. Mature, open source, crossplatform. <?xml version="1.0"?> <?xml-stylesheet href="chrome://global/skin/" type="text/css"?> <window id="main" title="My App" width="300" height="300" xmlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"> <caption label="Hello World"/> </window> Thank your for contributions!

  Read the article

• Android ksoap nested soap objects in request gives error in response

  - by Smalesy

  I'm trying to do the following soap request on Android using KSOAP. It contains a list of nested soap objects. However, I must be doing something wrong as I get an error back. The request I am trying to generate is as follows: <?xml version="1.0" encoding="utf-8"?> <soap12:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://www.w3.org/2003/05/soap-envelope"> <soap12:Body> <SetAttendanceMarks xmlns="http://hostname.net/"> <strSessionToken>string</strSessionToken> <LessonMarks> <Count>int</Count> <LessonMarks> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> </LessonMarks> </LessonMarks> </SetAttendanceMarks> </soap12:Body> </soap12:Envelope> My code is as follows: public boolean setAttendanceMarks(List<Mark> list) throws Exception { boolean result = false; String methodName = "SetAttendanceMarks"; String soapAction = getHost() + "SetAttendanceMarks"; SoapObject lessMarksN = new SoapObject(getHost(), "LessonMarks"); for (Mark m : list) { PropertyInfo smProp =new PropertyInfo(); smProp.setName("LessonMark"); smProp.setValue(m); smProp.setType(Mark.class); lessMarksN.addProperty(smProp); } PropertyInfo cProp =new PropertyInfo(); cProp.setName("Count"); cProp.setValue(list.size()); cProp.setType(Integer.class); SoapObject lessMarks = new SoapObject(getHost(), "LessonMarks"); lessMarks.addProperty(cProp); lessMarks.addSoapObject(lessMarksN); PropertyInfo sProp =new PropertyInfo(); sProp.setName("strSessionToken"); sProp.setValue(mSession); sProp.setType(String.class); SoapObject request = new SoapObject(getHost(), methodName); request.addProperty(sProp); request.addSoapObject(lessMarks); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(getURL()); androidHttpTransport.debug = true; androidHttpTransport.call(soapAction, envelope); String a = androidHttpTransport.requestDump; String b = androidHttpTransport.responseDump; SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; SoapObject res = (SoapObject) resultsRequestSOAP.getProperty(0); String resultStr = res.getPropertyAsString("Result"); if (resultStr.contentEquals("OK")) { result = true; } return result; } The error I get is as follows: <?xml version="1.0" encoding="utf-8"?><soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <soap:Body> <soap:Fault> <soap:Code> <soap:Value>soap:Sender</soap:Value> </soap:Code> <soap:Reason> <soap:Text xml:lang="en">Server was unable to read request. ---&gt; There is an error in XML document (1, 383). ---&gt; The specified type was not recognized: name='LessonMarks', namespace='http://gsdregapp.net/', at &lt;LessonMarks xmlns='http://gsdregapp.net/'&gt;.</soap:Text> </soap:Reason> <soap:Detail /> </soap:Fault> </soap:Body> </soap:Envelope> Can anybody tell me what I am doing wrong? I will be most grateful for any assistance!

  Read the article

• PHP submit problem

  - by TaG

  I'm trying to check if the username is available and display it for the user to see when they check there account settings, which I have done. BUT when the user tries to fill out another field I get the Your username is unavailable! which should not pop up because its the users username already. I want to know how can I fix this problem using PHP so that the users name is displayed every time the user views their account settings and it wont cause problems when a user submits additional info? Here is the PHP code. if (isset($_POST['submitted'])) { require_once '../htmlpurifier/library/HTMLPurifier.auto.php'; $config = HTMLPurifier_Config::createDefault(); $config->set('Core.Encoding', 'UTF-8'); $config->set('HTML.Doctype', 'XHTML 1.0 Strict'); $config->set('HTML.TidyLevel', 'heavy'); $config->set('HTML.SafeObject', true); $config->set('HTML.SafeEmbed', true); $purifier = new HTMLPurifier($config); $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"SELECT users.* FROM users WHERE user_id=3"); $first_name = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['first_name'])))); $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if($_POST['username']) { $u = "SELECT user_id FROM users WHERE username = '$username'"; $r = mysqli_query ($mysqli, $u) or trigger_error("Query: $q\n<br />MySQL Error: " . mysqli_error($mysqli)); if (mysqli_num_rows($r) == TRUE) { $username = NULL; echo '<p class="error">Your username is unavailable!</p>'; } else if(mysqli_num_rows($r) == 0) { $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if ($_POST['password1'] == $_POST['password2']) { $sha512 = hash('sha512', $_POST['password1']); $password = mysqli_real_escape_string($mysqli, $purifier->purify(strip_tags($sha512))); } else { $password = NULL; } if($password == NULL) { echo '<p class="error">Your password did not match the confirmed password!</p>'; } else { if (mysqli_num_rows($dbc) == 0) { $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"INSERT INTO users (user_id, first_name, username, password) VALUES ('$user_id', '$first_name', '$username', '$password')"); } if ($dbc == TRUE) { $dbc = mysqli_query($mysqli,"UPDATE users SET first_name = '$first_name', username = '$username', password = '$password' WHERE user_id = '$user_id'"); echo '<p class="changes-saved">Your changes have been saved!</p>'; } if (!$dbc) { print mysqli_error($mysqli); return; } } } } } Here is the html form. <form method="post" action="index.php"> <fieldset> <ul> <li><label for="first_name">First Name: </label><input type="text" name="first_name" id="first_name" size="25" class="input-size" value="<?php if (isset($_POST['first_name'])) { echo stripslashes(htmlentities(strip_tags($_POST['first_name']))); } else if(!empty($first_name)) { echo stripslashes(htmlentities(strip_tags($first_name))); } ?>" /></li> <li><label for="username">UserName: </label><input type="text" name="username" id="username" size="25" class="input-size" value="<?php if (isset($_POST['username'])) { echo stripslashes(htmlentities(strip_tags($_POST['username']))); } else if(!empty($username)) { echo stripslashes(htmlentities(strip_tags($username))); } ?>" /><br /><span>(ex: CSSKing, butterball)</span></li> <li><label for="password1">Password: </label><input type="password" name="password1" id="password1" size="25" class="input-size" value="<?php if (isset($_POST['password1'])) { echo stripslashes(htmlentities(strip_tags($_POST['password1']))); } ?>" /></li> <li><label for="password2">Confirm Password: </label><input type="password" name="password2" id="password2" size="25" class="input-size" value="<?php if (isset($_POST['password2'])) { echo stripslashes(htmlentities(strip_tags($_POST['password2']))); } ?>" /></li> <li><input type="submit" name="submit" value="Save Changes" class="save-button" /> <input type="hidden" name="submitted" value="true" /> <input type="submit" name="submit" value="Preview Changes" class="preview-changes-button" /></li> </ul> </fieldset> </form>

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• PHP: Strange behaviour while calling custom php functions

