Search Results

Search found 34016 results on 1361 pages for 'static content'.

Page 626/1361 | < Previous Page | 622 623 624 625 626 627 628 629 630 631 632 633  | Next Page >

  • Mails are coming from mail server to my account automatically...???

    - by Jayakrishnan T
    Hi all, i am getting same mail from admin account of my mail server every day automatically.The content of the mail is given below. Click here to access your spam quarantine. The spam quarantine contains emails that are being held from your email account. Quarantined emails can be released to your inbox or deleted using the spam quarantine link. Please give me an advice to solve this problem.

    Read the article

  • Configure server on network to analyze traffic

    - by Strajan Sebastian
    I have the following network: http://i.stack.imgur.com/rapkH.jpg I want to send all the traffic from the devices that connect to the 192.168.0.1 router to the 192.168.10.1 router(and eventually to the Internet), by passing through the server and an additional router. Almost 2 days have passed and I can't figure what is wrong. While searching on the Internet for some similar configuration I found some articles that are somehow related to my needs, but the proposed solutions don't seem to work for me. This is a similar article: iptables forwarding between two interface I done the following steps for the configuration process: Set static IP address 192.168.1.90 for the eth0 on the server from the 192.168.1.1 router Set static IP address 192.168.0.90 for the eth1 on the server from the 192.168.0.1 router Forwarded all the traffic from 192.168.0.1 router to the server on eth1 interface witch seems to be working. The router firmware has some option to redirect all the traffic from all the ports to a specified address. Added the following rules on the server(Only the following, there aren't any additional rules): iptables -t nat -A POSTROUTING -o eth1 -j MASQUERADE iptables -A FORWARD -i eth1 -o eth0 -m state -–state RELATED,ESTABLISHED -j ACCEPT iptables -A FORWARD -i eth0 -o eth1 -j ACCEPT I also tried changing iptables -A FORWARD -i eth1 -o eth0 -m state -–state RELATED,ESTABLISHED -j ACCEPT into iptables -A FORWARD -i eth1 -o eth0 -j ACCEPT but still is not working. After adding the following to enable the packet forwarding for the server that is running CentOS: echo 1 /proc/sys/net/ipv4/ip_forward sysctl -w net.ipv4.ip_forward = 1 After a server restart and extra an extra check to see that all the configuration from above are still available I tried to see again if I can ping from a computer connected to 192.168.0.1/24 LAN the router from 192.168.1.1 but it didn't worked. The server has tshark(console wireshark) installed and I found that while sending a ping from a computer connected to 192.168.0.1 router to 192.168.1.1 the 192.168.0.90(eth1) receives the ping but it doesn't forward it to the eth0 interface as the rule tells: iptables -A FORWARD -i eth1 -o eth0 -j ACCEPT and don't now why this is happening. Questions: The iptables seem that don't work as I am expecting. Is there a need to add in the NAT table from iptables rules to redirect the traffic to the proper location, or is something else wrong with what I've done? I want to use tshark to view the traffic on the server because I think that is the best at doing this. Do you know something better that tshark to capture the traffic and maybe analyze it?

