Search Results

Search found 16059 results on 643 pages for 'global temp tables'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 65/643 | < Previous Page | 61 62 63 64 65 66 67 68 69 70 71 72  | Next Page >

  • Cumulative average using data from multiple rows in an excel table

    - by Aaron E
    I am trying to calculate a cumulative average column on a table I'm making in excel. I use the totals row for the ending cumulative average, but I would like to add a column that gives a cumulative average for each row up to that point. So, if I have 3 rows I want each row to have a column giving the average up to that row and then the ending cumulative average in the totals row. Right now I can't figure this out because I'd be having to reference in a formula rows above and below the current row and I'm unsure about how to go about it because it's a table and not just cells. If it was just cells then I know how to do the formula and copy it down each row, but being that the formula I need depends on whether or not a new row in the table is added or not I keep thinking that my formula would be something like: (Completion rate row 1/n) where n is the number of rows up to that point, here row 1, then ((Completion rate row 1 + Completion rate row 2)/n) for row 2 so n=2, and so on for each new row added. Please advise.

    Read the article

  • How to edit a table in the email reply (in Gmail)?

    - by imz
    I've received an email with an embedded table. I want to put some marks inside that table (i.e., edit the contentof the table) and send it back. Unfortunately, the Gmail interface doesn't seem to have table editing capabilities: after I hit reply, I see the table in the quoted text of the original message, but is not editable... If this is not possible in Gmail, how do I export the HTML source of this messsage and edit in another installed word processor?

    Read the article

  • Use Excel Table Column in ComboBox Input Range property

    - by V7L
    I asked this in StackOverflow and was redirected here. Apologies for redundancy. I have an Excel worksheet with a combo box on Sheet1 that is populated via its Input Range property from a Dynamic Named Range on Sheet2. It works fine and no VBA is required. My data on Sheet2 is actually in an Excel Table (all data is in the XLS file, no external data sources). For clarity, I wanted to use a structured table reference for the combo box's Input Range, but cannot seem to find a syntax that works, e.g. myTable[[#Data],[myColumn3]] I cannot find any indications that the combo box WILL accept structured table references, though I cannot see why it wouldn't. So, two part question: 1. Is is possible to use a table column reference in the combo box input range property (not using VBA) and 2. HOW?

    Read the article

  • OpenVPN + iptables / NAT routing

    - by Mikeage
    Hi, I'm trying to set up an OpenVPN VPN, which will carry some (but not all) traffic from the clients to the internet via the OpenVPN server. My OpenVPN server has a public IP on eth0, and is using tap0 to create a local network, 192.168.2.x. I have a client which connects from local IP 192.168.1.101 and gets VPN IP 192.168.2.3. On the server, I ran: iptables -A INPUT -i tap+ -j ACCEPT iptables -A FORWARD -i tap+ -j ACCEPT iptables -t nat -A POSTROUTING -s 192.168.2.0/24 -o eth0 -j MASQUERADE On the client, the default remains to route via 192.168.1.1. In order to point it to 192.168.2.1 for HTTP, I ran ip rule add fwmark 0x50 table 200 ip route add table 200 default via 192.168.2.1 iptables -t mangle -A OUTPUT -j MARK -p tcp --dport 80 --set-mark 80 Now, if I try accessing a website on the client (say, wget google.com), it just hangs there. On the server, I can see $ sudo tcpdump -n -i tap0 tcpdump: verbose output suppressed, use -v or -vv for full protocol decode listening on tap0, link-type EN10MB (Ethernet), capture size 96 bytes 05:39:07.928358 IP 192.168.1.101.34941 > 74.125.67.100.80: S 4254520618:4254520618(0) win 5840 <mss 1334,sackOK,timestamp 558838 0,nop,wscale 5> 05:39:10.751921 IP 192.168.1.101.34941 > 74.125.67.100.80: S 4254520618:4254520618(0) win 5840 <mss 1334,sackOK,timestamp 559588 0,nop,wscale 5> Where 74.125.67.100 is the IP it gets for google.com . Why isn't the MASQUERADE working? More precisely, I see that the source showing up as 192.168.1.101 -- shouldn't there be something to indicate that it came from the VPN? Edit: Some routes [from the client] $ ip route show table main 192.168.2.0/24 dev tap0 proto kernel scope link src 192.168.2.4 192.168.1.0/24 dev wlan0 proto kernel scope link src 192.168.1.101 metric 2 169.254.0.0/16 dev wlan0 scope link metric 1000 default via 192.168.1.1 dev wlan0 proto static $ ip route show table 200 default via 192.168.2.1 dev tap0