  - by baltusaj

  I am facing a strange behavior while coding in PHP with Flex. Let me explain the situation: I have two funcions lets say: populateTable() //puts some data in a table made with flex createXML() //creates an xml file which is used by Fusion Charts to create a chart Now, if i call populateTable() alone, the table gets populated with data but if i call it with createXML(), the table doesn't get populated but createXML() does it's work i.e. creates an xml file. Even if i run following code, only xml file gets generated but table remains empty whereas i called populateTable() before createXML(). Any idea what may be going wrong? MXML Part <mx:HTTPService id="userRequest" url="request.php" method="POST" resultFormat="e4x"> <mx:request xmlns=""> <getResult>send</getResult> </mx:request> and <mx:DataGrid id="dgUserRequest" dataProvider="{userRequest.lastResult.user}" x="28.5" y="36" width="525" height="250" > <mx:columns> <mx:DataGridColumn headerText="No." dataField="no" /> <mx:DataGridColumn headerText="Name" dataField="name"/> <mx:DataGridColumn headerText="Age" dataField="age"/> </mx:columns> PHP Part <?php //-------------------------------------------------------------------------- function initialize($username,$password,$database) //-------------------------------------------------------------------------- { # Connect to the database $link = mysql_connect("localhost", $username,$password); if (!$link) { die('Could not connected to the database : ' . mysql_error()); } # Select the database $db_selected = mysql_select_db($database, $link); if (!$db_selected) { die ('Could not select the DB : ' . mysql_error()); } // populateTable(); createXML(); # Close database connection } //-------------------------------------------------------------------------- populateTable() //-------------------------------------------------------------------------- { if($_POST['getResult'] == 'send') { $Result = mysql_query("SELECT * FROM session" ); $Return = "<Users>"; $no = 1; while ( $row = mysql_fetch_object( $Result ) ) { $Return .= "<user><no>".$no."</no><name>".$row->name."</name><age>".$row->age."</age><salary>". $row->salary."</salary></session>"; $no=$no+1; $Return .= "</Users>"; mysql_free_result( $Result ); print ($Return); } //-------------------------------------------------------------------------- createXML() //-------------------------------------------------------------------------- { $users=array ( "0"=>array("",0), "1"=>array("Obama",0), "2"=>array("Zardari",0), "3"=>array("Imran Khan",0), "4"=>array("Ahmadenijad",0) ); $selectedUsers=array(1,4); //this means only obama and ahmadenijad are selected and the xml file will contain info related to them only //Extracting salaries of selected users $size=count($users); for($i = 0; $i<$size; $i++) { //initialize temp which will calculate total throughput for each protocol separately $salary = 0; $result = mysql_query("SELECT salary FROM userInfo where name='$users[$selectedUsers[$i]][0]'"); $row = mysql_fetch_array($result)) $salary = $row['salary']; } $users[$selectedUsers[$i]][1]=$salary; } //creating XML string $chartContent = "<chart caption=\"Users Vs Salaries\" formatNumberScale=\"0\" pieSliceDepth=\"30\" startingAngle=\"125\">"; for($i=0;$i<$size;$i++) { $chartContent .= "<set label=\"".$users[$selectedUsers[$i]][0]."\" value=\"".$users[$selectedUsers[$i]][1]."\"/>"; } $chartContent .= "<styles>" . "<definition>" . "<style type=\"font\" name=\"CaptionFont\" size=\"16\" color=\"666666\"/>" . "<style type=\"font\" name=\"SubCaptionFont\" bold=\"0\"/>" . "</definition>" . "<application>" . "<apply toObject=\"caption\" styles=\"CaptionFont\"/>" . "<apply toObject=\"SubCaption\" styles=\"SubCaptionFont\"/>" . "</application>" . "</styles>" . "</chart>"; $file_handle = fopen('ChartData.xml','w'); fwrite($file_handle,$chartContent); fclose($file_handle); } initialize("root","","hiddenpeak"); ?>

  Read the article

• Access Violation

  - by Justin

  I've been learning how to NOP functions in C++ or even C but there are very few tutorials online about it. I've been googling for the past few hours now and I'm just stuck. Here is my code. #include <iostream> #include <windows.h> #include <tlhelp32.h> using namespace std; //#define NOP 0x90 byte NOP[] = {0x90}; void enableDebugPrivileges() { HANDLE hcurrent=GetCurrentProcess(); HANDLE hToken; BOOL bret=OpenProcessToken(hcurrent,40,&hToken); LUID luid; bret=LookupPrivilegeValue(NULL,"SeDebugPrivilege",&luid); TOKEN_PRIVILEGES NewState,PreviousState; DWORD ReturnLength; NewState.PrivilegeCount =1; NewState.Privileges[0].Luid =luid; NewState.Privileges[0].Attributes=2; AdjustTokenPrivileges(hToken,FALSE,&NewState,28,&PreviousState,&ReturnLength); } DWORD GetProcId(char* ProcName) { PROCESSENTRY32 pe32; HANDLE hSnapshot = NULL; pe32.dwSize = sizeof( PROCESSENTRY32 ); hSnapshot = CreateToolhelp32Snapshot( TH32CS_SNAPPROCESS, 0 ); if( Process32First( hSnapshot, &pe32 ) ) { do{ if( strcmp( pe32.szExeFile, ProcName ) == 0 ) break; }while( Process32Next( hSnapshot, &pe32 ) ); } if( hSnapshot != INVALID_HANDLE_VALUE ) CloseHandle( hSnapshot ); return pe32.th32ProcessID; } void WriteMem(DWORD Address, void* Value, size_t Size) { DWORD Protect = NULL; VirtualProtect((LPVOID)Address, 3, PAGE_READWRITE, &Protect); memcpy((void*)Address, Value, 3); VirtualProtect((LPVOID)Address, 3, Protect, &Protect); } void nop_(PVOID address, int bytes){ DWORD d, ds; VirtualProtect(address, bytes, PAGE_EXECUTE_READWRITE, &d); memset(address, 144, bytes); VirtualProtect(address,bytes,d,&ds); } void MemCopy(HANDLE pHandle, void* Dest, const void* Src, int Len) { DWORD OldProtect; DWORD OldProtect2; VirtualProtect(Dest, Len, PAGE_EXECUTE_READWRITE, &OldProtect); memcpy(Dest, Src, Len); VirtualProtect(Dest, Len, OldProtect, &OldProtect2); FlushInstructionCache(pHandle, Dest, Len); } int main() { enableDebugPrivileges(); DWORD pid; HANDLE phandle; // Obtain the process ID pid = GetProcId("gr.exe"); if(GetLastError()) { cout << "Error_PID_: " << GetLastError() << endl; system("pause"); return -1; } // Obtain the process handle phandle = OpenProcess(PROCESS_ALL_ACCESS,0,pid); if(GetLastError()) { cout << "Error_HANDLE_: " << GetLastError() << endl; system("pause"); return -1; } // Debug info, 0 = bad cout <<"pid : " << pid << endl; cout <<"HANDLE: " << phandle << endl << endl; system("pause"); // Change value to short iValue = -1; int choice = 0; BYTE * bGodMode = (BYTE *) (0x409A7E); // Lives Address bool hack = true; while(hack) { system("cls"); cout << "What hack?\n0. Exit\n1. Lives\n\n!> "; cin >> choice; switch(choice) { case 0: { hack=false; break; } case 1: // Modify Time cout << "God Mode On\n!> "; // cin >> iValue; // nop_((PVOID)(0x409A7E), 3); // MemCopy(phandle, (PVOID)0x409A7E, &NOP, 1); WriteMem((DWORD)(0x00409A7E), (void*)NOP, sizeof NOP); if(GetLastError()) { cout << "Error: " << GetLastError() << endl; system("pause"); } break; default: cout << "ERROR!\n"; break; } Sleep(100); } system("pause"); return 0; } This is suppose to NOP the DEC function that is 3 bytes long preventing me from losing lives. However each time I try it, it crashes the hack and says I had a access violation. I tried to look up the reasons and most of them dealt with with the size of the location I'm writing to and what I'm copying from. Otherwise, I have absolutely no idea. Any help would be nice. The game is GunRoar and the base address "0x409A7E" is where the DEC function is.

