Search Results

Search found 6394 results on 256 pages for 'regular expressions'.

Page 65/256 | < Previous Page | 61 62 63 64 65 66 67 68 69 70 71 72  | Next Page >

  • Changing Windows 'hosts' file in guest OS under Parallels Desktop 6

    - by Jan
    Hi all, I am running Win7 in a Parallels Desktop 6 on Mac. I would like to modify my Windows hosts file. When doing this through notepad it says "You don't have permission to save in this location..." I am logged on as a regular windows user - not as 'local admin'. How can I edit the file? How can I grant my regular user 'local admin' rights? How can change the Windows user to 'admin' ... this option seems to be missing in my windows install... Does anybody recognize the issue? Thank you! J.

    Read the article

  • Yahoo toolbar and local sites (e.g. Intranet)

    - by Klaptrap
    We have local sites running on IIS in regular MS Windows network. User base has IE, FireFox and Chrome. Local sites are isolated by host headers and DNS record created for the common IP accordingly. This is a regular set-up. Users without Yahoo Toolbar type http://intranet and the sites resolves. Users with Yahoo toolbar type http://intranet and the toolbar goes off to search for this site in public domain. This is irrespective to whether the address is typed into the browser address bar or the toolbar. All versions of toolbar and IE are affected. I cannot see a setting on the toolbar to switch this "irritating" behaviour off and simply un-installing the toolbar is not an option. Any ideas?

    Read the article

  • Norton Ghost usage, Linux? ISO? Server? MBR?

    - by OverTheRainbow
    Before evaluating Symantec/Norton Ghost to image partitions, I have a couple of questions about using this tool: In the product page, it only mentions Windows: Can Norton image Linux partitions as well? Can I burn an ISO to create/recover images? The ISO's I found seem only able to restore an image but not create one. Does it mean that images can only be created from within a running Windows? For Windows partitions: Does it support both regular and Server versions? Acronis doesn't image Server partitions in the regular version When restoring an image, does Norton give the option of including/excluding the MBR? Thank you.

    Read the article

  • rsync osx to linux

    - by Nick
    I did a backup to a remote nfs folder with rsync, from a MAC to a Remote Debian. The final backup is 58GB less than the original. Rsync says that everything was OK, and nothing to update. Macintosh:/Volumes/Data1 root# du -sh Produccion/ 319G Produccion/ root@Disketera:/mnt/soho_storage/samba/shares# du -sh Produccion/ 260G Produccion/ can I trust in rsync? I'm using rsync -av --stats /Volumes/Data1/Produccion/ /mnt/red/ (/mnt/red is my samba mountpoint) Some differents folders root@Disketera:/mnt/soho_storage/samba/shares/Produccion/tiposok# du -sh * 0 IndoSanBol 0 IndoSans-Bold 0 IndoSans-Italic 0 IndoSans-Light 0 IndoSans-Regular 40K PalatinoLTStd-Black.otf 40K PalatinoLTStd-BlackItalic.otf 40K PalatinoLTStd-Bold.otf 44K PalatinoLTStd-BoldItalic.otf 44K PalatinoLTStd-Italic.otf 40K PalatinoLTStd-Light.otf 40K PalatinoLTStd-LightItalic.otf 40K PalatinoLTStd-Medium.otf 40K PalatinoLTStd-MediumItalic.otf 56K PalatinoLTStd-Roman.otf 12K TCL IndoSans_mac Macintosh:/Volumes/Data1/Produccion/tiposok root# du -sh * 36K IndoSanBol 40K IndoSans-Bold 36K IndoSans-Italic 36K IndoSans-Light 36K IndoSans-Regular 40K PalatinoLTStd-Black.otf 40K PalatinoLTStd-BlackItalic.otf 40K PalatinoLTStd-Bold.otf 44K PalatinoLTStd-BoldItalic.otf 44K PalatinoLTStd-Italic.otf 40K PalatinoLTStd-Light.otf 40K PalatinoLTStd-LightItalic.otf 40K PalatinoLTStd-Medium.otf 40K PalatinoLTStd-MediumItalic.otf 56K PalatinoLTStd-Roman.otf 160K TCL IndoSans_mac

    Read the article

  • Windows 7 blocks network access to network-installed apps

    - by VokinLoksar
    Windows 2008 R2 domain. Users, running Windows 7 Enterprise, are trying to run some software from a network share. Specifically, I've tested this with MATLAB and PuTTY. When starting, MATLAB has to contact a licensing server to get its license. This action fails for regular users when they start MATLAB from the network share. However, if they copy the installation directory to a local disk everything works fine. Running MATLAB as an admin user from the network share also works. Same story with PuTTY. If the executable is launched from the share, regular users cannot connect to any servers. Something is blocking network communications for programs that are launched from a network drive. Here's the only other mention I could find of the same problem: https://social.technet.microsoft.com/Forums/en-US/w7itpronetworking/thread/4504b192-0bc0-4402-8e00-a936ea7e6dff It's not the Windows firewall or the IE security settings. Does anyone have any clue as to what this is?

    Read the article

  • Font display issue (Mac OS X)?

    - by avenas8808
    I used a font manager on Mac OS X, for additional fonts in my graphic design projects without installing them to the fonts folder (I think that's how it works) - using Font Book and Font Explorer X Version 1.2.3 on OS X 10.6. Most fonts work fine, but Interstate has a problem: Interstate Regular is installed, but for some reason it's probably not seeing it; it's seeing all the Bold and Condensed versions fine. In the above image, it displays the second font as Interstate Regular, but it isn't that font... why? Also, how do I reset the system fonts folder back to the default-installed fonts (I think it's in the library folder) if worst comes to worst, and is using a font manager on Mac or Windows a good idea? I don't want to wreck my system, fairly new to using Mac, especially OS X, so any help would be gratefully accepted.

    Read the article

  • ESXi with non-headless VM

    - by Mike
    I'm going to receive a Xeon Server/Workstation soon and I was thinking about installing ESXi to host some server applications that I want (ex: SVN server, Web server, media server, etc). Most of these will be headless VM's. My question is: on top of all these headless VM's, is it possible for ESXi to have another VM that would be non-headless (so that it will output video through the VGA/DVI port)? Or are all VM's within ESXi only accessible through remote connections? I'll be using this non-headless VM like a regular workstation: browsing, development, media, gaming maybe. The other alternative I was thinking about is to install a very lightweight operating system and have the headless VM's running in Virtualbox. If it is possible to have have a non-headless VM, what would be the performance compared to a regular workstation? Noticeable or not when gaming?

    Read the article

  • How do I remove Windows Update uninstall files on Windows Server 2008?

    - by Robert Koritnik
    I'm running Windows Server 2008 Standard running in VMware. It has 2 disks: system disk: 16 GB data disk: 500 MB I installed Visual Studio 2008 SP1 + MSDN and some small tools and libraries that don't take much space. Over time the system disk's free space has been going down (I suspect because of regular system updates - NetFx (.NET), service packs, and regular updates). Questions 1 How do you remove Windows Update uninstall files from Windows Server 2008? Question 2 I also found lots of files in C:/Windows/Installer folder. Is it possible to determine which .msp file goes with which patch? I would like to delete some of them, because they do take a lot of space.

