Search Results

Search found 34016 results on 1361 pages for 'static content'.

Page 626/1361 | < Previous Page | 622 623 624 625 626 627 628 629 630 631 632 633  | Next Page >

  • source command in Linux

    - by Rodnower
    My question is: why if I run some file with name aliases for example with content such as: alias lsa="ls -a" directly: $ ./aliases it don't create the alias (may be only in script context). But if I run it with command "source": $ source aliases it do the work? I mean after execution the alias "lsa" existing in context of command shell? "man source" give: "No manual entry for source", and in google I just found that it runs Tcl, but why Tcl influence shell context and bush not?

    Read the article

  • gzip compression good or bad?

    - by WarDoGG
    I have a server that currently does a lot of processing in my application and the target users are those who have a very good internet connection. The output that is sent from the server is always text/html and we do not use any media (audio/video) only images (static site images like logo,etc). We are experiencing severe performance issues and I wonder if turning off gzip/mod_deflate on the server so that the server would avoid compressing the output. Will this cause an improvement in performance?

    Read the article

  • How do I configure Gnome 3 so that it doesn't pop up a dialog for 'open with files' when I mount a drive?

    - by michael
    I am running Gnome 3 on Ubuntu 11.10. In the file manager, when I click a drive under 'Devices', Gnome 3 always pops up a dialog with the choices 'open with files' and 'eject' and then I need to click 'open with files' to get rid of that dialog. Is there a way to configure Gnome 3 not to do that? I am in file manager already, clicking a drive should show the content in the right pane. Why does it still ask me to 'open with files'?

    Read the article

  • Recover not properly burned DVD from camcoder

    - by tomo
    Can anybody suggest me any good and preferably free software - working on Vista / 7 - for recovering content from DVD disks? A few DVD-R VOB files cannot be read from disk by Windows. Probably the camera failed to burn it correctly. What I want to achieve is to skip a few invalid frames in VOB files and recreate proper MPEG stream - without re-encoding whole stream and loosing the quality.

    Read the article

  • Where should I configure software installed by 3rd-party chef recipes?

    - by FRKT
    I'm provisioning a Vagrant virtual machine with Chef and it's amazing, but I'm unsure where I should put code to configure software installed by 3rd-party chef recipes. For example, I'm installing NGINX with this recipe but I need to configure the default virtual host to serve content from /vagrant/public instead of /var/www/nginx-default. Should I change the template of the 3rd-party recipe, or create another recipe that reconfigures it?

    Read the article

  • Force www. on multi domain site and retain http or https [closed]

    - by John Isaacks
    I am using CakePHP which already contains an .htaccess file that looks like: <IfModule mod_rewrite.c> RewriteEngine on RewriteRule ^$ app/webroot/ [L] RewriteRule (.*) app/webroot/$1 [L] </IfModule> I want to force www. (unless it is a subdomain) to avoid duplicate content penalties. It needs to retain http or https Also This application will have multiple domains pointing to it. So the code needs to be able to work with any domain.