  Read the article

• context.getContextResolved appliaction stopped - begginner in java

  - by Szymad

  I have a problem with my app. I'm trying to execute query, but app stops every time. This error occurs while trying to execute query. I'm learing from Android Pro 3 book, but code presented in this book is deprecated. package com.example.contactsabuout; import android.net.Uri; import android.os.Bundle; import android.provider.Contacts; import android.provider.ContactsContract; import android.app.Activity; import android.database.Cursor; import android.util.Log; import android.content.Context; import android.view.Menu; import android.view.View; import android.widget.TextView; public class MainActivity extends Activity { private static Context context; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.activity_main); MainActivity.context = getApplicationContext(); Log.v("INFO", "Completed: onCreate."); } public static Context getAppContext() { return MainActivity.context; } public void doQuery(View view) { Uri peopleBaseUri = ContactsContract.Contacts.CONTENT_URI; Log.v("II","Button clicked."); Log.v("II", "Uri for ContactsContract.Contacts: " + peopleBaseUri); Context context = getAppContext(); Log.v("II", "Got context: " + context); Cursor cur; Log.v("II", "Created cursor: cur"); cur = context.getContentResolver().query(peopleBaseUri, null, null, null, null); } @Override public boolean onCreateOptionsMenu(Menu menu) { getMenuInflater().inflate(R.menu.activity_main, menu); return true; } } FROM LogCat 10-28 17:45:02.513: V/INFO(4677): Completed: onCreate. 10-28 17:45:02.613: D/libEGL(4677): loaded /system/lib/egl/libGLES_android.so 10-28 17:45:02.653: D/libEGL(4677): loaded /system/lib/egl/libEGL_adreno200.so 10-28 17:45:02.723: D/libEGL(4677): loaded /system/lib/egl/libGLESv1_CM_adreno200.so 10-28 17:45:02.723: D/libEGL(4677): loaded /system/lib/egl/libGLESv2_adreno200.so 10-28 17:45:03.014: I/Adreno200-EGLSUB(4677): <ConfigWindowMatch:2078>: Format RGBA_8888. 10-28 17:45:03.054: D/OpenGLRenderer(4677): Enabling debug mode 0 10-28 17:45:03.254: D/OpenGLRenderer(4677): has fontRender patch 10-28 17:45:03.274: D/OpenGLRenderer(4677): has fontRender patch 10-28 17:45:12.873: V/II(4677): Button clicked. 10-28 17:45:12.873: V/II(4677): Uri for ContactsContract.Contacts: content://com.android.contacts/contacts, rest will be null 10-28 17:45:12.873: V/II(4677): Got context: android.app.Application@40d83d90 10-28 17:45:12.873: V/II(4677): Created cursor: cur 10-28 17:45:12.933: D/AndroidRuntime(4677): Shutting down VM 10-28 17:45:12.933: W/dalvikvm(4677): threadid=1: thread exiting with uncaught exception (group=0x40aaf228) 10-28 17:45:12.953: E/AndroidRuntime(4677): FATAL EXCEPTION: main 10-28 17:45:12.953: E/AndroidRuntime(4677): java.lang.IllegalStateException: Could not execute method of the activity 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.view.View$1.onClick(View.java:3071) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.view.View.performClick(View.java:3538) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.view.View$PerformClick.run(View.java:14330) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.os.Handler.handleCallback(Handler.java:608) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.os.Handler.dispatchMessage(Handler.java:92) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.os.Looper.loop(Looper.java:156) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.app.ActivityThread.main(ActivityThread.java:4977) 10-28 17:45:12.953: E/AndroidRuntime(4677): at java.lang.reflect.Method.invokeNative(Native Method) 10-28 17:45:12.953: E/AndroidRuntime(4677): at java.lang.reflect.Method.invoke(Method.java:511) 10-28 17:45:12.953: E/AndroidRuntime(4677): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:784) 10-28 17:45:12.953: E/AndroidRuntime(4677): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:551) 10-28 17:45:12.953: E/AndroidRuntime(4677): at dalvik.system.NativeStart.main(Native Method) 10-28 17:45:12.953: E/AndroidRuntime(4677): Caused by: java.lang.reflect.InvocationTargetException 10-28 17:45:12.953: E/AndroidRuntime(4677): at java.lang.reflect.Method.invokeNative(Native Method) 10-28 17:45:12.953: E/AndroidRuntime(4677): at java.lang.reflect.Method.invoke(Method.java:511) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.view.View$1.onClick(View.java:3066) 10-28 17:45:12.953: E/AndroidRuntime(4677): ... 11 more 10-28 17:45:12.953: E/AndroidRuntime(4677): Caused by: java.lang.SecurityException: Permission Denial: reading com.android.providers.contacts.HtcContactsProvider2 uri content://com.android.contacts/contacts from pid=4677, uid=10155 requires android.permission.READ_CONTACTS 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.os.Parcel.readException(Parcel.java:1332) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.database.DatabaseUtils.readExceptionFromParcel(DatabaseUtils.java:182) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.database.DatabaseUtils.readExceptionFromParcel(DatabaseUtils.java:136) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.content.ContentProviderProxy.query(ContentProviderNative.java:406) 10-28 17:45:12.953: E/AndroidRuntime(4677): at android.content.ContentResolver.query(ContentResolver.java:315) 10-28 17:45:12.953: E/AndroidRuntime(4677): at com.example.contactsabuout.MainActivity.doQuery(MainActivity.java:47) 10-28 17:45:12.953: E/AndroidRuntime(4677): ... 14 more I'm trying to learn android.

  Read the article

• XML over HTTP with JMS and Spring

  - by Will Sumekar

  I have a legacy HTTP server where I need to send an XML file over HTTP request (POST) using Java (not browser) and the server will respond with another XML in its HTTP response. It is similar to Web Service but there's no WSDL and I have to follow the existing XML structure to construct my XML to be sent. I have done a research and found an example that matches my requirement here. The example uses HttpClient from Apache Commons. (There are also other examples I found but they use java.net networking package (like URLConnection) which is tedious so I don't want to use them). But it's also my requirement to use Spring and JMS. I know from Spring's reference that it's possible to combine HttpClient, JMS and Spring. My question is, how? Note that it's NOT in my requirement to use HttpClient. If you have a better suggestion, I'm welcome. Appreciate it. For your reference, here's the XML-over-HTTP example I've been talking about: /* * $Header: * $Revision$ * $Date$ * ==================================================================== * * Copyright 2002-2004 The Apache Software Foundation * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. * ==================================================================== * * This software consists of voluntary contributions made by many * individuals on behalf of the Apache Software Foundation. For more * information on the Apache Software Foundation, please see * <http://www.apache.org/>. * * [Additional notices, if required by prior licensing conditions] * */ import java.io.File; import java.io.FileInputStream; import org.apache.commons.httpclient.HttpClient; import org.apache.commons.httpclient.methods.InputStreamRequestEntity; import org.apache.commons.httpclient.methods.PostMethod; /** * * This is a sample application that demonstrates * how to use the Jakarta HttpClient API. * * This application sends an XML document * to a remote web server using HTTP POST * * @author Sean C. Sullivan * @author Ortwin Glück * @author Oleg Kalnichevski */ public class PostXML { /** * * Usage: * java PostXML http://mywebserver:80/ c:\foo.xml * * @param args command line arguments * Argument 0 is a URL to a web server * Argument 1 is a local filename * */ public static void main(String[] args) throws Exception { if (args.length != 2) { System.out.println( "Usage: java -classpath <classpath> [-Dorg.apache.commons."+ "logging.simplelog.defaultlog=<loglevel>]" + " PostXML <url> <filename>]"); System.out.println("<classpath> - must contain the "+ "commons-httpclient.jar and commons-logging.jar"); System.out.println("<loglevel> - one of error, "+ "warn, info, debug, trace"); System.out.println("<url> - the URL to post the file to"); System.out.println("<filename> - file to post to the URL"); System.out.println(); System.exit(1); } // Get target URL String strURL = args[0]; // Get file to be posted String strXMLFilename = args[1]; File input = new File(strXMLFilename); // Prepare HTTP post PostMethod post = new PostMethod(strURL); // Request content will be retrieved directly // from the input stream // Per default, the request content needs to be buffered // in order to determine its length. // Request body buffering can be avoided when // content length is explicitly specified post.setRequestEntity(new InputStreamRequestEntity( new FileInputStream(input), input.length())); // Specify content type and encoding // If content encoding is not explicitly specified // ISO-8859-1 is assumed post.setRequestHeader( "Content-type", "text/xml; charset=ISO-8859-1"); // Get HTTP client HttpClient httpclient = new HttpClient(); // Execute request try { int result = httpclient.executeMethod(post); // Display status code System.out.println("Response status code: " + result); // Display response System.out.println("Response body: "); System.out.println(post.getResponseBodyAsString()); } finally { // Release current connection to the connection pool // once you are done post.releaseConnection(); } } }