    Read the article

  • Frequent connection drops when playing online games (StarCraft 2, Battlefield 3) and behind NAT - how to diagnose? [migrated]

    - by Moshev
    I am having some trouble with (I suspect) my wireless router. It's connected to the internet with a regular lan cable and has a static, public IP address. Our two home PCs connect to the router with regular lan cables, plus there's a laptop which connects over wifi. diagram: Internet | | <- isp-supplied cat5 ethernet cable | D-Link D300 ...wifi... laptop / \ / <- cable -> \ PC1 PC2 The PCs and laptop are behind NAT and share the router's public IP. The router is a D-Link D300. PC1 is used for online gaming and I'm experiencing frequent "connection dropped" errors when playing Battlefield 3, StarCraft 2 and the Diablo 3 beta; but not with TeamFortress 2 or the Tribes Ascend beta. The issue goes away when I remove the router and connect PC1 directly to the ISP's cable. I have also tried disconnecting PC2 and the laptop, leaving PC1 as the only machine connected to the router - doesn't help. How can I diagnose what precisely the issue is?

    Read the article

  • Case in-sensitivity for Apache httpd Location directive

    - by user57178
    I am working with a solution that requires the usage of mod_proxy_balancer and an application server that both ignores case and mixes different case combinations in URLs found in generated content. The configuration works, however I have now a new requirement that causes problems. I should be able to create a location directive (as per http://httpd.apache.org/docs/current/mod/core.html#location ) and have the URL-path interpret in case insensitive mode. This requirement comes from the need to add authentication directives to the location. As you might guess, users (or the application in question) changing one letter to capital circumvents the protection instantly. The httpd runs on Unix platform so every configuration directive is apparently case sensitive by default. Should the regular expressions in the Location directive work in this case? Could someone please show me an example of such configuration that should work? In case a regular expression can not be forced to work case insensitively, what part of httpd's source code should I go around modifying?

    Read the article

  • Frequent connection drops when playing online games (StarCraft 2, Battlefield 3) and behind NAT - how to diagnose?

    - by Moshev
    I am having some trouble with (I suspect) my wireless router. It's connected to the internet with a regular lan cable and has a static, public IP address. Our two home PCs connect to the router with regular lan cables, plus there's a laptop which connects over wifi. diagram: Internet | | <- isp-supplied cat5 ethernet cable | D-Link D300 ...wifi... laptop / \ / <- cable -> \ PC1 PC2 The PCs and laptop are behind NAT and share the router's public IP. The router is a D-Link D300. PC1 is used for online gaming and I'm experiencing frequent "connection dropped" errors when playing Battlefield 3, StarCraft 2 and the Diablo 3 beta; but not with TeamFortress 2 or the Tribes Ascend beta. The issue goes away when I remove the router and connect PC1 directly to the ISP's cable. I have also tried disconnecting PC2 and the laptop, leaving PC1 as the only machine connected to the router - doesn't help. How can I diagnose what precisely the issue is?

    Read the article

  • Do you think Microsoft is finally on the right track with its Windows 7?

    - by Saif Bechan
    It has been a while now since Windows 7 has been released. So far I didn't hear of many major complaints about it. I can remember the time that Windows Vista hist the shelves. There were major complaints from both experts and just regular users. I do a lot of OS installs for just regular users. These are mostly family and friends, and sometimes there are some customers. Up till now I mostly still use Windows XP SP3, because it is stable and most people are familiar with it. I did Vista for some users but they always call me back with all sorts of questions and in the end I had to downgrade them to XP. Do you think it is safe now to recommend Windows 7 as a good operating system? Offcourse their hardware has to support it, but let's say that is the case. If you install Windows 7 a lot for people, what are the complaints about if you get them?

    Read the article

  • How many hours of use before I need to clean a tape drive?

    - by codeape
    I do backups to a HP Ultrium 2 tape drive (HP StorageWorks Ultrium 448). The drive has a 'Clean' LED that supposedly will light up or blink when the drive needs to be cleaned. The drive has been in use since october 2005, and still the 'Clean' light has never been lit. The drive statistics are: Total hours in use: 1603 Total bytes written: 19.7 TB Total bytes read: 19.3 TB My question is: How many hours of use can I expect before I need to clean the drive? Edit: I have not encountered any errors using the drive. I do restore tests every two months, and every backup is verified. Edit 2: The user manual says: "HP StorageWorks Ultrium tape drives do not require regular cleaning. An Ultrium universal cleaning cartridge should only be used when the orange Clean LED is flashing." Update: It is now May 2010 (4.5 years of use), and the LED is still off, I have not cleaned, backups verify and regular restore tests are done.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How to stop windows from adding additional keyboards to languages

    - by MMavipc
    I have the English language setup with the normal en-us layout, and only this layout. I have the Spanish language setup with united states - international layout. When I switch to English it gives me the option to select the regular keyboard or the international version. Only the regular version is listed under EN in my language settings. How do I get it to remove the international keyboard from English? Sometimes it switches to international while I'm on English mode and screws up my typing, which is a pain in the ass.