    Read the article

  • nginx + apache subdomain redirection fault

    - by webwolf
    i really need your advice folks since i'm experiencing some troubles with nginx & apache2 subdomains configs first of all, there's a site (say, site.com) and two subdomains (links.site.com and shop.site.com) whose files are physically located at the same level of FS hierarchy as the site.com itself my hoster has configured both apache and nginx by my request, but it still doesn't work as it used to both of subdomains point to the main page of site.com for some unknown and implicit (for me) reason :( my assumption is that's happen because site.com record is placed first in both configs?!.. please help me solve this out! every opinion would be appreciated =) nginx.conf: server { listen 95.169.187.234:80; server_name site.com www.site.com ; access_log /home/www/site.com/logs/nginx.access.log main; location ~* ^.+\.(jpeg|jpg|gif|png|ico|css|zip|tgz|gz|rar|bz2|doc|xls|exe|pdf|ppt|txt|tar|mid|midi|wav|bmp|rtf|js|swf|avi|mp3|mpg|mpeg|asf|vmw)$ { expires 30d; root /home/www/site.com/www; } #error_page 404 /404.html; # redirect server error pages to the static page /50x.html # error_page 500 502 503 504 /50x.html; location = /50x.html { root html; } # deny access to .htaccess files, if Apache's document root # concurs with nginx's one # location ~ /\.ht { deny all; } location / { set $referer $http_referer; proxy_pass http://127.0.0.1:8080/; proxy_redirect off; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for; proxy_set_header Referer $referer; proxy_set_header Host $host; client_max_body_size 10m; client_body_buffer_size 64k; proxy_connect_timeout 90; proxy_send_timeout 90; proxy_read_timeout 90; proxy_buffer_size 4k; proxy_buffers 4 32k; proxy_busy_buffers_size 64k; proxy_temp_file_write_size 64k; } } server { listen 95.169.187.234:80; server_name links.site.com www.links.site.com ; access_log /home/www/links.site.com/logs/nginx.access.log main; location ~* ^.+\.(jpeg|jpg|gif|png|ico|css|zip|tgz|gz|rar|bz2|doc|xls|exe|pdf|ppt|txt|tar|mid|midi|wav|bmp|rtf|js|swf|avi|mp3|mpg|mpeg|asf|vmw)$ { expires 30d; root /home/www/links.site.com/www; } #error_page 404 /404.html; # redirect server error pages to the static page /50x.html # error_page 500 502 503 504 /50x.html; location = /50x.html { root html; } # deny access to .htaccess files, if Apache's document root # concurs with nginx's one # location ~ /\.ht { deny all; } location / { set $referer $http_referer; proxy_pass http://127.0.0.1:8080/; proxy_redirect off; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for; proxy_set_header Referer $referer; proxy_set_header Host $host; client_max_body_size 10m; client_body_buffer_size 64k; proxy_connect_timeout 90; proxy_send_timeout 90; proxy_read_timeout 90; proxy_buffer_size 4k; proxy_buffers 4 32k; proxy_busy_buffers_size 64k; proxy_temp_file_write_size 64k; } } server { listen 95.169.187.234:80; server_name shop.site.com www.shop.site.com ; access_log /home/www/shop.site.com/logs/nginx.access.log main; location ~* ^.+\.(jpeg|jpg|gif|png|ico|css|zip|tgz|gz|rar|bz2|doc|xls|exe|pdf|ppt|txt|tar|mid|midi|wav|bmp|rtf|js|swf|avi|mp3|mpg|mpeg|asf|vmw)$ { expires 30d; root /home/www/shop.site.com/www; } #error_page 404 /404.html; # redirect server error pages to the static page /50x.html # error_page 500 502 503 504 /50x.html; location = /50x.html { root html; } # deny access to .htaccess files, if Apache's document root # concurs with nginx's one # location ~ /\.ht { deny all; } location / { set $referer $http_referer; proxy_pass http://127.0.0.1:8080/; proxy_redirect off; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for; proxy_set_header Referer $referer; proxy_set_header Host $host; client_max_body_size 10m; client_body_buffer_size 64k; proxy_connect_timeout 90; proxy_send_timeout 90; proxy_read_timeout 90; proxy_buffer_size 4k; proxy_buffers 4 32k; proxy_busy_buffers_size 64k; proxy_temp_file_write_size 64k; } } httpd.conf: # ServerRoot "/usr/local/apache2" PidFile /var/run/httpd.pid Timeout 300 KeepAlive On MaxKeepAliveRequests 100 KeepAliveTimeout 15 Listen 127.0.0.1:8080 NameVirtualHost 127.0.0.1:8080 ... #Listen *:80 NameVirtualHost *:80 ServerName www.site.com ServerAlias site.com UseCanonicalName Off CustomLog /home/www/site.com/logs/custom_log combined ErrorLog /home/www/site.com/logs/error_log DocumentRoot /home/www/site.com/www AllowOverride All Options +FollowSymLinks Options -MultiViews Options -Indexes Options Includes Order allow,deny Allow from all DirectoryIndex index.html index.htm index.php ServerName www.links.site.com ServerAlias links.site.com UseCanonicalName Off CustomLog /home/www/links.site.com/logs/custom_log combined ErrorLog /home/www/links.site.com/logs/error_log DocumentRoot /home/www/links.site.com/www AllowOverride All Options +FollowSymLinks Options -MultiViews Options -Indexes Options Includes Order allow,deny Allow from all DirectoryIndex index.html index.htm index.php ServerName www.shop.site.com ServerAlias shop.site.com UseCanonicalName Off CustomLog /home/www/shop.site.com/logs/custom_log combined ErrorLog /home/www/shop.site.com/logs/error_log DocumentRoot /home/www/shop.site.com/www AllowOverride All Options +FollowSymLinks Options -MultiViews Options -Indexes Options Includes Order allow,deny Allow from all DirectoryIndex index.html index.htm index.php # if DSO load module first: LoadModule rpaf_module modules/mod_rpaf-2.0.so RPAFenable On RPAFsethostname On RPAFproxy_ips 127.0.0.1 RPAFheader X-Forwarded-For Include conf/virthost/*.conf