  Read the article

• Saving in mongoDb with Mongoose, unexpected elements saved

  - by guiomie

  When I write in my mongoDB with mongoose the operation is treated with success, my document is saved, but there is also all kind of weird other sutff written down. It seems to be mongoose code. What could cause this? I add stuff in a specific array with: resultReference.ref[arrayLocation].allEvents.push(theEvent); {id: 11, allEvents: [] } is the structure of a ref element, and I push theEvent in the allEvents array. I then resultReference.save() I use express, mongoose and mongoHQ for database. I tried on a local mongo server, and this annoyance is still there. I've print in my console the document to write before save() and non of this weird code is there. { id 11 allEvents [ 0 { _events { maxListeners 0 } _doc { _id {"$oid": "4eb87834f54944e263000003"} title "Test" allDay false start 2011-11-10 13:00:00 UTC end 2011-11-10 15:00:00 UTC url "/test/4eb87834f54944e263000002" color "#99CCFF" ref "4eb87834f54944e263000002" } _activePaths { paths { title "modify" allDay "modify" start "modify" end "modify" url "modify" color "modify" ref "modify" } states { init { } modify { title true allDay true start true end true url true color true ref true } require { } } stateNames [ 0 "require" 1 "modify" 2 "init" ] } _saveError null _validationError null isNew true _pres { save [ 0 function (next) { // we keep the error semaphore to make sure we don't // call `save` unnecessarily (we only need 1 error) var subdocs = 0 , error = false , self = this; var arrays = this._activePaths .map('init', 'modify', function (i) { return self.getValue(i); }) .filter(function (val) { return (val && val instanceof DocumentArray && val.length); }); if (!arrays.length) return next(); arrays.forEach(function (array) { subdocs += array.length; array.forEach(function (value) { if (!error) value.save(function (err) { if (!error) { if (err) { error = true; next(err); } else --subdocs || next(); } }); }); }); } 1 "function checkForExistingErrors(next) { if (self._saveError){ next(self._saveError); self._saveError = null; } else { next(); } }" 2 "function validation(next) { return self.validate.call(self, next); }" ] } _posts { save [ ] } save function () { var self = this , hookArgs // arguments eventually passed to the hook - are mutable , lastArg = arguments[arguments.length-1] , pres = this._pres[name] , posts = this._posts[name] , _total = pres.length , _current = -1 , _asyncsLeft = proto[name].numAsyncPres , _next = function () { if (arguments[0] instanceof Error) { return handleError(arguments[0]); } var _args = Array.prototype.slice.call(arguments) , currPre , preArgs; if (_args.length && !(arguments[0] === null && typeof lastArg === 'function')) hookArgs = _args; if (++_current < _total) { currPre = pres[_current] if (currPre.isAsync && currPre.length < 2) throw new Error("Your pre must have next and done arguments -- e.g., function (next, done, ...)"); if (currPre.length < 1) throw new Error("Your pre must have a next argument -- e.g., function (next, ...)"); preArgs = (currPre.isAsync ? [once(_next), once(_asyncsDone)] : [once(_next)]).concat(hookArgs); return currPre.apply(self, preArgs); } else if (!proto[name].numAsyncPres) { return _done.apply(self, hookArgs); } } , _done = function () { var args_ = Array.prototype.slice.call(arguments) , ret, total_, current_, next_, done_, postArgs; if (_current === _total) { ret = fn.apply(self, args_); total_ = posts.length; current_ = -1; next_ = function () { if (arguments[0] instanceof Error) { return handleError(arguments[0]); } var args_ = Array.prototype.slice.call(arguments, 1) , currPost , postArgs; if (args_.length) hookArgs = args_; if (++current_ < total_) { currPost = posts[current_] if (currPost.length < 1) throw new Error("Your post must have a next argument -- e.g., function (next, ...)"); postArgs = [once(next_)].concat(hookArgs); return currPost.apply(self, postArgs); } }; if (total_) return next_(); return ret; } }; if (_asyncsLeft) { function _asyncsDone (err) { if (err && err instanceof Error) { return handleError(err); } --_asyncsLeft || _done.apply(self, hookArgs); } } function handleError (err) { if ('function' == typeof lastArg) return lastArg(err); if (errorCb) return errorCb.call(self, err); throw err; } return _next.apply(this, arguments); } errors null } ] } ]

  Read the article

• .NET interview, code structure and the design

  - by j_lewis

  I have been given the below .NET question in an interview. I don’t know why I got low marks. Unfortunately I did not get a feedback. Question: The file hockey.csv contains the results from the Hockey Premier League. The columns ‘For’ and ‘Against’ contain the total number of goals scored for and against each team in that season (so Alabama scored 79 goals against opponents, and had 36 goals scored against them). Write a program to print the name of the team with the smallest difference in ‘for’ and ‘against’ goals. the structure of the hockey.csv looks like this (it is a valid csv file, but I just copied the values here to get an idea) Team - For - Against Alabama 79 36 Washinton 67 30 Indiana 87 45 Newcastle 74 52 Florida 53 37 New York 46 47 Sunderland 29 51 Lova 41 64 Nevada 33 63 Boston 30 64 Nevada 33 63 Boston 30 64 Solution: class Program { static void Main(string[] args) { string path = @"C:\Users\<valid csv path>"; var resultEvaluator = new ResultEvaluator(string.Format(@"{0}\{1}",path, "hockey.csv")); var team = resultEvaluator.GetTeamSmallestDifferenceForAgainst(); Console.WriteLine( string.Format("Smallest difference in ‘For’ and ‘Against’ goals > TEAM: {0}, GOALS DIF: {1}", team.Name, team.Difference )); Console.ReadLine(); } } public interface IResultEvaluator { Team GetTeamSmallestDifferenceForAgainst(); } public class ResultEvaluator : IResultEvaluator { private static DataTable leagueDataTable; private readonly string filePath; private readonly ICsvExtractor csvExtractor; public ResultEvaluator(string filePath){ this.filePath = filePath; csvExtractor = new CsvExtractor(); } private DataTable LeagueDataTable{ get { if (leagueDataTable == null) { leagueDataTable = csvExtractor.GetDataTable(filePath); } return leagueDataTable; } } public Team GetTeamSmallestDifferenceForAgainst() { var teams = GetTeams(); var lowestTeam = teams.OrderBy(p => p.Difference).First(); return lowestTeam; } private IEnumerable<Team> GetTeams() { IList<Team> list = new List<Team>(); foreach (DataRow row in LeagueDataTable.Rows) { var name = row["Team"].ToString(); var @for = int.Parse(row["For"].ToString()); var against = int.Parse(row["Against"].ToString()); var team = new Team(name, against, @for); list.Add(team); } return list; } } public interface ICsvExtractor { DataTable GetDataTable(string csvFilePath); } public class CsvExtractor : ICsvExtractor { public DataTable GetDataTable(string csvFilePath) { var lines = File.ReadAllLines(csvFilePath); string[] fields; fields = lines[0].Split(new[] { ',' }); int columns = fields.GetLength(0); var dt = new DataTable(); //always assume 1st row is the column name. for (int i = 0; i < columns; i++) { dt.Columns.Add(fields[i].ToLower(), typeof(string)); } DataRow row; for (int i = 1; i < lines.GetLength(0); i++) { fields = lines[i].Split(new char[] { ',' }); row = dt.NewRow(); for (int f = 0; f < columns; f++) row[f] = fields[f]; dt.Rows.Add(row); } return dt; } } public class Team { public Team(string name, int against, int @for) { Name = name; Against = against; For = @for; } public string Name { get; private set; } public int Against { get; private set; } public int For { get; private set; } public int Difference { get { return (For - Against); } } } Output: Smallest difference in for' andagainst' goals TEAM: Boston, GOALS DIF: -34 Can someone please review my code and see anything obviously wrong here? They were only interested in the structure/design of the code and whether the program produces the correct result (i.e lowest difference). Much appreciated. "P.S - Please correct me if the ".net-interview" tag is not the right tag to use"

  Read the article

• Compile error with initializer_list when trying to use it to initialize member value of class