    Read the article

  • How LINQ to Object statements work

    - by rajbk
    This post goes into detail as to now LINQ statements work when querying a collection of objects. This topic assumes you have an understanding of how generics, delegates, implicitly typed variables, lambda expressions, object/collection initializers, extension methods and the yield statement work. I would also recommend you read my previous two posts: Using Delegates in C# Part 1 Using Delegates in C# Part 2 We will start by writing some methods to filter a collection of data. Assume we have an Employee class like so: 1: public class Employee { 2: public int ID { get; set;} 3: public string FirstName { get; set;} 4: public string LastName {get; set;} 5: public string Country { get; set; } 6: } and a collection of employees like so: 1: var employees = new List<Employee> { 2: new Employee { ID = 1, FirstName = "John", LastName = "Wright", Country = "USA" }, 3: new Employee { ID = 2, FirstName = "Jim", LastName = "Ashlock", Country = "UK" }, 4: new Employee { ID = 3, FirstName = "Jane", LastName = "Jackson", Country = "CHE" }, 5: new Employee { ID = 4, FirstName = "Jill", LastName = "Anderson", Country = "AUS" }, 6: }; Filtering We wish to  find all employees that have an even ID. We could start off by writing a method that takes in a list of employees and returns a filtered list of employees with an even ID. 1: static List<Employee> GetEmployeesWithEvenID(List<Employee> employees) { 2: var filteredEmployees = new List<Employee>(); 3: foreach (Employee emp in employees) { 4: if (emp.ID % 2 == 0) { 5: filteredEmployees.Add(emp); 6: } 7: } 8: return filteredEmployees; 9: } The method can be rewritten to return an IEnumerable<Employee> using the yield return keyword. 1: static IEnumerable<Employee> GetEmployeesWithEvenID(IEnumerable<Employee> employees) { 2: foreach (Employee emp in employees) { 3: if (emp.ID % 2 == 0) { 4: yield return emp; 5: } 6: } 7: } We put these together in a console application. 1: using System; 2: using System.Collections.Generic; 3: //No System.Linq 4:  5: public class Program 6: { 7: [STAThread] 8: static void Main(string[] args) 9: { 10: var employees = new List<Employee> { 11: new Employee { ID = 1, FirstName = "John", LastName = "Wright", Country = "USA" }, 12: new Employee { ID = 2, FirstName = "Jim", LastName = "Ashlock", Country = "UK" }, 13: new Employee { ID = 3, FirstName = "Jane", LastName = "Jackson", Country = "CHE" }, 14: new Employee { ID = 4, FirstName = "Jill", LastName = "Anderson", Country = "AUS" }, 15: }; 16: var filteredEmployees = GetEmployeesWithEvenID(employees); 17:  18: foreach (Employee emp in filteredEmployees) { 19: Console.WriteLine("ID {0} First_Name {1} Last_Name {2} Country {3}", 20: emp.ID, emp.FirstName, emp.LastName, emp.Country); 21: } 22:  23: Console.ReadLine(); 24: } 25: 26: static IEnumerable<Employee> GetEmployeesWithEvenID(IEnumerable<Employee> employees) { 27: foreach (Employee emp in employees) { 28: if (emp.ID % 2 == 0) { 29: yield return emp; 30: } 31: } 32: } 33: } 34:  35: public class Employee { 36: public int ID { get; set;} 37: public string FirstName { get; set;} 38: public string LastName {get; set;} 39: public string Country { get; set; } 40: } Output: ID 2 First_Name Jim Last_Name Ashlock Country UK ID 4 First_Name Jill Last_Name Anderson Country AUS Our filtering method is too specific. Let us change it so that it is capable of doing different types of filtering and lets give our method the name Where ;-) We will add another parameter to our Where method. This additional parameter will be a delegate with the following declaration. public delegate bool Filter(Employee emp); The idea is that the delegate parameter in our Where method will point to a method that contains the logic to do our filtering thereby freeing our Where method from any dependency. The method is shown below: 1: static IEnumerable<Employee> Where(IEnumerable<Employee> employees, Filter filter) { 2: foreach (Employee emp in employees) { 3: if (filter(emp)) { 4: yield return emp; 5: } 6: } 7: } Making the change to our app, we create a new instance of the Filter delegate on line 14 with a target set to the method EmployeeHasEvenId. Running the code will produce the same output. 1: public delegate bool Filter(Employee emp); 2:  3: public class Program 4: { 5: [STAThread] 6: static void Main(string[] args) 7: { 8: var employees = new List<Employee> { 9: new Employee { ID = 1, FirstName = "John", LastName = "Wright", Country = "USA" }, 10: new Employee { ID = 2, FirstName = "Jim", LastName = "Ashlock", Country = "UK" }, 11: new Employee { ID = 3, FirstName = "Jane", LastName = "Jackson", Country = "CHE" }, 12: new Employee { ID = 4, FirstName = "Jill", LastName = "Anderson", Country = "AUS" } 13: }; 14: var filterDelegate = new Filter(EmployeeHasEvenId); 15: var filteredEmployees = Where(employees, filterDelegate); 16:  17: foreach (Employee emp in filteredEmployees) { 18: Console.WriteLine("ID {0} First_Name {1} Last_Name {2} Country {3}", 19: emp.ID, emp.FirstName, emp.LastName, emp.Country); 20: } 21: Console.ReadLine(); 22: } 23: 24: static bool EmployeeHasEvenId(Employee emp) { 25: return emp.ID % 2 == 0; 26: } 27: 28: static IEnumerable<Employee> Where(IEnumerable<Employee> employees, Filter filter) { 29: foreach (Employee emp in employees) { 30: if (filter(emp)) { 31: yield return emp; 32: } 33: } 34: } 35: } 36:  37: public class Employee { 38: public int ID { get; set;} 39: public string FirstName { get; set;} 40: public string LastName {get; set;} 41: public string Country { get; set; } 42: } Lets use lambda expressions to inline the contents of the EmployeeHasEvenId method in place of the method. The next code snippet shows this change (see line 15).  For brevity, the Employee class declaration has been skipped. 1: public delegate bool Filter(Employee emp); 2:  3: public class Program 4: { 5: [STAThread] 6: static void Main(string[] args) 7: { 8: var employees = new List<Employee> { 9: new Employee { ID = 1, FirstName = "John", LastName = "Wright", Country = "USA" }, 10: new Employee { ID = 2, FirstName = "Jim", LastName = "Ashlock", Country = "UK" }, 11: new Employee { ID = 3, FirstName = "Jane", LastName = "Jackson", Country = "CHE" }, 12: new Employee { ID = 4, FirstName = "Jill", LastName = "Anderson", Country = "AUS" } 13: }; 14: var filterDelegate = new Filter(EmployeeHasEvenId); 15: var filteredEmployees = Where(employees, emp => emp.ID % 2 == 0); 16:  17: foreach (Employee emp in filteredEmployees) { 18: Console.WriteLine("ID {0} First_Name {1} Last_Name {2} Country {3}", 19: emp.ID, emp.FirstName, emp.LastName, emp.Country); 20: } 21: Console.ReadLine(); 22: } 23: 24: static bool EmployeeHasEvenId(Employee emp) { 25: return emp.ID % 2 == 0; 26: } 27: 28: static IEnumerable<Employee> Where(IEnumerable<Employee> employees, Filter filter) { 29: foreach (Employee emp in employees) { 30: if (filter(emp)) { 31: yield return emp; 32: } 33: } 34: } 35: } 36:  The output displays the same two employees.  