    Read the article

  • nginx + apache subdomain redirection fault

    - by webwolf
    i really need your advice folks since i'm experiencing some troubles with nginx & apache2 subdomains configs first of all, there's a site (say, site.com) and two subdomains (links.site.com and shop.site.com) whose files are physically located at the same level of FS hierarchy as the site.com itself my hoster has configured both apache and nginx by my request, but it still doesn't work as it used to both of subdomains point to the main page of site.com for some unknown and implicit (for me) reason :( my assumption is that's happen because site.com record is placed first in both configs?!.. please help me solve this out! every opinion would be appreciated =) nginx.conf: server { listen 95.169.187.234:80; server_name site.com www.site.com ; access_log /home/www/site.com/logs/nginx.access.log main; location ~* ^.+\.(jpeg|jpg|gif|png|ico|css|zip|tgz|gz|rar|bz2|doc|xls|exe|pdf|ppt|txt|tar|mid|midi|wav|bmp|rtf|js|swf|avi|mp3|mpg|mpeg|asf|vmw)$ { expires 30d; root /home/www/site.com/www; } #error_page 404 /404.html; # redirect server error pages to the static page /50x.html # error_page 500 502 503 504 /50x.html; location = /50x.html { root html; } # deny access to .htaccess files, if Apache's document root # concurs with nginx's one # location ~ /\.ht { deny all; } location / { set $referer $http_referer; proxy_pass http://127.0.0.1:8080/; proxy_redirect off; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for; proxy_set_header Referer $referer; proxy_set_header Host $host; client_max_body_size 10m; client_body_buffer_size 64k; proxy_connect_timeout 90; proxy_send_timeout 90; proxy_read_timeout 90; proxy_buffer_size 4k; proxy_buffers 4 32k; proxy_busy_buffers_size 64k; proxy_temp_file_write_size 64k; } } server { listen 95.169.187.234:80; server_name links.site.com www.links.site.com ; access_log /home/www/links.site.com/logs/nginx.access.log main; location ~* ^.+\.(jpeg|jpg|gif|png|ico|css|zip|tgz|gz|rar|bz2|doc|xls|exe|pdf|ppt|txt|tar|mid|midi|wav|bmp|rtf|js|swf|avi|mp3|mpg|mpeg|asf|vmw)$ { expires 30d; root /home/www/links.site.com/www; } #error_page 404 /404.html; # redirect server error pages to the static page /50x.html # error_page 500 502 503 504 /50x.html; location = /50x.html { root html; } # deny access to .htaccess files, if Apache's document root # concurs with nginx's one # location ~ /\.ht { deny all; } location / { set $referer $http_referer; proxy_pass http://127.0.0.1:8080/; proxy_redirect off; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for; proxy_set_header Referer $referer; proxy_set_header Host $host; client_max_body_size 10m; client_body_buffer_size 64k; proxy_connect_timeout 90; proxy_send_timeout 90; proxy_read_timeout 90; proxy_buffer_size 4k; proxy_buffers 4 32k; proxy_busy_buffers_size 64k; proxy_temp_file_write_size 64k; } } server { listen 95.169.187.234:80; server_name shop.site.com www.shop.site.com ; access_log /home/www/shop.site.com/logs/nginx.access.log main; location ~* ^.+\.(jpeg|jpg|gif|png|ico|css|zip|tgz|gz|rar|bz2|doc|xls|exe|pdf|ppt|txt|tar|mid|midi|wav|bmp|rtf|js|swf|avi|mp3|mpg|mpeg|asf|vmw)$ { expires 30d; root /home/www/shop.site.com/www; } #error_page 404 /404.html; # redirect server error pages to the static page /50x.html # error_page 500 502 503 504 /50x.html; location = /50x.html { root html; } # deny access to .htaccess files, if Apache's document root # concurs with nginx's one # location ~ /\.ht { deny all; } location / { set $referer $http_referer; proxy_pass http://127.0.0.1:8080/; proxy_redirect off; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for; proxy_set_header Referer $referer; proxy_set_header Host $host; client_max_body_size 10m; client_body_buffer_size 64k; proxy_connect_timeout 90; proxy_send_timeout 90; proxy_read_timeout 90; proxy_buffer_size 4k; proxy_buffers 4 32k; proxy_busy_buffers_size 64k; proxy_temp_file_write_size 64k; } } httpd.conf: # ServerRoot "/usr/local/apache2" PidFile /var/run/httpd.pid Timeout 300 KeepAlive On MaxKeepAliveRequests 100 KeepAliveTimeout 15 Listen 127.0.0.1:8080 NameVirtualHost 127.0.0.1:8080 ... #Listen *:80 NameVirtualHost *:80 ServerName www.site.com ServerAlias site.com UseCanonicalName Off CustomLog /home/www/site.com/logs/custom_log combined ErrorLog /home/www/site.com/logs/error_log DocumentRoot /home/www/site.com/www AllowOverride All Options +FollowSymLinks Options -MultiViews Options -Indexes Options Includes Order allow,deny Allow from all DirectoryIndex index.html index.htm index.php ServerName www.links.site.com ServerAlias links.site.com UseCanonicalName Off CustomLog /home/www/links.site.com/logs/custom_log combined ErrorLog /home/www/links.site.com/logs/error_log DocumentRoot /home/www/links.site.com/www AllowOverride All Options +FollowSymLinks Options -MultiViews Options -Indexes Options Includes Order allow,deny Allow from all DirectoryIndex index.html index.htm index.php ServerName www.shop.site.com ServerAlias shop.site.com UseCanonicalName Off CustomLog /home/www/shop.site.com/logs/custom_log combined ErrorLog /home/www/shop.site.com/logs/error_log DocumentRoot /home/www/shop.site.com/www AllowOverride All Options +FollowSymLinks Options -MultiViews Options -Indexes Options Includes Order allow,deny Allow from all DirectoryIndex index.html index.htm index.php # if DSO load module first: LoadModule rpaf_module modules/mod_rpaf-2.0.so RPAFenable On RPAFsethostname On RPAFproxy_ips 127.0.0.1 RPAFheader X-Forwarded-For Include conf/virthost/*.conf