  - by ilektron

  I am trying to make a class initializable from an initialization_list in a class constructor's constructor's initialization list. It works for a std::map, but not for my custom class. I don't see any difference other than templates are used in std::map. #include <iostream> #include <initializer_list> #include <string> #include <sstream> #include <map> using std::string; class text_thing { private: string m_text; public: text_thing() { } text_thing(text_thing& other); text_thing(std::initializer_list< std::pair<const string, const string> >& il); text_thing& operator=(std::initializer_list< std::pair<const string, const string> >& il); operator string() { return m_text; } }; class static_base { private: std::map<string, string> m_test_map; text_thing m_thing; static_base(); public: static static_base& getInstance() { static static_base instance; return instance; } string getText() { return (string)m_thing; } }; typedef std::pair<const string, const string> spair; text_thing::text_thing(text_thing& other) { m_text = other.m_text; } text_thing::text_thing(std::initializer_list< std::pair<const string, const string> >& il) { std::stringstream text_gen; for (auto& apair : il) { text_gen << "{" << apair.first << ", " << apair.second << "}" << std::endl; } } text_thing& text_thing::operator=(std::initializer_list< std::pair<const string, const string> >& il) { std::stringstream text_gen; for (auto& apair : il) { text_gen << "{" << apair.first << ", " << apair.second << "}" << std::endl; } return *this; } static_base::static_base() : m_test_map{{"test", "1"}, {"test2", "2"}}, // Compiler fine with this m_thing{{"test", "1"}, {"test2", "2"}} // Compiler doesn't like this { } int main() { std::cout << "Starting the program" << std::endl; std::cout << "The text thing: " << std::endl << static_base::getInstance().getText(); } I get this compiler output g++ -O0 -g3 -Wall -c -fmessage-length=0 -std=c++11 -MMD -MP -MF"static_base.d" -MT"static_base.d" -o "static_base.o" "../static_base.cpp" Finished building: ../static_base.cpp Building file: ../test.cpp Invoking: GCC C++ Compiler g++ -O0 -g3 -Wall -c -fmessage-length=0 -std=c++11 -MMD -MP -MF"test.d" -MT"test.d" -o "test.o" "../test.cpp" ../test.cpp: In constructor ‘static_base::static_base()’: ../test.cpp:94:40: error: no matching function for call to ‘text_thing::text_thing(<brace-enclosed initializer list>)’ m_thing{{"test", "1"}, {"test2", "2"}} ^ ../test.cpp:94:40: note: candidates are: ../test.cpp:72:1: note: text_thing::text_thing(std::initializer_list<std::pair<const std::basic_string<char>, const std::basic_string<char> > >&) text_thing::text_thing(std::initializer_list< std::pair<const string, const string> >& il) ^ ../test.cpp:72:1: note: candidate expects 1 argument, 2 provided ../test.cpp:67:1: note: text_thing::text_thing(text_thing&) text_thing::text_thing(text_thing& other) ^ ../test.cpp:67:1: note: candidate expects 1 argument, 2 provided ../test.cpp:23:2: note: text_thing::text_thing() text_thing() ^ ../test.cpp:23:2: note: candidate expects 0 arguments, 2 provided make: *** [test.o] Error 1 Output of gcc -v Using built-in specs. COLLECT_GCC=gcc COLLECT_LTO_WRAPPER=/usr/lib/gcc/x86_64-linux-gnu/4.8/lto-wrapper Target: x86_64-linux-gnu Configured with: ../src/configure -v --with-pkgversion='Ubuntu 4.8.1-2ubuntu1~13.04' --with-bugurl=file:///usr/share/doc/gcc-4.8/README.Bugs --enable-languages=c,c++,java,go,d,fortran,objc,obj-c++ --prefix=/usr --program-suffix=-4.8 --enable-shared --enable-linker-build-id --libexecdir=/usr/lib --without-included-gettext --enable-threads=posix --with-gxx-include-dir=/usr/include/c++/4.8 --libdir=/usr/lib --enable-nls --with-sysroot=/ --enable-clocale=gnu --enable-libstdcxx-debug --enable-libstdcxx-time=yes --enable-gnu-unique-object --enable-plugin --with-system-zlib --disable-browser-plugin --enable-java-awt=gtk --enable-gtk-cairo --with-java-home=/usr/lib/jvm/java-1.5.0-gcj-4.8-amd64/jre --enable-java-home --with-jvm-root-dir=/usr/lib/jvm/java-1.5.0-gcj-4.8-amd64 --with-jvm-jar-dir=/usr/lib/jvm-exports/java-1.5.0-gcj-4.8-amd64 --with-arch-directory=amd64 --with-ecj-jar=/usr/share/java/eclipse-ecj.jar --enable-objc-gc --enable-multiarch --disable-werror --with-arch-32=i686 --with-abi=m64 --with-multilib-list=m32,m64,mx32 --with-tune=generic --enable-checking=release --build=x86_64-linux-gnu --host=x86_64-linux-gnu --target=x86_64-linux-gnu Thread model: posix gcc version 4.8.1 (Ubuntu 4.8.1-2ubuntu1~13.04) It compiles fine with the std::map constructed this way, and if I modify the static_base to return the strings from the maps, all is fine and dandy. Please help me understand what is going on here.

  Read the article

• null pointer exception at org.hibernate.tuple.AbstractEntityTuplizer.createProxy

  - by saurabh

  I am using hibernate 3.2 with struts 1.2 framework I got this exception when i m trying to load the object I am using this code to load the object public Currentprofile findById(java.lang.String id) { log.debug("getting Currentprofile instance with id: " + id); try { Currentprofile instance = (Currentprofile) getSession().get( "com.hibermappings.Currentprofile", id); return instance; } catch (RuntimeException re) { log.error("get failed", re); throw re; } } my hbm file is this <one-to-one name="referenceDb" lazy="proxy" class="com.hibermappings.ReferenceDb" cascade="all" constrained="false" /> <one-to-one name="registration" lazy="proxy" class="com.hibermappings.Registration" cascade="all" constrained="false" /> <one-to-one name="jobseekerpackagedetails" lazy="proxy" class="com.hibermappings.Jobseekerpackagedetails" cascade="all" constrained="false" /> <property name="keyWords" type="java.lang.String"> <column name="keyWords" length="5000" /> </property> <property name="totalExp" type="java.lang.String"> <column name="totalExp" length="100" /> </property> <property name="hqualification" type="java.lang.String"> <column name="hQualification" length="100" /> </property> <property name="preferedLocation" type="java.lang.String"> <column name="preferedLocation" length="100" /> </property> <property name="functionalArea" type="java.lang.String"> <column name="functionalArea" length="1000" /> </property> <property name="expSalary" type="java.lang.String"> <column name="expSalary" length="100" /> </property> <property name="designation" type="java.lang.String"> <column name="designation" length="100" /> </property> <property name="resumeTitle" type="java.lang.String"> <column name="resumeTitle" length="500" /> </property> <property name="profileDetails" type="java.lang.String"> <column name="profileDetails" length="65535" /> </property> <property name="requiredProfile" type="java.lang.String"> <column name="requiredProfile" length="65535" /> </property> <property name="activatedOn" type="java.util.Date"> <column name="activatedOn" length="0" /> </property> <set name="resumes" inverse="true" cascade="save-update"> <key> <column name="jobseekerId" length="50" /> </key> <one-to-many class="com.hibermappings.Resume" /> </set> </class> the same code runs well when I m using in a simple java class within main method .. full stack trace of exception is java.lang.NullPointerException at org.hibernate.tuple.AbstractEntityTuplizer.createProxy(AbstractEntityTuplizer.java:372) at org.hibernate.persister.entity.AbstractEntityPersister.createProxy(AbstractEntityPersister.java:3121) at org.hibernate.event.def.DefaultLoadEventListener.createProxyIfNecessary(DefaultLoadEventListener.java:232) at org.hibernate.event.def.DefaultLoadEventListener.proxyOrLoad(DefaultLoadEventListener.java:173) at org.hibernate.event.def.DefaultLoadEventListener.onLoad(DefaultLoadEventListener.java:87) at org.hibernate.impl.SessionImpl.fireLoad(SessionImpl.java:862) at org.hibernate.impl.SessionImpl.load(SessionImpl.java:781) at org.hibernate.impl.SessionImpl.load(SessionImpl.java:774) at com.DAOs.CurrentprofileDAO.getLoad(CurrentprofileDAO.java:71) at com.action.JobSekeerManage.viewProfile(JobSekeerManage.java:447) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.apache.struts.actions.DispatchAction.dispatchMethod(DispatchAction.java:270) at org.apache.struts.actions.DispatchAction.execute(DispatchAction.java:187) at org.apache.struts.action.RequestProcessor.processActionPerform(RequestProcessor.java:431) at org.apache.struts.action.RequestProcessor.process(RequestProcessor.java:236) at org.apache.struts.action.ActionServlet.process(ActionServlet.java:1196) at org.apache.struts.action.ActionServlet.doGet(ActionServlet.java:414) at javax.servlet.http.HttpServlet.service(HttpServlet.java:689) at javax.servlet.http.HttpServlet.service(HttpServlet.java:802) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:237) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:157) at com.filter.HibernateFilter.doFilter(HibernateFilter.java:24) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:186) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:157) at org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.java:214) at org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.java:178) at org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:126) at org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:105) at org.apache.catalina.core.StandardEngineValve.invoke(StandardEngineValve.java:107) at org.apache.catalina.connector.CoyoteAdapter.service(CoyoteAdapter.java:148) at org.apache.coyote.http11.Http11Processor.process(Http11Processor.java:825) at org.apache.coyote.http11.Http11Protocol$Http11ConnectionHandler.processConnection(Http11Protocol.java:731) at org.apache.tomcat.util.net.PoolTcpEndpoint.processSocket(PoolTcpEndpoint.java:526) at org.apache.tomcat.util.net.LeaderFollowerWorkerThread.runIt(LeaderFollowerWorkerThread.java:80) at org.apache.tomcat.util.threads.ThreadPool$ControlRunnable.run(ThreadPool.java:684) at java.lang.Thread.run(Thread.java:595) Error::null