Our Where method is too restricted since it works with a collection of Employees only. Lets change it so that it works with any IEnumerable<T>. In addition, you may recall from my previous post,  that .NET 3.5 comes with a lot of predefined delegates including public delegate TResult Func<T, TResult>(T arg); We will get rid of our Filter delegate and use the one above instead. We apply these two changes to our code. 1: public class Program 2: { 3: [STAThread] 4: static void Main(string[] args) 5: { 6: var employees = new List<Employee> { 7: new Employee { ID = 1, FirstName = "John", LastName = "Wright", Country = "USA" }, 8: new Employee { ID = 2, FirstName = "Jim", LastName = "Ashlock", Country = "UK" }, 9: new Employee { ID = 3, FirstName = "Jane", LastName = "Jackson", Country = "CHE" }, 10: new Employee { ID = 4, FirstName = "Jill", LastName = "Anderson", Country = "AUS" } 11: }; 12:  13: var filteredEmployees = Where(employees, emp => emp.ID % 2 == 0); 14:  15: foreach (Employee emp in filteredEmployees) { 16: Console.WriteLine("ID {0} First_Name {1} Last_Name {2} Country {3}", 17: emp.ID, emp.FirstName, emp.LastName, emp.Country); 18: } 19: Console.ReadLine(); 20: } 21: 22: static IEnumerable<T> Where<T>(IEnumerable<T> source, Func<T, bool> filter) { 23: foreach (var x in source) { 24: if (filter(x)) { 25: yield return x; 26: } 27: } 28: } 29: } We have successfully implemented a way to filter any IEnumerable<T> based on a  filter criteria. Projection Now lets enumerate on the items in the IEnumerable<Employee> we got from the Where method and copy them into a new IEnumerable<EmployeeFormatted>. The EmployeeFormatted class will only have a FullName and ID property. 1: public class EmployeeFormatted { 2: public int ID { get; set; } 3: public string FullName {get; set;} 4: } We could “project” our existing IEnumerable<Employee> into a new collection of IEnumerable<EmployeeFormatted> with the help of a new method. We will call this method Select ;-) 1: static IEnumerable<EmployeeFormatted> Select(IEnumerable<Employee> employees) { 2: foreach (var emp in employees) { 3: yield return new EmployeeFormatted { 4: ID = emp.ID, 5: FullName = emp.LastName + ", " + emp.FirstName 6: }; 7: } 8: } The changes are applied to our app. 1: public class Program 2: { 3: [STAThread] 4: static void Main(string[] args) 5: { 6: var employees = new List<Employee> { 7: new Employee { ID = 1, FirstName = "John", LastName = "Wright", Country = "USA" }, 8: new Employee { ID = 2, FirstName = "Jim", LastName = "Ashlock", Country = "UK" }, 9: new Employee { ID = 3, FirstName = "Jane", LastName = "Jackson", Country = "CHE" }, 10: new Employee { ID = 4, FirstName = "Jill", LastName = "Anderson", Country = "AUS" } 11: }; 12:  13: var filteredEmployees = Where(employees, emp => emp.ID % 2 == 0); 14: var formattedEmployees = Select(filteredEmployees); 15:  16: foreach (EmployeeFormatted emp in formattedEmployees) { 17: Console.WriteLine("ID {0} Full_Name {1}", 18: emp.ID, emp.FullName); 19: } 20: Console.ReadLine(); 21: } 22:  23: static IEnumerable<T> Where<T>(IEnumerable<T> source, Func<T, bool> filter) { 24: foreach (var x in source) { 25: if (filter(x)) { 26: yield return x; 27: } 28: } 29: } 30: 31: static IEnumerable<EmployeeFormatted> Select(IEnumerable<Employee> employees) { 32: foreach (var emp in employees) { 33: yield return new EmployeeFormatted { 34: ID = emp.ID, 35: FullName = emp.LastName + ", " + emp.FirstName 36: }; 37: } 38: } 39: } 40:  41: public class Employee { 42: public int ID { get; set;} 43: public string FirstName { get; set;} 44: public string LastName {get; set;} 45: public string Country { get; set; } 46: } 47:  48: public class EmployeeFormatted { 49: public int ID { get; set; } 50: public string FullName {get; set;} 51: } Output: ID 2 Full_Name Ashlock, Jim ID 4 Full_Name Anderson, Jill We have successfully selected employees who have an even ID and then shaped our data with the help of the Select method so that the final result is an IEnumerable<EmployeeFormatted>.  Lets make our Select method more generic so that the user is given the freedom to shape what the output would look like. We can do this, like before, with lambda expressions. Our Select method is changed to accept a delegate as shown below. TSource will be the type of data that comes in and TResult will be the type the user chooses (shape of data) as returned from the selector delegate. 1:  2: static IEnumerable<TResult> Select<TSource, TResult>(IEnumerable<TSource> source, Func<TSource, TResult> selector) { 3: foreach (var x in source) { 4: yield return selector(x); 5: } 6: } We see the new changes to our app. On line 15, we use lambda expression to specify the shape of the data. In this case the shape will be of type EmployeeFormatted. 1:  2: public class Program 3: { 4: [STAThread] 5: static void Main(string[] args) 6: { 7: var employees = new List<Employee> { 8: new Employee { ID = 1, FirstName = "John", LastName = "Wright", Country = "USA" }, 9: new Employee { ID = 2, FirstName = "Jim", LastName = "Ashlock", Country = "UK" }, 10: new Employee { ID = 3, FirstName = "Jane", LastName = "Jackson", Country = "CHE" }, 11: new Employee { ID = 4, FirstName = "Jill", LastName = "Anderson", Country = "AUS" } 12: }; 13:  14: var filteredEmployees = Where(employees, emp => emp.ID % 2 == 0); 15: var formattedEmployees = Select(filteredEmployees, (emp) => 16: new EmployeeFormatted { 17: ID = emp.ID, 18: FullName = emp.LastName + ", " + emp.FirstName 19: }); 20:  21: foreach (EmployeeFormatted emp in formattedEmployees) { 22: Console.WriteLine("ID {0} Full_Name {1}", 23: emp.ID, emp.FullName); 24: } 25: Console.ReadLine(); 26: } 27: 28: static IEnumerable<T> Where<T>(IEnumerable<T> source, Func<T, bool> filter) { 29: foreach (var x in source) { 30: if (filter(x)) { 31: yield return x; 32: } 33: } 34: } 35: 36: static IEnumerable<TResult> Select<TSource, TResult>(IEnumerable<TSource> source, Func<TSource, TResult> selector) { 37: foreach (var x in source) { 38: yield return selector(x); 39: } 40: } 41: } The code outputs the same result as before. On line 14 we filter our data and on line 15 we project our data. What if we wanted to be more expressive and concise? We could combine both line 14 and 15 into one line as shown below. Assuming you had to perform several operations like this on our collection, you would end up with some very unreadable code! 1: var formattedEmployees = Select(Where(employees, emp => emp.ID % 2 == 0), (emp) => 2: new EmployeeFormatted { 3: ID = emp.ID, 4: FullName = emp.LastName + ", " + emp.FirstName 5: }); A cleaner way to write this would be to give the appearance that the Select and Where methods were part of the IEnumerable<T>. This is exactly what extension methods give us. Extension methods have to be defined in a static class. Let us make the Select and Where extension methods on IEnumerable<T> 1: public static class MyExtensionMethods { 2: static IEnumerable<T> Where<T>(this IEnumerable<T> source, Func<T, bool> filter) { 3: foreach (var x in source) { 4: if (filter(x)) { 5: yield return x; 6: } 7: } 8: } 9: 10: static IEnumerable<TResult> Select<TSource, TResult>(this IEnumerable<TSource> source, Func<TSource, TResult> selector) { 11: foreach (var x in source) { 12: yield return selector(x); 13: } 14: } 15: } The creation of the extension method makes the syntax much cleaner as shown below. We can write as many extension methods as we want and keep on chaining them using this technique. 