    Read the article

  • IIS, SSL, and Virtual Directories

    - by yodie
    I'm running a webserver on WS 2k3, IIS 6.0. Some of the content is on that server, but most is in a virtual directory linked to another server. Everything works (almost) fine when no SSL is used. However, when using SSL, I cannot access the files in the virtual directory. Instead I get a generic error 500. Any advice?

    Read the article

  • Cisco 861 Router forces one-to-one NAT

    - by Slurpee
    I have a cisco 861 router that only allows one-to-one NATs in order to access the Internet. I would like for computers to get an address via DHCP from this router, and be able to access the Internet without needing to set a static NAT to one of my public IPs. What is wrong with the configuration? I have a basic understanding of the IOS CLI, most of the configuration file (edited for content) was created by my company's long gone Senior Network Engineer.

    Read the article

  • How to allow only specific directories to use htaccess?

    - by DisgruntledGoat
    Currently in apache2.conf I have AllowOverride all set for /var/www which simply allows htaccess for all the sites on the server (which is Ubuntu, 9.04). However, I'd rather only allow overrides in each site root directory and nothing else. In other words, /var/www/site1, /var/www/site2, etc. can have a htaccess, but all other directories including /var/www and /var/www/site1/content cannot. Is there a way to do this without having to write a rule for every site on the server?

    Read the article

  • How can I make my eth0 connection default on startup?

    - by Alex
    I'm running kubuntu 9.10 and every time I log in auto eth0 is used instead of my custom connection called "batnet". I have batnet set to automatically connect, but despite this it is ignored and the default auto eth0 is used instead. This would be fine IF I could somehow figure out how to define a static ip for auto eth0. I would prefer to just make the 'batnet' connection default. How can I do this?

    Read the article

  • Gzip not working in browser

    - by Cathal
    According to whatsmyip.org none of my browsers (Firefox, Chrome etc) on W7 are gzip enabled, it's saying 'NO, your browser is not requesting compressed content' which agrees with Chrome developer tools as I was testing a site and it was complaining that the page and css etc weren't compressed. I've searched for an answer but cannot find anything for this. I've tested from another pc connected to the router and that works fine, something on this pc is broke.... Any help tia

    Read the article

  • Copying SharePoint DB to a new SharePoint 2010 server

    - by LJe
    Hi - we would like to know what is the best and easy way to configure a new SharePoint 2010 Server, we have backup the existing DB of SharePoint 2007 (up and running). We would like to mirror the same settings and content of our current SharePoint setup to the new server using the SharePoint 2010.