    Read the article

  • Dates not recognized as dates in pivot table pulling directly from SQL Server

    - by Michael K
    My pivot pulls from an external data source with a date column. Excel doesn't see this column as a date and the 'Format Cells' option panel doesn't change how the dates are displayed. The cell data is left-aligned, suggesting a string rather than a date. I have tried cast(myvar as date) and convert(varchar, myvar, 101) and convert(varchar, myvar, 1) in the base table, but none of these have been picked up by Excel as dates. If the column is recognized as a date, I can group by week and month. I understand that if I can't fix this, the next step is to add columns with weeks and months for each date to the table, but I'd like to give formatting the column one more shot before doing that.

    Read the article

  • Split a table in Word without losing row title

    - by Shane Hsu
    Word has the feature to repeat title row of a table when a table is so long that it spans a bunch of pages. I need to categorize my data into several pages, and I did that by splitting the table and insert page split to put them all in a page of itself. So now I got several page of data, but only the first page has title row. Is there anyway else to do this beside manually adding the title row to all the other pages? Original data: _________________ | Cat. Data | | 1 * | | 1 * | | 1 * | | 1 * | | 1 * | | 1 * | | 2 * | | 2 * | | 2 * | | 2 * | | 3 * | |___3______*______| And then turn it into: _________________ | Cat. Data | | 1 * | | 1 * | | 1 * | | 1 * | | 1 * | |___1______*______| Next page _________________ | Cat. Data | | 2 * | | 2 * | | 2 * | |___2______*______| Next Page _________________ | Cat. Data | | 3 * | |___3______*______|

    Read the article

  • Table Formatting in Excel 2007: How do I remove it?

    - by RocketGoal
    I've used the new Table Formatting option in Excel 2007. Now I can't remove it. I've dragged the little blue square up to the last cell on the top left, but it just won't go any further. In fact it just won't go at all. Clear all doesn't remove it. What does? I want my table back! I'm not a beginner with Excel, but this little annoyance has made me feel like on. Surely there must be some way to remove table format without deleting something or clearing all! Thanks Mike

    Read the article

  • MySQL: how to convert many MyISAM tables to InnoDB in a production database?

    - by Continuation
    We have a production database that is made up entirely of MyISAM tables. We are considering converting them to InnoDB to gain better concurrency & reliability. Can I just alter the myISAM tables to InnoDB without shutting down MySQL? What are the recommend procedures here? How long will such a conversion take? All the tables have a total size of about 700MB There are quite a large number of tables. Is there any way to apply ALTER TABLE to all the MyISAM tables at once instead of doing it one by one? Any pitfalls I need to be aware of? Thank you

    Read the article

  • Problems creating a functioning table

    - by Hoser
    This is a pretty simple SQL query I would assume, but I'm having problems getting it to work. if (object_id('#InfoTable')is not null) Begin Drop Table #InfoTable End create table #InfoTable (NameOfObject varchar(50), NameOfCounter varchar(50), SampledValue float(30), DayStamp datetime) insert into #InfoTable(NameOfObject, NameOfCounter, SampledValue, DayStamp) select vPerformanceRule.ObjectName AS NameOfObject, vPerformanceRule.CounterName AS NameOfCounter, Perf.vPerfRaw.SampleValue AS SampledValue, Perf.vPerfHourly.DateTime AS DayStamp from vPerformanceRule, vPerformanceRuleInstance, Perf.vPerfHourly, Perf.vPerfRaw where (ObjectName like 'Logical Disk' and CounterName like '% Free Space' AND SampleValue > 95 AND SampleValue < 100) order by DayStamp desc select NameOfObject, NameOfCounter, SampledValue, DayStamp from #InfoTable Drop Table #InfoTable I've tried various other forms of syntax, but no matter what I do, I get these error messages. Msg 207, Level 16, State 1, Line 10 Invalid column name 'NameOfObject'. Msg 207, Level 16, State 1, Line 10 Invalid column name 'NameOfCounter'. Msg 207, Level 16, State 1, Line 10 Invalid column name 'SampledValue'. Msg 207, Level 16, State 1, Line 10 Invalid column name 'DayStamp'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'NameOfObject'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'NameOfCounter'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'SampledValue'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'DayStamp'. Line 10 is the first 'insert into' line, and line 22 is the second select line. Any ideas?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Does OSB has any database dependency?