    Read the article

  • Copying SharePoint DB to a new SharePoint 2010 server

    - by LJe
    Hi - we would like to know what is the best and easy way to configure a new SharePoint 2010 Server, we have backup the existing DB of SharePoint 2007 (up and running). We would like to mirror the same settings and content of our current SharePoint setup to the new server using the SharePoint 2010.

    Read the article

  • Ubuntu Server on live Internet

    - by vaibhav
    I just installed Ubuntu Server 12.04 in an office machine with openSSH, DNS and LAMP Server. I also made the IP static and I can access the server in my office premises easily, but when I try to access my server from my home it is not working. I know I have to make some changes and need to install some firewall (I had just gone through with a couple of posts) but I guess an expert advise will save my time here.

    Read the article

  • How can I make my eth0 connection default on startup?

    - by Alex
    I'm running kubuntu 9.10 and every time I log in auto eth0 is used instead of my custom connection called "batnet". I have batnet set to automatically connect, but despite this it is ignored and the default auto eth0 is used instead. This would be fine IF I could somehow figure out how to define a static ip for auto eth0. I would prefer to just make the 'batnet' connection default. How can I do this?

    Read the article

  • IIS, SSL, and Virtual Directories

    - by yodie
    I'm running a webserver on WS 2k3, IIS 6.0. Some of the content is on that server, but most is in a virtual directory linked to another server. Everything works (almost) fine when no SSL is used. However, when using SSL, I cannot access the files in the virtual directory. Instead I get a generic error 500. Any advice?

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Create a certificate file

    - by saeed hardan
    I have a proxy that I want to test. The proxy generates a private key and a certificate like here . I have tried to copy the content as in the link in a file and name it x.CER , then clicked on it and i got the message : This file is invalid for use as the following : Security Certificate how can i install them on windows ? note: I have set in internet options that all the traffic goes throw the proxy

    Read the article

  • Where should I configure software installed by 3rd-party chef recipes?

    - by FRKT
    I'm provisioning a Vagrant virtual machine with Chef and it's amazing, but I'm unsure where I should put code to configure software installed by 3rd-party chef recipes. For example, I'm installing NGINX with this recipe but I need to configure the default virtual host to serve content from /vagrant/public instead of /var/www/nginx-default. Should I change the template of the 3rd-party recipe, or create another recipe that reconfigures it?

    Read the article

  • How to allow only specific directories to use htaccess?

    - by DisgruntledGoat
    Currently in apache2.conf I have AllowOverride all set for /var/www which simply allows htaccess for all the sites on the server (which is Ubuntu, 9.04). However, I'd rather only allow overrides in each site root directory and nothing else. In other words, /var/www/site1, /var/www/site2, etc. can have a htaccess, but all other directories including /var/www and /var/www/site1/content cannot. Is there a way to do this without having to write a rule for every site on the server?

    Read the article

  • Java application delivery through CDN

    - by tuler
    We have a java application bundled as an applet or as webstart. The client java plugin caches the jar files on the client machine and downloads a new version if there is one. Is it possible to deliver this jar files using a CDN? What are the issues involved? Which CDNs would work for jar delivery? Is this different from static content delivery like images or video?

    Read the article

  • source command in Linux

    - by Rodnower
    My question is: why if I run some file with name aliases for example with content such as: alias lsa="ls -a" directly: $ ./aliases it don't create the alias (may be only in script context). But if I run it with command "source": $ source aliases it do the work? I mean after execution the alias "lsa" existing in context of command shell? "man source" give: "No manual entry for source", and in google I just found that it runs Tcl, but why Tcl influence shell context and bush not?

    Read the article

  • Multiple computers in SBS domain that need a Remote Desktop Connection with a sub domain

    - by Mark
    Hi all, I've been searching the internet for a while for this answer. I have a bunch of computers that are part of a small business server domain and would like to be able to connect to each one individually with remote desktop connection using a subdomain, like: computer1.mydomain.org computer2.mydomain.org etc... I can currently connect to the server easily using an A record with the subdomain pointing to the static IP address with home.mydomain.org, so computer1.home.mydomain.org would also be cool. Thanks!