1: var formattedEmployees = employees 2: .Where(emp => emp.ID % 2 == 0) 3: .Select (emp => new EmployeeFormatted { ID = emp.ID, FullName = emp.LastName + ", " + emp.FirstName }); Making these changes and running our code produces the same result. 1: using System; 2: using System.Collections.Generic; 3:  4: public class Program 5: { 6: [STAThread] 7: static void Main(string[] args) 8: { 9: var employees = new List<Employee> { 10: new Employee { ID = 1, FirstName = "John", LastName = "Wright", Country = "USA" }, 11: new Employee { ID = 2, FirstName = "Jim", LastName = "Ashlock", Country = "UK" }, 12: new Employee { ID = 3, FirstName = "Jane", LastName = "Jackson", Country = "CHE" }, 13: new Employee { ID = 4, FirstName = "Jill", LastName = "Anderson", Country = "AUS" } 14: }; 15:  16: var formattedEmployees = employees 17: .Where(emp => emp.ID % 2 == 0) 18: .Select (emp => 19: new EmployeeFormatted { 20: ID = emp.ID, 21: FullName = emp.LastName + ", " + emp.FirstName 22: } 23: ); 24:  25: foreach (EmployeeFormatted emp in formattedEmployees) { 26: Console.WriteLine("ID {0} Full_Name {1}", 27: emp.ID, emp.FullName); 28: } 29: Console.ReadLine(); 30: } 31: } 32:  33: public static class MyExtensionMethods { 34: static IEnumerable<T> Where<T>(this IEnumerable<T> source, Func<T, bool> filter) { 35: foreach (var x in source) { 36: if (filter(x)) { 37: yield return x; 38: } 39: } 40: } 41: 42: static IEnumerable<TResult> Select<TSource, TResult>(this IEnumerable<TSource> source, Func<TSource, TResult> selector) { 43: foreach (var x in source) { 44: yield return selector(x); 45: } 46: } 47: } 48:  49: public class Employee { 50: public int ID { get; set;} 51: public string FirstName { get; set;} 52: public string LastName {get; set;} 53: public string Country { get; set; } 54: } 55:  56: public class EmployeeFormatted { 57: public int ID { get; set; } 58: public string FullName {get; set;} 59: } Let’s change our code to return a collection of anonymous types and get rid of the EmployeeFormatted type. We see that the code produces the same output. 1: using System; 2: using System.Collections.Generic; 3:  4: public class Program 5: { 6: [STAThread] 7: static void Main(string[] args) 8: { 9: var employees = new List<Employee> { 10: new Employee { ID = 1, FirstName = "John", LastName = "Wright", Country = "USA" }, 11: new Employee { ID = 2, FirstName = "Jim", LastName = "Ashlock", Country = "UK" }, 12: new Employee { ID = 3, FirstName = "Jane", LastName = "Jackson", Country = "CHE" }, 13: new Employee { ID = 4, FirstName = "Jill", LastName = "Anderson", Country = "AUS" } 14: }; 15:  16: var formattedEmployees = employees 17: .Where(emp => emp.ID % 2 == 0) 18: .Select (emp => 19: new { 20: ID = emp.ID, 21: FullName = emp.LastName + ", " + emp.FirstName 22: } 23: ); 24:  25: foreach (var emp in formattedEmployees) { 26: Console.WriteLine("ID {0} Full_Name {1}", 27: emp.ID, emp.FullName); 28: } 29: Console.ReadLine(); 30: } 31: } 32:  33: public static class MyExtensionMethods { 34: public static IEnumerable<T> Where<T>(this IEnumerable<T> source, Func<T, bool> filter) { 35: foreach (var x in source) { 36: if (filter(x)) { 37: yield return x; 38: } 39: } 40: } 41: 42: public static IEnumerable<TResult> Select<TSource, TResult>(this IEnumerable<TSource> source, Func<TSource, TResult> selector) { 43: foreach (var x in source) { 44: yield return selector(x); 45: } 46: } 47: } 48:  49: public class Employee { 50: public int ID { get; set;} 51: public string FirstName { get; set;} 52: public string LastName {get; set;} 53: public string Country { get; set; } 54: } To be more expressive, C# allows us to write our extension method calls as a query expression. Line 16 can be rewritten a query expression like so: 1: var formattedEmployees = from emp in employees 2: where emp.ID % 2 == 0 3: select new { 4: ID = emp.ID, 5: FullName = emp.LastName + ", " + emp.FirstName 6: }; When the compiler encounters an expression like the above, it simply rewrites it as calls to our extension methods.  So far we have been using our extension methods. The System.Linq namespace contains several extension methods for objects that implement the IEnumerable<T>. You can see a listing of these methods in the Enumerable class in the System.Linq namespace. Let’s get rid of our extension methods (which I purposefully wrote to be of the same signature as the ones in the Enumerable class) and use the ones provided in the Enumerable class. Our final code is shown below: 1: using System; 2: using System.Collections.Generic; 3: using System.Linq; //Added 4:  5: public class Program 6: { 7: [STAThread] 8: static void Main(string[] args) 9: { 10: var employees = new List<Employee> { 11: new Employee { ID = 1, FirstName = "John", LastName = "Wright", Country = "USA" }, 12: new Employee { ID = 2, FirstName = "Jim", LastName = "Ashlock", Country = "UK" }, 13: new Employee { ID = 3, FirstName = "Jane", LastName = "Jackson", Country = "CHE" }, 14: new Employee { ID = 4, FirstName = "Jill", LastName = "Anderson", Country = "AUS" } 15: }; 16:  17: var formattedEmployees = from emp in employees 18: where emp.ID % 2 == 0 19: select new { 20: ID = emp.ID, 21: FullName = emp.LastName + ", " + emp.FirstName 22: }; 23:  24: foreach (var emp in formattedEmployees) { 25: Console.WriteLine("ID {0} Full_Name {1}", 26: emp.ID, emp.FullName); 27: } 28: Console.ReadLine(); 29: } 30: } 31:  32: public class Employee { 33: public int ID { get; set;} 34: public string FirstName { get; set;} 35: public string LastName {get; set;} 36: public string Country { get; set; } 37: } 38:  39: public class EmployeeFormatted { 40: public int ID { get; set; } 41: public string FullName {get; set;} 42: } This post has shown you a basic overview of LINQ to Objects work by showning you how an expression is converted to a sequence of calls to extension methods when working directly with objects. It gets more interesting when working with LINQ to SQL where an expression tree is constructed – an in memory data representation of the expression. The C# compiler compiles these expressions into code that builds an expression tree at runtime. The provider can then traverse the expression tree and generate the appropriate SQL query. You can read more about expression trees in this MSDN article.