    - by Manoj Neelapu
    Major functionality of OSB is database independent. Most of the internal data-structures that re required by OSB are stored in-memory.Reporting functionality of OSB requires DB tables be accessible.http://download.oracle.com/docs/cd/E14571_01/doc.1111/e15017/before.htm#BABCJHDJ It should hover be noted that we can still run OSB with out creating any tables on database.In such cases the reporting functionality cannot be used where as other functions in OSB will work just as fine.We also see few errors in the log file indicating the absence of these tables which we can ignore.  If reporting function is required we will have to install few tables. http://download.oracle.com/docs/cd/E14571_01/doc.1111/e15017/before.htm#BABBBEHD indicates running RCU recommended. OSB reporting tables are bundled along with SOA schema in RCU. OSB requires two simple tables for reporting functionality and installing complete SOA schema is little far fetched. SOA schema contains lot of tables which OSB doesn't require at all. More over OSB tables are too simple to require a tool like an RCU.Solution to it would be to manually create those tables required for OSB. To make  life easier the definition of tables is available in dbscripts folder under OSB_HOME.eg. D:\Oracle\Middleware\osb\11gPS2\Oracle_OSB1\dbscripts. $OSB_HOME=D:\Oracle\Middleware\osb\11gPS2\Oracle_OSB1If you are not planning to use reporting feature in OSB, then we can also delete the JDBC data sources that comes along with standard OSB domain.WLST script to delete cgDataSources from OSB domain . OSB will work fine with out DB tables and JDBC Datasource.

    Read the article

  • ASP.Net Session_Start event not firing

    - by Jazza
    I have an ASP.Net 2.0 application in which the Session_Start event is not firing in my Global.asax file. Can anyone tell why this is happening and how I can get it working? The application worked fine on my Windows XP development machine, but stopped working when deployed to the server (Win Server 2003/IIS 6/ASP.Net 2.0). I'm not sure if this is relevant, but the server also hosts a SharePoint installation (WSS 3.0) which I know does change some settings at the default web site level.

    Read the article

  • How to make and use first object in Objective C to store sender tag

    - by dbonneville
    I started with a sample program that simply sets up a UIView with some buttons on it. Works great. I want to access the sender tag from each button and save it. My first thought was to save it to a global variable but I couldn't get it to work right. I thought the best way would be to create an object with one property and synthesize it so I can get or set it as needed. First, I created GlobalGem.h: #import <Foundation/Foundation.h> @interface GlobalGem : NSObject { int gemTag; } @property int gemTag; -(void) print; @end Then I created GlobalGem.m: #import "GlobalGem.h" @implementation GlobalGem @synthesize gemTag; -(void) print { NSLog(@"gemTag value is %i", gemTag); } @end The sample code I worked from doesn't do anything I can see in "main" where the program initializes. They just have their methods and are set up to handle IBOutlet actions. I want to use this object in the IBOutlet methods. But I don't know where to create the object. In the viewDidLoad, I tried this: GlobalGem *aGem = [[GlobalGem alloc]init]; [aGem print]; I added reference to the .h file of course. The print method works. In the nslog I get "gemTag value is 0". But now I want to use the instance aGem in some of the IBOutlet actions. For instance, if I put this same method in one of the outlet actions like this: - (IBAction)touchButton:(id)sender { [aGem print]; } ...I get a build error saying that "aGem is undeclared". Yes, I'm new to objective c and am very confused. Is the instance I created, aGem, in the viewDidLoad not accessible outside of that method? How would I create an instance of a Class that I can store a variable value that any of the IBOutlet methods can access? All the buttons need to be able to store their sender tag in the instance aGem and I'm stuck. As I mentioned earlier, I was able to write the sender tag to a global variable I declared in the UIView .h file that came with the program, but I ran into issues using it. Where am I off?