    Read the article

  • Facebook, Twitter, Yahoo doesn't work

    - by Toktik
    Some sites doesn't work normally, they are open, without css, images and javascript errors... Facebook stucks on static.ak.fbcdn.net Twitter stucks on a1.twimg.com Yahoo stucks on l.yimg.com On firefox I'm receiving Waiting for ...(any of those). I can access facebook only with SSL. Like https://facebook.com I ping them, only receive request timed out.

    Read the article

  • Windows XP restarts itself suddenly

    - by LaD
    My computer (Windows XP sp3) gets stuck suddenly and restarts itself. When Windows loads I get the following message: error Signature: BCCode : 100000d1 BCP1 : 0000674B BCP2 : 00000002 BCP3 : 00000000 BCP4 : BA9910DC OSVer : 5_1_2600 SP : 3_0 Product : 256_1 error report content: C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\Mini090909-02.dmp C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\sysdata.xml Help! Thanks.

    Read the article

  • How do I configure Gnome 3 so that it doesn't pop up a dialog for 'open with files' when I mount a drive?

    - by michael
    I am running Gnome 3 on Ubuntu 11.10. In the file manager, when I click a drive under 'Devices', Gnome 3 always pops up a dialog with the choices 'open with files' and 'eject' and then I need to click 'open with files' to get rid of that dialog. Is there a way to configure Gnome 3 not to do that? I am in file manager already, clicking a drive should show the content in the right pane. Why does it still ask me to 'open with files'?

    Read the article

  • Cisco 861 Router forces one-to-one NAT

    - by Slurpee
    I have a cisco 861 router that only allows one-to-one NATs in order to access the Internet. I would like for computers to get an address via DHCP from this router, and be able to access the Internet without needing to set a static NAT to one of my public IPs. What is wrong with the configuration? I have a basic understanding of the IOS CLI, most of the configuration file (edited for content) was created by my company's long gone Senior Network Engineer.

    Read the article

  • Gzip not working in browser

    - by Cathal
    According to whatsmyip.org none of my browsers (Firefox, Chrome etc) on W7 are gzip enabled, it's saying 'NO, your browser is not requesting compressed content' which agrees with Chrome developer tools as I was testing a site and it was complaining that the page and css etc weren't compressed. I've searched for an answer but cannot find anything for this. I've tested from another pc connected to the router and that works fine, something on this pc is broke.... Any help tia

    Read the article

  • Which guide do you recommend on setting up Nginx

    - by Saif Bechan
    I am setting up an LEMP (Nginx, MySQL, PHP on Linux) from scratch. There are a lot of guides available online in all different forms. Now I want a setup with virtual hosts, and only serve dynamic content (PHP). My static files(images,css,js) are on a CDN. Do you know of a good guide on setting up the LEMP installation.

    Read the article

  • How can I configure OSX/Windows7 to send ALL traffic though VPN tunnel?

    - by lrrrgg
    While connected to a VPN (SwissVPN service), a content filter at a site I'm working at blocked a web page. This was perplexing, since the local site's filter should not be able to see my traffic, right? So I assume my web browsing activity was not going through the VPN tunnel. How can I configure the OS to send ALL traffic though the currently connected VPN tunnel? I'm using OSX Lion and Windows 7. Thanks!

    Read the article

  • How to schedule server jobs more intelligently than with cron?

    - by John
    I run a job every minute to reindex my site's content. Today, the search engine died, and when I logged in there were hundreds of orphan processes that had been started by cron. Is there another way using some kind of existing software that will let me execute a job every minute, but that won't launch another instance if that job doesn't return (i.e. because the search engine process has failed)?

    Read the article

  • How to register rss for a website?

    - by domainking
    I am not sure if I ask this question in the right place, because I am new to it. What I want to ask is, do I need to register/create RSS for my website? I have a website, lets say: [http://blog.domain.com] = its a 2.9.2 wordpress blog So, if I want to display the latest content in another subdomain, for example: [news.domain.com], how do I do that? I know a little bit of php and mysql.

    Read the article

< Previous Page | 622 623 624 625 626 627 628 629 630 631 632 633  | Next Page >