    Read the article

  • HTML5 Form Validation

    - by Stephen.Walther
    The latest versions of Google Chrome (16+), Mozilla Firefox (8+), and Internet Explorer (10+) all support HTML5 client-side validation. It is time to take HTML5 validation seriously. The purpose of the blog post is to describe how you can take advantage of HTML5 client-side validation regardless of the type of application that you are building. You learn how to use the HTML5 validation attributes, how to perform custom validation using the JavaScript validation constraint API, and how to simulate HTML5 validation on older browsers by taking advantage of a jQuery plugin. Finally, we discuss the security issues related to using client-side validation. Using Client-Side Validation Attributes The HTML5 specification discusses several attributes which you can use with INPUT elements to perform client-side validation including the required, pattern, min, max, step, and maxlength attributes. For example, you use the required attribute to require a user to enter a value for an INPUT element. The following form demonstrates how you can make the firstName and lastName form fields required: <!DOCTYPE html> <html > <head> <title>Required Demo</title> </head> <body> <form> <label> First Name: <input required title="First Name is Required!" /> </label> <label> Last Name: <input required title="Last Name is Required!" /> </label> <button>Register</button> </form> </body> </html> If you attempt to submit this form without entering a value for firstName or lastName then you get the validation error message: Notice that the value of the title attribute is used to display the validation error message “First Name is Required!”. The title attribute does not work this way with the current version of Firefox. If you want to display a custom validation error message with Firefox then you need to include an x-moz-errormessage attribute like this: <input required title="First Name is Required!" x-moz-errormessage="First Name is Required!" /> The pattern attribute enables you to validate the value of an INPUT element against a regular expression. For example, the following form includes a social security number field which includes a pattern attribute: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Pattern</title> </head> <body> <form> <label> Social Security Number: <input required pattern="^d{3}-d{2}-d{4}$" title="###-##-####" /> </label> <button>Register</button> </form> </body> </html> The regular expression in the form above requires the social security number to match the pattern ###-##-####: Notice that the input field includes both a pattern and a required validation attribute. If you don’t enter a value then the regular expression is never triggered. You need to include the required attribute to force a user to enter a value and cause the value to be validated against the regular expression. Custom Validation You can take advantage of the HTML5 constraint validation API to perform custom validation. You can perform any custom validation that you need. The only requirement is that you write a JavaScript function. For example, when booking a hotel room, you might want to validate that the Arrival Date is in the future instead of the past: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Constraint Validation API</title> </head> <body> <form> <label> Arrival Date: <input id="arrivalDate" type="date" required /> </label> <button>Submit Reservation</button> </form> <script type="text/javascript"> var arrivalDate = document.getElementById("arrivalDate"); arrivalDate.addEventListener("input", function() { var value = new Date(arrivalDate.value); if (value < new Date()) { arrivalDate.setCustomValidity("Arrival date must be after now!"); } else { arrivalDate.setCustomValidity(""); } }); </script> </body> </html> The form above contains an input field named arrivalDate. Entering a value into the arrivalDate field triggers the input event. The JavaScript code adds an event listener for the input event and checks whether the date entered is greater than the current date. If validation fails then the validation error message “Arrival date must be after now!” is assigned to the arrivalDate input field by calling the setCustomValidity() method of the validation constraint API. Otherwise, the validation error message is cleared by calling setCustomValidity() with an empty string. HTML5 Validation and Older Browsers But what about older browsers? For example, what about Apple Safari and versions of Microsoft Internet Explorer older than Internet Explorer 10? What the world really needs is a jQuery plugin which provides backwards compatibility for the HTML5 validation attributes. If a browser supports the HTML5 validation attributes then the plugin would do nothing. Otherwise, the plugin would add support for the attributes. Unfortunately, as far as I know, this plugin does not exist. I have not been able to find any plugin which supports both the required and pattern attributes for older browsers, but does not get in the way of these attributes in the case of newer browsers. There are several jQuery plugins which provide partial support for the HTML5 validation attributes including: · jQuery Validation — http://docs.jquery.com/Plugins/Validation · html5Form — http://www.matiasmancini.com.ar/jquery-plugin-ajax-form-validation-html5.html · h5Validate — http://ericleads.com/h5validate/ The jQuery Validation plugin – the most popular JavaScript validation library – supports the HTML5 required attribute, but it does not support the HTML5 pattern attribute. Likewise, the html5Form plugin does not support the pattern attribute. The h5Validate plugin provides the best support for the HTML5 validation attributes. The following page illustrates how this plugin supports both the required and pattern attributes: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>h5Validate</title> <style type="text/css"> .validationError { border: solid 2px red; } .validationValid { border: solid 2px green; } </style> </head> <body> <form id="customerForm"> <label> First Name: <input id="firstName" required /> </label> <label> Social Security Number: <input id="ssn" required pattern="^d{3}-d{2}-d{4}$" title="Expected pattern is ###-##-####" /> </label> <input type="submit" /> </form> <script type="text/javascript" src="Scripts/jquery-1.4.4.min.js"></script> <script type="text/javascript" src="Scripts/jquery.h5validate.js"></script> <script type="text/javascript"> // Enable h5Validate plugin $("#customerForm").h5Validate({ errorClass: "validationError", validClass: "validationValid" }); // Prevent form submission when errors $("#customerForm").submit(function (evt) { if ($("#customerForm").h5Validate("allValid") === false) { evt.preventDefault(); } }); </script> </body> </html> When an input field fails validation, the validationError CSS class is applied to the field and the field appears with a red border. When an input field passes validation, the validationValid CSS class is applied to the field and the field appears with a green border. From the perspective of HTML5 validation, the h5Validate plugin is the best of the plugins. It adds support for the required and pattern attributes to browsers which do not natively support these attributes such as IE9. However, this plugin does not include everything in my wish list for a perfect HTML5 validation plugin. Here’s my wish list for the perfect back compat HTML5 validation plugin: 1. The plugin would disable itself when used with a browser which natively supports HTML5 validation attributes. The plugin should not be too greedy – it should not handle validation when a browser could do the work itself. 2. The plugin should simulate the same user interface for displaying validation error messages as the user interface displayed by browsers which natively support HTML5 validation. Chrome, Firefox, and Internet Explorer all display validation errors in a popup. The perfect plugin would also display a popup. 3. Finally, the plugin would add support for the setCustomValidity() method and the other methods of the HTML5 validation constraint API. That way, you could implement custom validation in a standards compatible way and you would know that it worked across all browsers both old and new. Security It would be irresponsible of me to end this blog post without mentioning the issue of security. It is important to remember that any client-side validation — including HTML5 validation — can be bypassed. You should use client-side validation with the intention to create a better user experience. Client validation is great for providing a user with immediate feedback when the user is in the process of completing a form. However, client-side validation cannot prevent an evil hacker from submitting unexpected form data to your web server. You should always enforce your validation rules on the server. The only way to ensure that a required field has a value is to verify that the required field has a value on the server. The HTML5 required attribute does not guarantee anything. Summary The goal of this blog post was to describe the support for validation contained in the HTML5 standard. You learned how to use both the required and the pattern attributes in an HTML5 form. We also discussed how you can implement custom validation by taking advantage of the setCustomValidity() method. Finally, I discussed the available jQuery plugins for adding support for the HTM5 validation attributes to older browsers. Unfortunately, I am unaware of any jQuery plugin which provides a perfect solution to the problem of backwards compatibility.