    Read the article

  • How can I configure OSX/Windows7 to send ALL traffic though VPN tunnel?

    - by lrrrgg
    While connected to a VPN (SwissVPN service), a content filter at a site I'm working at blocked a web page. This was perplexing, since the local site's filter should not be able to see my traffic, right? So I assume my web browsing activity was not going through the VPN tunnel. How can I configure the OS to send ALL traffic though the currently connected VPN tunnel? I'm using OSX Lion and Windows 7. Thanks!

    Read the article

  • Encrypt windows 8 file history

    - by SnippetSpace
    File history is great but it saves your files on the external drive without any encryption and stores them using the exact same folder structure as the originals. If a bad guy gets his hands on the hard drive it could basically not be easier to get to your important files. Is there any way to encrypt the file history backup without breaking its functionality and without having to encrypt the original content itself? Thanks for your input!

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Streaming from a second computer

    - by techgod52
    I play games on my laptop, and they run at about 30-45 fps, which is bearable for me. But when I try to stream, the frame rate drops to 20 or lower, which is unplayable for me. I have a second computer though (a Mac, the laptop is Win7), and I'm wondering if there is anyway to stream the game content (onto Twitch.tv) from my laptop using my Mac. Is this possible, and how would I go about doing it?

    Read the article

  • Java application delivery through CDN

    - by tuler
    We have a java application bundled as an applet or as webstart. The client java plugin caches the jar files on the client machine and downloads a new version if there is one. Is it possible to deliver this jar files using a CDN? What are the issues involved? Which CDNs would work for jar delivery? Is this different from static content delivery like images or video?

    Read the article

  • Windows XP restarts itself suddenly

    - by LaD
    My computer (Windows XP sp3) gets stuck suddenly and restarts itself. When Windows loads I get the following message: error Signature: BCCode : 100000d1 BCP1 : 0000674B BCP2 : 00000002 BCP3 : 00000000 BCP4 : BA9910DC OSVer : 5_1_2600 SP : 3_0 Product : 256_1 error report content: C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\Mini090909-02.dmp C:\DOCUME~1\ADMINI~1\LOCALS~1\Temp\WER811d.dir00\sysdata.xml Help! Thanks.

    Read the article

  • Which guide do you recommend on setting up Nginx

    - by Saif Bechan
    I am setting up an LEMP (Nginx, MySQL, PHP on Linux) from scratch. There are a lot of guides available online in all different forms. Now I want a setup with virtual hosts, and only serve dynamic content (PHP). My static files(images,css,js) are on a CDN. Do you know of a good guide on setting up the LEMP installation.

    Read the article

  • How to schedule server jobs more intelligently than with cron?

    - by John
    I run a job every minute to reindex my site's content. Today, the search engine died, and when I logged in there were hundreds of orphan processes that had been started by cron. Is there another way using some kind of existing software that will let me execute a job every minute, but that won't launch another instance if that job doesn't return (i.e. because the search engine process has failed)?

    Read the article

  • How to determine which request nginx sends to a proxy and which it serves?

    - by Zxaos
    I currently have nginx proxying for Thin, but set up to serve static files for the app that Thin is serving instead of proxying the request. What I'd like to know is how I can check that the rules are set up correctly. Since Thin doesn't log requests, I would need to set up nginx logs in such a way that it shows which requests were served as files and which were passed to Thin. Is this even possible? If so, how?

    Read the article

  • windows 8.1 sync wallpaper slideshow

    - by March Ho
    I have the same slideshow in the exact same folder (C:\Images) on two computers which are syncing their settings over the Microsoft account (mail and other settings synced normally), and I have independently configured them to display wallpaper slideshows from that folder. However, the "Synced Theme" in Personalise Desktop repeatedly resets to a static image. Is there a way to ensure the sync sticks?

    Read the article

< Previous Page | 622 623 624 625 626 627 628 629 630 631 632 633  | Next Page >