    Read the article

  • Python: How to make a cross-module variable?

    - by Dan Homerick
    The __debug__ variable is handy in part because it affects every module. If I want to create another variable that works the same way, how would I do it? The variable (let's be original and call it 'foo') doesn't have to be truly global, in the sense that if I change foo in one module, it is updated in others. I'd be fine if I could set foo before importing other modules and then they would see the same value for it.

    Read the article

  • Python __import__ parameter confusion

    - by CMC
    I'm trying to import a module, while passing some global variables, but it does not seem to work: File test_1: test_2 = __import__("test_2", {"testvar": 1}) File test_2: print testvar This seems like it should work, and print a 1, but I get the following error when I run test_1: Traceback (most recent call last): File ".../test_1.py", line 1, in <module> print testvar NameError: name 'testvar' is not defined What am I doing wrong?

    Read the article

  • [Flex 4 and .Net] Retrieving tables from SQL database

    - by mG
    Hi everyone, As the title says, I want to retrieve tables of data from a SQL database, using Flex 4 and .Net WebService. I'm new to both Flex and DotNet. Please tell me a proper way to do it. This is what I've done so far: Retrieving an array of string: (this works) .Net: [WebMethod] public String[] getTestArray() { String[] arStr = { "AAA", "BBB", "CCC", "DDD" }; return arStr; } Flex 4: <?xml version="1.0" encoding="utf-8"?> <s:Application xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" minWidth="955" minHeight="600"> <fx:Script> <![CDATA[ import mx.collections.ArrayCollection; import mx.controls.Alert; import mx.rpc.events.ResultEvent; [Bindable] private var ac:ArrayCollection = new ArrayCollection(); protected function btn_clickHandler(event:MouseEvent):void { ws.getTestArray(); } protected function ws_resultHandler(event:ResultEvent):void { ac = event.result as ArrayCollection; Alert.show(ac.toString()); } ]]> </fx:Script> <fx:Declarations> <s:WebService id="ws" wsdl="http://localhost:50582/Service1.asmx?WSDL" result="ws_resultHandler(event)"/> </fx:Declarations> <s:Button x="10" y="30" label="Button" id="btn" click="btn_clickHandler(event)"/> </s:Application> Retrieving a DataTable: (this does not work) DotNet: [WebMethod] public DataTable getUsers() { DataTable dt = new DataTable("Users"); SqlConnection conn = new SqlConnection("server = 192.168.1.50; database = MyDatabase; user id = sa; password = 1234; integrated security = false"); SqlDataAdapter da = new SqlDataAdapter("select vFName, vLName, vEmail from Users", conn); da.Fill(dt); return dt; } Flex 4: <?xml version="1.0" encoding="utf-8"?> <s:Application xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" minWidth="955" minHeight="600"> <fx:Script> <![CDATA[ import mx.collections.ArrayCollection; import mx.controls.Alert; import mx.rpc.events.ResultEvent; [Bindable] private var ac:ArrayCollection = new ArrayCollection(); protected function btn_clickHandler(event:MouseEvent):void { ws.getUsers(); } protected function ws_resultHandler(event:ResultEvent):void { ac = event.result as ArrayCollection; Alert.show(ac.toString()); } ]]> </fx:Script> <fx:Declarations> <s:WebService id="ws" wsdl="http://localhost:50582/Service1.asmx?WSDL" result="ws_resultHandler(event)"/> </fx:Declarations> <s:Button x="10" y="30" label="Button" id="btn" click="btn_clickHandler(event)"/> </s:Application>

    Read the article

  • How do I 'globally' catch exceptions thrown in object instances.