    Read the article

  • HTML5 Form Validation

    - by Stephen.Walther
    The latest versions of Google Chrome (16+), Mozilla Firefox (8+), and Internet Explorer (10+) all support HTML5 client-side validation. It is time to take HTML5 validation seriously. The purpose of the blog post is to describe how you can take advantage of HTML5 client-side validation regardless of the type of application that you are building. You learn how to use the HTML5 validation attributes, how to perform custom validation using the JavaScript validation constraint API, and how to simulate HTML5 validation on older browsers by taking advantage of a jQuery plugin. Finally, we discuss the security issues related to using client-side validation. Using Client-Side Validation Attributes The HTML5 specification discusses several attributes which you can use with INPUT elements to perform client-side validation including the required, pattern, min, max, step, and maxlength attributes. For example, you use the required attribute to require a user to enter a value for an INPUT element. The following form demonstrates how you can make the firstName and lastName form fields required: <!DOCTYPE html> <html > <head> <title>Required Demo</title> </head> <body> <form> <label> First Name: <input required title="First Name is Required!" /> </label> <label> Last Name: <input required title="Last Name is Required!" /> </label> <button>Register</button> </form> </body> </html> If you attempt to submit this form without entering a value for firstName or lastName then you get the validation error message: Notice that the value of the title attribute is used to display the validation error message “First Name is Required!”. The title attribute does not work this way with the current version of Firefox. If you want to display a custom validation error message with Firefox then you need to include an x-moz-errormessage attribute like this: <input required title="First Name is Required!" x-moz-errormessage="First Name is Required!" /> The pattern attribute enables you to validate the value of an INPUT element against a regular expression. For example, the following form includes a social security number field which includes a pattern attribute: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Pattern</title> </head> <body> <form> <label> Social Security Number: <input required pattern="^\d{3}-\d{2}-\d{4}$" title="###-##-####" /> </label> <button>Register</button> </form> </body> </html> The regular expression in the form above requires the social security number to match the pattern ###-##-####: Notice that the input field includes both a pattern and a required validation attribute. If you don’t enter a value then the regular expression is never triggered. You need to include the required attribute to force a user to enter a value and cause the value to be validated against the regular expression. Custom Validation You can take advantage of the HTML5 constraint validation API to perform custom validation. You can perform any custom validation that you need. The only requirement is that you write a JavaScript function. For example, when booking a hotel room, you might want to validate that the Arrival Date is in the future instead of the past: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Constraint Validation API</title> </head> <body> <form> <label> Arrival Date: <input id="arrivalDate" type="date" required /> </label> <button>Submit Reservation</button> </form> <script type="text/javascript"> var arrivalDate = document.getElementById("arrivalDate"); arrivalDate.addEventListener("input", function() { var value = new Date(arrivalDate.value); if (value < new Date()) { arrivalDate.setCustomValidity("Arrival date must be after now!"); } else { arrivalDate.setCustomValidity(""); } }); </script> </body> </html> The form above contains an input field named arrivalDate. Entering a value into the arrivalDate field triggers the input event. The JavaScript code adds an event listener for the input event and checks whether the date entered is greater than the current date. If validation fails then the validation error message “Arrival date must be after now!” is assigned to the arrivalDate input field by calling the setCustomValidity() method of the validation constraint API. Otherwise, the validation error message is cleared by calling setCustomValidity() with an empty string. HTML5 Validation and Older Browsers But what about older browsers? For example, what about Apple Safari and versions of Microsoft Internet Explorer older than Internet Explorer 10? What the world really needs is a jQuery plugin which provides backwards compatibility for the HTML5 validation attributes. If a browser supports the HTML5 validation attributes then the plugin would do nothing. Otherwise, the plugin would add support for the attributes. Unfortunately, as far as I know, this plugin does not exist. I have not been able to find any plugin which supports both the required and pattern attributes for older browsers, but does not get in the way of these attributes in the case of newer browsers. There are several jQuery plugins which provide partial support for the HTML5 validation attributes including: · jQuery Validation — http://docs.jquery.com/Plugins/Validation · html5Form — http://www.matiasmancini.com.ar/jquery-plugin-ajax-form-validation-html5.html · h5Validate — http://ericleads.com/h5validate/ The jQuery Validation plugin – the most popular JavaScript validation library – supports the HTML5 required attribute, but it does not support the HTML5 pattern attribute. Likewise, the html5Form plugin does not support the pattern attribute. The h5Validate plugin provides the best support for the HTML5 validation attributes. The following page illustrates how this plugin supports both the required and pattern attributes: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>h5Validate</title> <style type="text/css"> .validationError { border: solid 2px red; } .validationValid { border: solid 2px green; } </style> </head> <body> <form id="customerForm"> <label> First Name: <input id="firstName" required /> </label> <label> Social Security Number: <input id="ssn" required pattern="^\d{3}-\d{2}-\d{4}$" title="Expected pattern is ###-##-####" /> </label> <input type="submit" /> </form> <script type="text/javascript" src="Scripts/jquery-1.4.4.min.js"></script> <script type="text/javascript" src="Scripts/jquery.h5validate.js"></script> <script type="text/javascript"> // Enable h5Validate plugin $("#customerForm").h5Validate({ errorClass: "validationError", validClass: "validationValid" }); // Prevent form submission when errors $("#customerForm").submit(function (evt) { if ($("#customerForm").h5Validate("allValid") === false) { evt.preventDefault(); } }); </script> </body> </html> When an input field fails validation, the validationError CSS class is applied to the field and the field appears with a red border. When an input field passes validation, the validationValid CSS class is applied to the field and the field appears with a green border. From the perspective of HTML5 validation, the h5Validate plugin is the best of the plugins. It adds support for the required and pattern attributes to browsers which do not natively support these attributes such as IE9. However, this plugin does not include everything in my wish list for a perfect HTML5 validation plugin. Here’s my wish list for the perfect back compat HTML5 validation plugin: 1. The plugin would disable itself when used with a browser which natively supports HTML5 validation attributes. The plugin should not be too greedy – it should not handle validation when a browser could do the work itself. 2. The plugin should simulate the same user interface for displaying validation error messages as the user interface displayed by browsers which natively support HTML5 validation. Chrome, Firefox, and Internet Explorer all display validation errors in a popup. The perfect plugin would also display a popup. 3. Finally, the plugin would add support for the setCustomValidity() method and the other methods of the HTML5 validation constraint API. That way, you could implement custom validation in a standards compatible way and you would know that it worked across all browsers both old and new. Security It would be irresponsible of me to end this blog post without mentioning the issue of security. It is important to remember that any client-side validation — including HTML5 validation — can be bypassed. You should use client-side validation with the intention to create a better user experience. Client validation is great for providing a user with immediate feedback when the user is in the process of completing a form. However, client-side validation cannot prevent an evil hacker from submitting unexpected form data to your web server. You should always enforce your validation rules on the server. The only way to ensure that a required field has a value is to verify that the required field has a value on the server. The HTML5 required attribute does not guarantee anything. Summary The goal of this blog post was to describe the support for validation contained in the HTML5 standard. You learned how to use both the required and the pattern attributes in an HTML5 form. We also discussed how you can implement custom validation by taking advantage of the setCustomValidity() method. Finally, I discussed the available jQuery plugins for adding support for the HTM5 validation attributes to older browsers. Unfortunately, I am unaware of any jQuery plugin which provides a perfect solution to the problem of backwards compatibility.

    Read the article

  • The Open Data Protocol

    - by Bobby Diaz
    Well, day 2 of the MIX10 conference did not disappoint.  The keynote speakers introduced the preview release of IE9, which looks really cool and quick, and Visual Studio 2010 RC that is scheduled to RTM on April 12th.  It seemed to have a lot of improvements aimed at making developers more productive.  Here are the current links to these two offerings: Internet Explorer 9 – Platform Preview Visual Studio 2010 and .NET 4 – Release Candidate While both of these were interesting, the demos that really blew me away today centered around the work being done with The Open Data Protocol, or OData for short!  OData is a recommended standard being pushed by Microsoft that uses a REST based interface to interact with various types of data in a uniform manner.  Data producers then provide the data to consumer in either ATOM or JSON formats as requested by the client application. The OData SDK contains client and server libraries for many of the popular languages in use today, including .NET, Java, PHP, Objective C and JavaScript, so you consume or even produce your own OData services.  More information can be found using the following links: OData.org How to navigate an OData compliant service Query Functions (WCF Data Services) Netflix has made available one of the first live OData services by exposing their entire movie catalog.  You can browse and query using URLs similar to the following: http://odata.netflix.com/ http://odata.netflix.com/Catalog/Genres('Horror')/CatalogTitles http://odata.netflix.com/Catalog/CatalogTitles?$filter=startswith(Title/Regular,%20'Star%20Wars')&$orderby=Title/Regular So now I just need to find an excuse reason to start using OData in a real project! Enjoy!

    Read the article

  • What are the options for hosting a small Plone site?