  Read the article

• 405: Method Not Allowed WCF

  - by luiscarlosch

  I can perfectly call a WCF web method from localhost. I published to this server: http://luiscarlosch.com/WebFormClean.aspx (only firefox or chrome) with the Visual Studio publishing tool and it works fine. The problem is when a try to access it from another computer. I get the 405: Method Not Allowed. But It doest make sense because It works fine when i access it remotely from the publisher computer as I said. Any idea? [ServiceContract(Namespace = "")] [AspNetCompatibilityRequirements(RequirementsMode = AspNetCompatibilityRequirementsMode.Allowed)] public class ContactProxy { [WebGet()] [OperationContract] public Contact getByID(int IDContact) { Contact contact = new Contact(IDContact); return contact; } [OperationContract] public EntityData insertEntityData(int IDEntityDataFieldType, int IDContact, String value) { //Contact contact = new Contact(); // contact.insertEntityData(IDEntityDataFieldType, IDContact, value); EntityData entityData = new EntityData(); entityData.save(IDEntityDataFieldType, IDContact, value); return entityData; } } Neither method seems to work. I just noticed some user were able to access http://luiscarlosch.com/WebFormClean.aspx because they change the values. So. some clients can read the methods but some cant. This should be happening. Web Config <?xml version="1.0"?> <configuration> <configSections> </configSections> <connectionStrings> <add name="ApplicationServices" connectionString="data source=.\SQLEXPRESS;Integrated Security=SSPI;AttachDBFilename=|DataDirectory|\aspnetdb.mdf;User Instance=true" providerName="System.Data.SqlClient" /> </connectionStrings> <system.web> <compilation debug="true" targetFramework="4.0" /> <customErrors mode="Off"/> <authentication mode="Forms"> <forms loginUrl="~/Account/Login.aspx" timeout="2880" /> </authentication> <membership> <providers> <clear/> <add name="AspNetSqlMembershipProvider" type="System.Web.Security.SqlMembershipProvider" connectionStringName="ApplicationServices" enablePasswordRetrieval="false" enablePasswordReset="true" requiresQuestionAndAnswer="false" requiresUniqueEmail="false" maxInvalidPasswordAttempts="5" minRequiredPasswordLength="6" minRequiredNonalphanumericCharacters="0" passwordAttemptWindow="10" applicationName="/" /> </providers> </membership> <profile> <providers> <clear/> <add name="AspNetSqlProfileProvider" type="System.Web.Profile.SqlProfileProvider" connectionStringName="ApplicationServices" applicationName="/"/> </providers> </profile> <roleManager enabled="false"> <providers> <clear/> <add name="AspNetSqlRoleProvider" type="System.Web.Security.SqlRoleProvider" connectionStringName="ApplicationServices" applicationName="/" /> <add name="AspNetWindowsTokenRoleProvider" type="System.Web.Security.WindowsTokenRoleProvider" applicationName="/" /> </providers> </roleManager> </system.web> <system.webServer> <modules runAllManagedModulesForAllRequests="true"/> </system.webServer> <system.serviceModel> <behaviors> <serviceBehaviors> <behavior name="MyServiceTypeBehaviors" > <serviceMetadata httpGetEnabled="true" /> </behavior> </serviceBehaviors> <endpointBehaviors> <behavior name="WebApplicationTest.WCFProxy.EmployeeProxyAspNetAjaxBehavior"> <enableWebScript /> </behavior> <behavior name="WebApplicationTest.WCFProxy.EntityDataFieldCollectionProxyAspNetAjaxBehavior"> <enableWebScript /> </behavior> <behavior name="WebApplicationTest.WCFProxy.Service1AspNetAjaxBehavior"> <enableWebScript /> </behavior> <behavior name="WebApplicationTest.WCFProxy.ContactProxyAspNetAjaxBehavior"> <enableWebScript /> </behavior> </endpointBehaviors> </behaviors> <serviceHostingEnvironment aspNetCompatibilityEnabled="true" multipleSiteBindingsEnabled="true" /> <services> <service name="WebApplicationTest.WCFProxy.EmployeeProxy" behaviorConfiguration="MyServiceTypeBehaviors" > <endpoint address="" behaviorConfiguration="WebApplicationTest.WCFProxy.EmployeeProxyAspNetAjaxBehavior" binding="webHttpBinding" contract="WebApplicationTest.WCFProxy.EmployeeProxy" /> <endpoint contract="IMetadataExchange" binding="mexHttpBinding" address="mex" /> </service> <service name="WebApplicationTest.WCFProxy.EntityDataFieldCollectionProxy" behaviorConfiguration="MyServiceTypeBehaviors" > <endpoint address="" behaviorConfiguration="WebApplicationTest.WCFProxy.EntityDataFieldCollectionProxyAspNetAjaxBehavior" binding="webHttpBinding" contract="WebApplicationTest.WCFProxy.EntityDataFieldCollectionProxy" /> <endpoint contract="IMetadataExchange" binding="mexHttpBinding" address="mex" /> </service> <service name="WebApplicationTest.WCFProxy.Service1"> <endpoint address="" behaviorConfiguration="WebApplicationTest.WCFProxy.Service1AspNetAjaxBehavior" binding="webHttpBinding" contract="WebApplicationTest.WCFProxy.Service1" /> </service> <service name="WebApplicationTest.WCFProxy.ContactProxy" behaviorConfiguration="MyServiceTypeBehaviors" ><!--new--> <endpoint address="" behaviorConfiguration="WebApplicationTest.WCFProxy.ContactProxyAspNetAjaxBehavior" binding="webHttpBinding" contract="WebApplicationTest.WCFProxy.ContactProxy" /> <endpoint contract="IMetadataExchange" binding="mexHttpBinding" address="mex" /> </service> </services> <bindings /> <client /> </system.serviceModel> </configuration>