    - by SleepyBobos
    I am currently writing a winforms application (C#). I am making use of the Enterprise Library Exception Handling Block, following a fairly standard approach from what I can see. IE : In the Main method of Program.cs I have wired up event handler to Application.ThreadException event etc. This approach works well and handles the applications exceptional circumstances. In one of my business objects I throw various exceptions in the Set accessor of one of the objects properties set { if (value > MaximumTrim) throw new CustomExceptions.InvalidTrimValue("The value of the minimum trim..."); if (!availableSubMasterWidthSatisfiesAllPatterns(value)) throw new CustomExceptions.InvalidTrimValue("Another message..."); _minimumTrim = value; } My logic for this approach (without turning this into a 'when to throw exceptions' discussion) is simply that the business objects are responsible for checking business rule constraints and throwing an exception that can bubble up and be caught as required. It should be noted that in the UI of my application I do explictly check the values that the public property is being set to (and take action there displaying friendly dialog etc) but with throwing the exception I am also covering the situation where my business object may not be used by a UI eg : the Property is being set by another business object for example. Anyway I think you all get the idea. My issue is that these exceptions are not being caught by the handler wired up to Application.ThreadException and I don't understand why. From other reading I have done the Application.ThreadException event and it handler "... catches any exception that occurs on the main GUI thread". Are the exceptions being raised in my business object not in this thread? I have not created any new threads. I can get the approach to work if I update the code as follows, explicity calling the event handler that is wired to Application.ThreadException. This is the approach outlined in Enterprise Library samples. However this approach requires me to wrap any exceptions thrown in a try catch, something I was trying to avoid by using a 'global' handler to start with. try { if (value > MaximumTrim) throw new CustomExceptions.InvalidTrimValue("The value of the minimum..."); if (!availableSubMasterWidthSatisfiesAllPatterns(value)) throw new CustomExceptions.InvalidTrimValue("Another message"); _minimumTrim = value; } catch (Exception ex) { Program.ThreadExceptionHandler.ProcessUnhandledException(ex); } I have also investigated using wiring a handler up to AppDomain.UnhandledException event but this does not catch the exceptions either. I would be good if someone could explain to me why my exceptions are not being caught by my global exception handler in the first code sample. Is there another approach I am missing or am I stuck with wrapping code in try catch, shown above, as required?

    Read the article

  • word Application.AddIns.Add throws 'Word cannot open this document template'

    - by Vinay B R
    Hi, I have a template document with a simple macro to insert a file into a document. When i try to load this template file using Application.Addins.Add i am getting an error saying 'Word cannot open this document template'. wordApplication.AddIns.Add( %template file path%, ref trueObj ); This works fine on some machines. Also is there any way to make sure that we load the template file as a global Template always.

    Read the article

  • Adding nodes dynamically and global_groups in Erlang

    - by ZeissS
    Erlang support to partition its nodes into groups using the global_group module. Further, Erlang supports adding nodes on the fly to the node-network. Are these two features usable with each other? As far as I understand, you have to name every node on startup to use the global groups.

    Read the article

  • Comparing 2 tables column values and copying the next column content to the second table

    - by Sullan
    Hi All.. I am comparing between two tables first column each. If there is find a match i am copying the text from the adjacent cell of the first table to the second table. I am able to compare strings and get the value, but finding it difficult to print it in the second table. I am getting the value in the var "replaceText", but how to print it in the second table ?? Please help... Sample code is as follows.. <script type="text/javascript"> jQuery.noConflict(); jQuery(document).ready(function(){ jQuery('.itemname').each(function(){ var itemName = jQuery(this).text(); jQuery('.comparerow').each(function() { var compareRow = jQuery(this).text(); if (itemName == compareRow) { var replaceText = jQuery(this).next('td').text(); alert(replaceText); } }); }); }); </script> HTML is as follows <table width="100%"><thead> <tr> <th align="left" >Name</th><th>Description</th></tr></thead> <tbody> <tr> <td class="comparerow">IX0001</td> <td class="desc">Desc 1 </td> </tr> <tr> <td class="comparerow">IX0002</td> <td class="desc" >Desc 2 </td> </tr> <tr> <td class="comparerow">IX0003</td> <td class="desc">Desc 3 </td> </tr> <tr> <td class="comparerow">IX0004</td> <td class="desc">Desc 4 </td> </tr> </tbody> </table> <br /> <table width="100%"> <tr> <th>Name</th><th>Description</th> </tr> <tr > <td class="itemname">IX0001</td><td></td> </tr> <tr> <td class="itemname">IX0002</td><td></td> </tr> <tr> <td class="itemname">IX0003</td><td></td> </tr> </table>

    Read the article

  • Redirect in Application_Error redundant if using customErrors?