    - by Tina Russell
    I’ve developed a portfolio website for myself using Plone 4, and I’m looking for someplace to host it. Most Plone hosting services seem to focus on large, corporate deployments, but I need something that I can afford on a very limited budget and fits a small, single-admin website. My understanding is that my basic options are thus: I can go with a hosting service that specifically provides Plone. I know of WebFaction, but what others exist? Also, I’d have two stipulations for a Plone hosting service: (a) It needs to use Plone 4, for which I’ve developed my site, and (b) it needs to allow me SSH access to a home directory (including the Plone configuration), so that I may use my custom development eggs and such. I could use a VPS hosting service. What are my options here? Again, I need something cheap and scaled to my level. I could use Amazon EC2 or a similar service (please tell me of any) and pay by the tiniest unit of data. I’m a little scared of this because I have no idea how to do a cost-benefit analysis between this and a regular VPS host. The advantage of this approach would be that I only pay for what I use, making it very scalable, but I don’t know how the overall cost would compare to any VPS host under similar circumstances. What factors enter into the cost of Amazon EC2? What can I expect to pay under either option for regular traffic for a new website? Which one is more desirable for when a rush of visitors drive up my bandwidth bill? One last note: I know Plone isn’t common for websites for individuals, but please don’t try to talk me out of it here; that’s a completely different subject. For now, assume I’m sticking with Plone for good. Also, I have seen the Plone hosting services list on Plone.org—it’s twenty pages long, and the first page was nothing but professional Plone consulting services that sometimes offer hosting for business clients. So, that wasn’t much help. Thank you!

    Read the article

  • Triangulation A* (TA*) pathfinding algorithm

    - by hyn
    I need help understanding the Triangle A* (TA*) algorithm that is described by Demyen in his paper Efficient Triangulation-Based Pathfinding, on pages 76-81. He describes how to adapt the regular A* algorithm for triangulation, to search for other possibly more optimal paths, even after the final node is reached/expanded. Regular A* stops when the final node is expanded, but this is not always the best path when used in a triangulated graph. This is exactly the problem I'm having. The problem is illustrated on page 78, Figure 5.4: I understand how to calculate the g and h values presented in the paper (page 80). And I think the search stop condition is: if (currentNode.fCost > shortestDistanceFound) { // stop break; } where currentNode is the search node popped from the open list (priority queue), which has the lowest f-score. shortestDistanceFound is the actual distance of the shortest path found so far. But how do I exclude the previously found paths from future searches? Because if I do the search again, it will obviously find the same path. Do I reset the closed list? I need to modify something, but I don't know what it is I need to change. The paper lacks pseudocode, so that would be helpful.

    Read the article

  • How to get a Sun Ray to load a firmware from elsewhere

    - by vdiozguy
    I run a Sun Ray/VDI demo environment internally within the company - and because it's not a public service, I need to tell my Sun Rays to connect to it directly so that I don't get redirected to the corporate servers. To get any new Sun Ray to connect to *my* setup I usually pull out my laptop so that the Sun Ray can load the new version of the F/W along with the permission to pull up the management GUI via STOP-S.But there is a better way if you have another Sun Ray server handy:1) allow your Sun Ray to connect to the default corporate server2) log in to a "regular" session, that is a Solaris or Linux desktop on the Sun Ray server itself3) in a terminal, utswitch to your server (/opt/SUNWut/bin/utswitch -h myserver)4) again, login to a regular session there5) in a terminal,  issue "/opt/SUNWut/lib/utload -S myserver -w"6) Watch your firmware load and wait7) the Sun Ray will reboot and connect to the first server again. Repeat steps 2-48) issue "/opt/SUNWut/lib/utload -S myserver -f SunRay.enableGUI"9) Press STOP-S and be merryNOTE: I'm sure there is even yet a better way - this is totally unsupported, most likely a figment of my imagination. In any case, this post will self-destruct in BOOM.

    Read the article

  • Bash script using eyeD3 to remove extra tags from mp3 files

    - by jaguare22
    I found what looks like the perfect script for this but getting errors. Hoping someone can see problem. I am running 12.04 Server. Error is - awk: line 0: regular expression compile failed (missing '(') ): awk: line 0: regular expression compile failed (missing '(') ) The following tags have been found in the mp3s: These tags are to be stripped: Here is a the script obtained from savvyadmin !/bin/bash Script name: strip-tags.sh Original Author: Ian of DarkStarShout Blog Site: http://darkstarshout.blogspot.com/ Options slightly modified to liking of SavvyAdmin.com oktags="TALB APIC TCON TPE1 TPE2 TPE3 TIT2 TRCK TYER TCOM TPOS" indexfile=mktemp Determine tags present: find . -iname "*.mp3" -exec eyeD3 --no-color -v {} \; $indexfile tagspresent=sort -u $indexfile | awk -F\): '/^<.*$/ {print $1}' \ | uniq | awk -F\)\> '{print $1}' | awk -F\( '{print $(NF)}' \ | awk 'BEGIN {ORS=" "} {print $0}' rm $indexfile Determine tags to strip: tostrip=echo -n $tagspresent $oktags $oktags \ | awk 'BEGIN {RS=" "; ORS="\n"} {print $0}' | sort | uniq -u \ | awk 'BEGIN {ORS=" "} {print $0}' Confirm action: echo echo The following tags have been found in the mp3s: echo $tagspresent echo These tags are to be stripped: echo $tostrip echo echo -n Press enter to confirm, or Ctrl+C to cancel... read dummy Strip 'em stripstring=echo $tostrip \ | awk 'BEGIN {FS="\n"; RS=" "} {print "--set-text-frame=" $1 ": "}' First pass copies any v1.x tags to v2.3 and strips unwanted tag data. Second pass removes v1.x tags, since I don't like to use them. Without --no-tagging-time-frame, a new unwanted tag is added. :-) find . -iname "*.mp3" \ -exec eyeD3 --to-v2.3 --no-tagging-time-frame $stripstring {} \; \ -exec eyeD3 --remove-v1 --no-tagging-time-frame {} \; echo "Script complete!"

    Read the article

  • MVVM Project and Item Templates

    - by Timmy Kokke
    Intro This is the first in a series of small articles about what is new in Silverlight 4 and Expression Blend 4. The series is build around a open source demo application SilverAmp which is available on http://SilverAmp.CodePlex.com.   MVVM Project and Item Templates Expression Blend has got a new project template to get started with a Model-View-ViewModel project  easily. The template provides you with a View and a ViewModel bound together. It also adds the ViewModel to the SampleData of your project. It is available for both Silverlight and Wpf. To get going, start a new project in Expression Blend and select Silverlight DataBound Application from the Silverlight project type. In this case I named the project DemoTest1. The solution now contains several folders: SampleData; which contains a data to show in Blend ViewModels; starts with one file, MainViewModel.cs Views; containing MainView.xaml with codebehind used for binding with the MainViewModel class. and your regular App.xaml and MainPage.xaml The MainViewModel class contains a sample property and a sample method. Both the property and the method are used in the MainView control. The MainView control is a regular UserControl and is placed in the MainPage. You can continue on building your applicaition by adding your own properties and methods to the ViewModel and adding controls to the View. Adding Views with ViewModels is very easy too. The guys at Microsoft where nice enough to add a new Item template too: a UserControl with ViewModel. If you add this new item to the root of your solution it will add the .xaml file to the views folder and a .cs file to the ViewModels folder. Conclusion The databound Application project type is a great to get your MVVM based project started. It also functions a great source of information about how to connect it all together.   Technorati Tags: Silverlight,Wpf,Expression Blend,MVVM

    Read the article

< Previous Page | 61 62 63 64 65 66 67 68 69 70 71 72  | Next Page >