  Read the article

• SetWindowHookEx and execution blocking

  - by Kalaz

  Hello, I just wonder... I mainly use .NET but now I started to investigate WINAPI calls. For example I am using this piece of code to hook to the API functions. It starts freezing, when I try to debug the application... using System; using System.Diagnostics; using System.Runtime.InteropServices; using System.Threading; using System.Windows.Forms; public class Keyboard { private const int WH_KEYBOARD_LL = 13; private const int WM_KEYDOWN = 0x0100; private static LowLevelKeyboardProc _proc = HookCallback; private static IntPtr _hookID = IntPtr.Zero; public static event Action<Keys,bool, bool> KeyDown; public static void Hook() { new Thread(new ThreadStart(()=> { _hookID = SetHook(_proc); Application.Run(); })).Start(); } public static void Unhook() { UnhookWindowsHookEx(_hookID); } private static IntPtr SetHook(LowLevelKeyboardProc proc) { using (Process curProcess = Process.GetCurrentProcess()) using (ProcessModule curModule = curProcess.MainModule) { return SetWindowsHookEx(WH_KEYBOARD_LL, proc, GetModuleHandle(curModule.ModuleName), 0); } } private delegate IntPtr LowLevelKeyboardProc( int nCode, IntPtr wParam, IntPtr lParam); private static IntPtr HookCallback( int nCode, IntPtr wParam, IntPtr lParam) { if (nCode >= 0 && wParam == (IntPtr)WM_KEYDOWN) { int vkCode = Marshal.ReadInt32(lParam); Keys k = (Keys) vkCode; if (KeyDown != null) { KeyDown.BeginInvoke(k, IsKeyPressed(VirtualKeyStates.VK_CONTROL), IsKeyPressed(VirtualKeyStates.VK_SHIFT),null,null); } } return CallNextHookEx(_hookID, nCode, wParam, lParam); } private static bool IsKeyPressed(VirtualKeyStates virtualKeyStates) { return (GetKeyState(virtualKeyStates) & (1 << 7))==128; } [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr SetWindowsHookEx(int idHook, LowLevelKeyboardProc lpfn, IntPtr hMod, uint dwThreadId); [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] [return: MarshalAs(UnmanagedType.Bool)] private static extern bool UnhookWindowsHookEx(IntPtr hhk); [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr CallNextHookEx(IntPtr hhk, int nCode, IntPtr wParam, IntPtr lParam); [DllImport("kernel32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr GetModuleHandle(string lpModuleName); [DllImport("user32.dll")] static extern short GetKeyState(VirtualKeyStates nVirtKey); } enum VirtualKeyStates : int { VK_LBUTTON = 0x01, VK_RBUTTON = 0x02, VK_CANCEL = 0x03, VK_MBUTTON = 0x04, // VK_XBUTTON1 = 0x05, VK_XBUTTON2 = 0x06, // VK_BACK = 0x08, VK_TAB = 0x09, // VK_CLEAR = 0x0C, VK_RETURN = 0x0D, // VK_SHIFT = 0x10, VK_CONTROL = 0x11, VK_MENU = 0x12, VK_PAUSE = 0x13, VK_CAPITAL = 0x14, // VK_KANA = 0x15, VK_HANGEUL = 0x15, /* old name - should be here for compatibility */ VK_HANGUL = 0x15, VK_JUNJA = 0x17, VK_FINAL = 0x18, VK_HANJA = 0x19, VK_KANJI = 0x19, // VK_ESCAPE = 0x1B, // VK_CONVERT = 0x1C, VK_NONCONVERT = 0x1D, VK_ACCEPT = 0x1E, VK_MODECHANGE = 0x1F, // VK_SPACE = 0x20, VK_PRIOR = 0x21, VK_NEXT = 0x22, VK_END = 0x23, VK_HOME = 0x24, VK_LEFT = 0x25, VK_UP = 0x26, VK_RIGHT = 0x27, VK_DOWN = 0x28, VK_SELECT = 0x29, VK_PRINT = 0x2A, VK_EXECUTE = 0x2B, VK_SNAPSHOT = 0x2C, VK_INSERT = 0x2D, VK_DELETE = 0x2E, VK_HELP = 0x2F, // VK_LWIN = 0x5B, VK_RWIN = 0x5C, VK_APPS = 0x5D, // VK_SLEEP = 0x5F, // VK_NUMPAD0 = 0x60, VK_NUMPAD1 = 0x61, VK_NUMPAD2 = 0x62, VK_NUMPAD3 = 0x63, VK_NUMPAD4 = 0x64, VK_NUMPAD5 = 0x65, VK_NUMPAD6 = 0x66, VK_NUMPAD7 = 0x67, VK_NUMPAD8 = 0x68, VK_NUMPAD9 = 0x69, VK_MULTIPLY = 0x6A, VK_ADD = 0x6B, VK_SEPARATOR = 0x6C, VK_SUBTRACT = 0x6D, VK_DECIMAL = 0x6E, VK_DIVIDE = 0x6F, VK_F1 = 0x70, VK_F2 = 0x71, VK_F3 = 0x72, VK_F4 = 0x73, VK_F5 = 0x74, VK_F6 = 0x75, VK_F7 = 0x76, VK_F8 = 0x77, VK_F9 = 0x78, VK_F10 = 0x79, VK_F11 = 0x7A, VK_F12 = 0x7B, VK_F13 = 0x7C, VK_F14 = 0x7D, VK_F15 = 0x7E, VK_F16 = 0x7F, VK_F17 = 0x80, VK_F18 = 0x81, VK_F19 = 0x82, VK_F20 = 0x83, VK_F21 = 0x84, VK_F22 = 0x85, VK_F23 = 0x86, VK_F24 = 0x87, // VK_NUMLOCK = 0x90, VK_SCROLL = 0x91, // VK_OEM_NEC_EQUAL = 0x92, // '=' key on numpad // VK_OEM_FJ_JISHO = 0x92, // 'Dictionary' key VK_OEM_FJ_MASSHOU = 0x93, // 'Unregister word' key VK_OEM_FJ_TOUROKU = 0x94, // 'Register word' key VK_OEM_FJ_LOYA = 0x95, // 'Left OYAYUBI' key VK_OEM_FJ_ROYA = 0x96, // 'Right OYAYUBI' key // VK_LSHIFT = 0xA0, VK_RSHIFT = 0xA1, VK_LCONTROL = 0xA2, VK_RCONTROL = 0xA3, VK_LMENU = 0xA4, VK_RMENU = 0xA5, // VK_BROWSER_BACK = 0xA6, VK_BROWSER_FORWARD = 0xA7, VK_BROWSER_REFRESH = 0xA8, VK_BROWSER_STOP = 0xA9, VK_BROWSER_SEARCH = 0xAA, VK_BROWSER_FAVORITES = 0xAB, VK_BROWSER_HOME = 0xAC, // VK_VOLUME_MUTE = 0xAD, VK_VOLUME_DOWN = 0xAE, VK_VOLUME_UP = 0xAF, VK_MEDIA_NEXT_TRACK = 0xB0, VK_MEDIA_PREV_TRACK = 0xB1, VK_MEDIA_STOP = 0xB2, VK_MEDIA_PLAY_PAUSE = 0xB3, VK_LAUNCH_MAIL = 0xB4, VK_LAUNCH_MEDIA_SELECT = 0xB5, VK_LAUNCH_APP1 = 0xB6, VK_LAUNCH_APP2 = 0xB7, // VK_OEM_1 = 0xBA, // ';:' for US VK_OEM_PLUS = 0xBB, // '+' any country VK_OEM_COMMA = 0xBC, // ',' any country VK_OEM_MINUS = 0xBD, // '-' any country VK_OEM_PERIOD = 0xBE, // '.' any country VK_OEM_2 = 0xBF, // '/?' for US VK_OEM_3 = 0xC0, // '`~' for US // VK_OEM_4 = 0xDB, // '[{' for US VK_OEM_5 = 0xDC, // '\|' for US VK_OEM_6 = 0xDD, // ']}' for US VK_OEM_7 = 0xDE, // ''"' for US VK_OEM_8 = 0xDF, // VK_OEM_AX = 0xE1, // 'AX' key on Japanese AX kbd VK_OEM_102 = 0xE2, // "<>" or "\|" on RT 102-key kbd. VK_ICO_HELP = 0xE3, // Help key on ICO VK_ICO_00 = 0xE4, // 00 key on ICO // VK_PROCESSKEY = 0xE5, // VK_ICO_CLEAR = 0xE6, // VK_PACKET = 0xE7, // VK_OEM_RESET = 0xE9, VK_OEM_JUMP = 0xEA, VK_OEM_PA1 = 0xEB, VK_OEM_PA2 = 0xEC, VK_OEM_PA3 = 0xED, VK_OEM_WSCTRL = 0xEE, VK_OEM_CUSEL = 0xEF, VK_OEM_ATTN = 0xF0, VK_OEM_FINISH = 0xF1, VK_OEM_COPY = 0xF2, VK_OEM_AUTO = 0xF3, VK_OEM_ENLW = 0xF4, VK_OEM_BACKTAB = 0xF5, // VK_ATTN = 0xF6, VK_CRSEL = 0xF7, VK_EXSEL = 0xF8, VK_EREOF = 0xF9, VK_PLAY = 0xFA, VK_ZOOM = 0xFB, VK_NONAME = 0xFC, VK_PA1 = 0xFD, VK_OEM_CLEAR = 0xFE } It works well even if you put messagebox into the event or something that blocks execution. But it gets bad if you try to put breakpoint into the event. Why? I mean event is not run in the same thread that the windows hook is. That means that It shouldn't block HookCallback. It does however... I would really like to know why is this happening. My theory is that Visual Studio when breaking execution temporarily stops all threads and that means that HookCallback is blocked... Is there any book or valuable resource that would explain concepts behind all of this threading?

  Read the article

• What's wrong with Bundler working with RubyGems to push a Git repo to Heroku?