    - by Ek0nomik
    If I have a customErrors section in my Web.config that says to redirect to Error.html, then putting code in the Application_Error method in the Global.asax to redirect to Error.html is redundant is it not? Technically, I could bypass the Web.config by redirecting to a different page in the Application_Error method if I wanted to, but since I don't want to go to a separate page I don't think I need the code.

    Read the article

  • Pass variables between separate instances of ruby (without writing to a text file or database)

    - by boulder_ruby
    Lets say I'm running a long worker-script in one of several open interactive rails consoles. The script is updating columns in a very, very, very large table of records. I've muted the ActiveRecord logger to speed up the process, and instruct the script to output some record of progress so I know how roughly how long the process is going to take. That is what I am currently doing and it would look something like this: ModelName.all.each_with_index do |r, i| puts i if i % 250 ...runs some process... r.save end Sometimes its two nested arrays running, such that there would be multiple iterators and other things running all at once. Is there a way that I could do something like this and access that variable from a separate rails console? (such that the variable would be overwritten every time the process is run without much slowdown) records = ModelName.all $total = records.count records.each_with_index do |r, i| $i = i ...runs some process... r.save end meanwhile mid-process in other console puts "#{($i/$total * 100).round(2)}% complete" #=> 67.43% complete I know passing global variables from one separate instance of ruby to the next doesn't work. I also just tried this to no effect as well unix console 1 $X=5 echo {$X} #=> 5 unix console 2 echo {$X} #=> "" Lastly, I also know using global variables like this is a major software design pattern no-no. I think that's reasonable, but I'd still like to know how to break that rule if I'd like. Writing to a text file obviously would work. So would writing to a separate database table or something. That's not a bad idea. But the really cool trick would be sharing a variable between two instances without writing to a text file or database column. What would this be called anyway? Tunneling? I don't quite know how to tag this question. Maybe bad-idea is one of them. But honestly design-patterns isn't what this question is about.

    Read the article

  • Parsing tables, cells with Html agility in C#

    - by Kaeso
    I need to parse Html code. More specifically, parse each cell of every rows in all tables. Each row represent a single object and each cell represent different properties. I want to parse these to be able to write an XML file with every data inside (without the useless HTML code). This is the way I thought it out initially but I ran out of ideas: HTML: <tr> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF"> 1 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="left"> <a href="/ice/player.htm?id=8471675">Sidney Crosby</a> </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="center"> PIT </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="center"> C </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 39 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 32 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 33 </td> <td class="statBox sorted" style="border-width:0px 1px 1px 0px; background-color: #E0E0E0" align="right"> <font color="#000000"> 65 </font> </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 20 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 29 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 10 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 1 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 3 </td> <td class="statBox" style="border-width:0px 0px 1px 0px; background-color: #FFFFFF" align="right"> </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 0 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 154 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 20.8 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 21:54 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 22.6 </td> <td class="statBox" style="border-width:0px 0px 1px 0px; background-color: #FFFFFF" align="right"> 55.7 </td> </tr> C#: using HtmlAgilityPack; using System.Data; namespace Stats { class StatsParser { private string htmlCode; private static string fileName = "[" + DateTime.Now.ToShortDateString() + " NHL Stats].xml"; public StatsParser(string htmlCode) { this.htmlCode = htmlCode; this.ParseHtml(); } public DataTable ParseHtml() { var result = new DataTable(); HtmlDocument doc = new HtmlDocument(); doc.LoadHtml(htmlCode); HtmlNode row = doc.DocumentNode.SelectNodes("//tr"); foreach (var statBox in row.SelectNodes("//td[@class='statBox']")) { System.Windows.MessageBox.Show(statBox.InnerText); } } } }

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 61 62 63 64 65 66 67 68 69 70 71 72  | Next Page >