  - by stanigator

  I've made sure that all the files are in the root of the repository as recommended in this discussion. However, as I follow the instructions in this section of the book, I can't get through the section without the problems. What do you think is happening with my system that's causing the error? I have no clue at the moment of what the problem means despite reading the following in the log. Thanks in advance for your help! stanley@ubuntu:~/rails_sample/first_app$ git push heroku master Warning: Permanently added the RSA host key for IP address '50.19.85.156' to the list of known hosts. Counting objects: 96, done. Compressing objects: 100% (79/79), done. Writing objects: 100% (96/96), 28.81 KiB, done. Total 96 (delta 22), reused 0 (delta 0) -----> Heroku receiving push -----> Ruby/Rails app detected -----> Installing dependencies using Bundler version 1.2.0.pre Running: bundle install --without development:test --path vendor/bundle --binstubs bin/ --deployment Fetching gem metadata from https://rubygems.org/....... Installing rake (0.9.2.2) Installing i18n (0.6.0) Installing multi_json (1.3.5) Installing activesupport (3.2.3) Installing builder (3.0.0) Installing activemodel (3.2.3) Installing erubis (2.7.0) Installing journey (1.0.3) Installing rack (1.4.1) Installing rack-cache (1.2) Installing rack-test (0.6.1) Installing hike (1.2.1) Installing tilt (1.3.3) Installing sprockets (2.1.3) Installing actionpack (3.2.3) Installing mime-types (1.18) Installing polyglot (0.3.3) Installing treetop (1.4.10) Installing mail (2.4.4) Installing actionmailer (3.2.3) Installing arel (3.0.2) Installing tzinfo (0.3.33) Installing activerecord (3.2.3) Installing activeresource (3.2.3) Installing coffee-script-source (1.3.3) Installing execjs (1.3.2) Installing coffee-script (2.2.0) Installing rack-ssl (1.3.2) Installing json (1.7.3) with native extensions Installing rdoc (3.12) Installing thor (0.14.6) Installing railties (3.2.3) Installing coffee-rails (3.2.2) Installing jquery-rails (2.0.2) Using bundler (1.2.0.pre) Installing rails (3.2.3) Installing sass (3.1.18) Installing sass-rails (3.2.5) Installing sqlite3 (1.3.6) with native extensions Gem::Installer::ExtensionBuildError: ERROR: Failed to build gem native extension. /usr/local/bin/ruby extconf.rb checking for sqlite3.h... no sqlite3.h is missing. Try 'port install sqlite3 +universal' or 'yum install sqlite-devel' and check your shared library search path (the location where your sqlite3 shared library is located). *** extconf.rb failed *** Could not create Makefile due to some reason, probably lack of necessary libraries and/or headers. Check the mkmf.log file for more details. You may need configuration options. Provided configuration options: --with-opt-dir --without-opt-dir --with-opt-include --without-opt-include=${opt-dir}/include --with-opt-lib --without-opt-lib=${opt-dir}/lib --with-make-prog --without-make-prog --srcdir=. --curdir --ruby=/usr/local/bin/ruby --with-sqlite3-dir --without-sqlite3-dir --with-sqlite3-include --without-sqlite3-include=${sqlite3-dir}/include --with-sqlite3-lib --without-sqlite3-lib=${sqlite3-dir}/lib --enable-local --disable-local Gem files will remain installed in /tmp/build_3tplrxvj7qa81/vendor/bundle/ruby/1.9.1/gems/sqlite3-1.3.6 for inspection. Results logged to /tmp/build_3tplrxvj7qa81/vendor/bundle/ruby/1.9.1/gems/sqlite3-1.3.6/ext/sqlite3/gem_make.out An error occurred while installing sqlite3 (1.3.6), and Bundler cannot continue. Make sure that `gem install sqlite3 -v '1.3.6'` succeeds before bundling. ! ! Failed to install gems via Bundler. ! ! Heroku push rejected, failed to compile Ruby/rails app To [email protected]:growing-mountain-2788.git ! [remote rejected] master -> master (pre-receive hook declined) error: failed to push some refs to '[email protected]:growing-mountain-2788.git' ------Gemfile------------------------ As requested, here's the auto-generated gemfile: source 'https://rubygems.org' gem 'rails', '3.2.3' # Bundle edge Rails instead: # gem 'rails', :git => 'git://github.com/rails/rails.git' gem 'sqlite3' gem 'json' # Gems used only for assets and not required # in production environments by default. group :assets do gem 'sass-rails', '~> 3.2.3' gem 'coffee-rails', '~> 3.2.1' # See https://github.com/sstephenson/execjs#readme for more supported runtimes # gem 'therubyracer', :platform => :ruby gem 'uglifier', '>= 1.0.3' end gem 'jquery-rails' # To use ActiveModel has_secure_password # gem 'bcrypt-ruby', '~> 3.0.0' # To use Jbuilder templates for JSON # gem 'jbuilder' # Use unicorn as the app server # gem 'unicorn' # Deploy with Capistrano # gem 'capistrano' # To use debugger # gem 'ruby-debug'

  Read the article

• ASp.Net Mvc 1.0 Dynamic Images Returned from Controller taking 154 seconds+ to display in IE8, firef

  - by julian guppy

  I have a curious problem with IE, IIS 6.0 dynamic PNG files and I am baffled as to how to fix.. Snippet from Helper (this returns the URL to the view for requesting the images from my Controller. string url = LinkBuilder.BuildUrlFromExpression(helper.ViewContext.RequestContext, helper.RouteCollection, c = c.FixHeight(ir.Filename, ir.AltText, "FFFFFF")); url = url.Replace("&", "&"); sb.Append(string.Format("<removed id=\"TheImage\" src=\"{0}\" alt=\"\" /", url)+Environment.NewLine); This produces a piece of html as follows:- img id="TheImage" src="/ImgText/FixHeight?sFile=Images%2FUser%2FJulianGuppy%2FMediums%2Fconservatory.jpg&backgroundColour=FFFFFF" alt="" / brackets missing because i cant post an image... even though I dont want to post an image I jsut want to post the markup... sigh Snippet from Controller ImgTextController /// <summary> /// This function fixes the height of the image /// </summary> /// <param name="sFile"></param> /// <param name="alternateText"></param> /// <param name="backgroundColour"></param> /// <returns></returns> [AcceptVerbs(HttpVerbs.Get)] public ActionResult FixHeight(string sFile, string alternateText, string backgroundColour) { #region File if (string.IsNullOrEmpty(sFile)) { return new ImgTextResult(); } // MVC specific change to prepend the new directory if (sFile.IndexOf("Content") == -1) { sFile = "~/Content/" + sFile; } // open the file System.Drawing.Image img; try { img = System.Drawing.Image.FromFile(Server.MapPath(sFile)); } catch { img = null; } // did we fail? if (img == null) { return new ImgTextResult(); } #endregion File #region Width // Sort out the width from the image passed to me Int32 nWidth = img.Width; #endregion Width #region Height Int32 nHeight = img.Height; #endregion Height // What is the ideal height given a width of 2100 this should be 1400. var nIdealHeight = (int)(nWidth / 1.40920096852); // So is the actual height of the image already greater than the ideal height? Int32 nSplit; if (nIdealHeight < nHeight) { // Yes, do nothing, well i need to return the iamge... nSplit = 0; } else { // rob wants to not show the white at the top or bottom, so if we were to crop the image how would be do it // 1. Calculate what the width should be If we dont adjust the heigt var newIdealWidth = (int)(nHeight * 1.40920096852); // 2. This newIdealWidth should be smaller than the existing width... so work out the split on that Int32 newSplit = (nWidth - newIdealWidth) / 2; // 3. Now recrop the image using 0-nHeight as the height (i.e. full height) // but crop the sides so that its the correct aspect ration var newRect = new Rectangle(newSplit, 0, newIdealWidth, nHeight); img = CropImage(img, newRect); nHeight = img.Height; nWidth = img.Width; nSplit = 0; } // No, so I want to place this image on a larger canvas and we do this by Creating a new image to be the size that we want System.Drawing.Image canvas = new Bitmap(nWidth, nIdealHeight, PixelFormat.Format24bppRgb); Graphics g = Graphics.FromImage(canvas); #region Color // Whilst we can set the background colour we shall default to white if (string.IsNullOrEmpty(backgroundColour)) { backgroundColour = "FFFFFF"; } Color bc = ColorTranslator.FromHtml("#" + backgroundColour); #endregion Color // Filling the background (which gives us our broder) Brush backgroundBrush = new SolidBrush(bc); g.FillRectangle(backgroundBrush, -1, -1, nWidth + 1, nIdealHeight + 1); // draw the image at the position var rect = new Rectangle(0, nSplit, nWidth, nHeight); g.DrawImage(img, rect); return new ImgTextResult { Image = canvas, ImageFormat = ImageFormat.Png }; } My ImgTextResult is a class that returns an Action result for me but embedding the image from a memory stream into the response.outputstream. snippet from my ImageResults /// <summary> /// Execute the result /// </summary> /// <param name="context"></param> public override void ExecuteResult(ControllerContext context) { // output context.HttpContext.Response.Clear(); context.HttpContext.Response.ContentType = "image/png"; try { var memStream = new MemoryStream(); Image.Save(memStream, ImageFormat.Png); context.HttpContext.Response.BinaryWrite(memStream.ToArray()); context.HttpContext.Response.Flush(); context.HttpContext.Response.Close(); memStream.Dispose(); Image.Dispose(); } catch (Exception ex) { string a = ex.Message; } } Now all of this works locally and lovely, and indeed all of this works on my production server BUT Only for Firefox, Safari, Chrome (and other browsers) IE has a fit and decides that it either wont display the image or it does display the image after approx 154seconds of waiting..... I have made sure my HTML is XHTML compliant, I have made sure I am getting no Routing errors or crashes in my event log on the server.... Now obviously I have been a muppet and have done something wrong... but what I cant fathom is why in development all works fine, and in production all non IE browsers also work fine, but IE 8 using IIS 6.0 production server is having some kind of problem in returning this PNG and I dont have an error to trace... so what I am looking for is guidance as to how I can debug this problem.

  Read the article

< Previous Page | 620 621 622 623 624 625 626 627 628 629 630 631  | Next Page >