Search Results

Search found 56777 results on 2272 pages for 'system programming'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 672/2272 | < Previous Page | 668 669 670 671 672 673 674 675 676 677 678 679  | Next Page >

  • Does Objective-C have a Standard Library?

    - by Roman A. Taycher
    Most somewhat modern programming languages have a standard library? It is my impression is that there isn't a decent sized standard library for Obj-C , rather that it relies mostly/all on Cocoa and that (plus people not wanting to use GNUstep) is why Obj-C is only used on macs)? Is this true/to what extent? Are there any standard obj-c collections? (note I haven't done any Obj-C programming and am not to likely to try it in the near future, I'm just curious). P.S. are there a any decent non-Cocoa/Gnustep Libraries? are they non-apple, are they open source, well documented?

    Read the article

  • How can you extend the Bitmap class

    - by vrish88
    Hello, I am trying to extend the Bitmap class so that I can apply my own effects to an image. When I use this code: namespace ImageEditor { public class Effects : System.Drawing.Bitmap { public void toBlackAndWhite() { System.Drawing.Bitmap image = (Bitmap)this; AForge.Imaging.Filters.Grayscale filter = new AForge.Imaging.Filters.Grayscale(); this = filter.Apply(this); } } } I get the following error: 'ImageEditor.Effects': cannot derive from sealed type 'System.Drawing.Bitmap' So is there a way to get around this or is it simply not possible to extend the class? Thanks.

    Read the article

  • Good development themes/environments for Gnome/kde/whatever?

    - by EvanAlm
    I've searched forever for good themes or customized versions of any type of x-server that is designed for development in terms of web productions/programming for all kind of stuffs. Features such as simplified workspace overviews, good tabbing support etc. For multimedia "UbuntuStudio" exists, and something like that but for programming instead. I know that it's possible to customize it by myself but I don't have the skills to make it all happen. Another reason why it's hard for me to customize it is that I simply do not know everything that would make it good for me. I've looked into gnome-shell and it has (according to me) superb workspace overview functions, but lacks in other spaces instead. Any help in finding a good solution for me in this case is appreciated. If some of you also have had this problem and found a solution that works for you, please tell me how you did :) Would love to solve this for once!

    Read the article

  • Trying to execute netdom.exe from a ruby script or IRB does nothing

    - by Joraff
    I'm trying to write a script that will rename a computer and join it to a domain, and was planning to call on netdom.exe to do the dirty work. However, trying to run this utility in the script (same results in irb) does absolutely nothing. No output, no execution. I tried with backticks and with the system() method. System() returns false for everything but system("netdom") (which returns true). Backticks never return anything but an empty string. I have verified that netdom runs and works in the environment the script will be running in, and I'm calling other command-line utilities earlier in the script that work (w32tm, getmac, ping). Here's the exact line that gets executed: `netdom renamecomputer %COMPUTERNAME% /NewName:#{newname} /force` FYI, This is windows 7 x64

    Read the article

  • Malloc to a CGPoint Pointer throwing EXC_BAD_ACCESS when accessing

    - by kdbdallas
    I am trying to use a snippet of code from a Apple programming guide, and I am getting a EXC_BAD_ACCESS when trying to pass a pointer to a function, right after doing a malloc. (For Reference: iPhone Application Programming Guide: Event Handling - Listing 3-6) The code in question is really simple: CFMutableDictionaryRef touchBeginPoints; UITouch *touch; .... CGPoint *point = (CGPoint *)CFDictionaryGetValue(touchBeginPoints, touch); if (point == NULL) { point = (CGPoint *)malloc(sizeof(CGPoint)); CFDictionarySetValue(touchBeginPoints, touch, point); } Now when the program goes into the if statement it assigns the 'output' of malloc into the point variable/pointer. Then when it tries to pass point into the CFDictionarySetValue function it crashes the application with: Program received signal: “EXC_BAD_ACCESS”. Someone suggested not doing the malloc and pass the point var/pointer as: &point, however that still gave me a EXC_BAD_ACCESS. What I am (and it looks like Apple) doing wrong??? Thanks in advance.

    Read the article

  • What is the current state of Unit testing support in the R language

    - by PaulHurleyuk
    R is a statistics programming language. Part of R is the use of Packages, which themselves are written in the R language. Programming best practice includes the use of unit-testing to test the functions within these packages while they are being written and when they are used. I am aware of a few packages for unit testing within R, these being RUnit Svunit Testthat I'm interested to know; Are there any other packages out there ? Given peoples experience, do these packages excel at different things ? What's the current state of the art in unit testing for R ?

    Read the article

  • mvc components in codeigniter?

    - by ajsie
    in yii i could have mvc components (acts like an own application). could i have this too in codeigniter? eg. in SYSTEM/APPLICATION have a folder called COMPONENTS and in there i put stand-alone applications that would be a part of the application. components like ADDRESS BOOK, MAIL, TWITTER and so on. every component folder has folders like: models, views, controllers, config etc. so a component model extends the application model which in turn extends system's (code igniter) model. the same goes for view and controller. i've already got a lot of these components which i want to use in codeigniter. is it good idea to place them as i said in SYSTEM/APPLICATION/COMPONENTS or is there best practice for this?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Enable access for assistive device programmatically

    - by Dheeraj
    Hi All, I want to enable Access for assistive devices in System Preferences programmatically. But Problem is that my application is not running as root user and i do not want my application to be as root user and also should not ask for any authentication in between. I want to tap all keyboard events globally. I am using CGEventTapCreate() for the same.In the documentation of CGEventTapCreate() API it is mentioned that, Event taps receive key up and key down events if one of the following conditions is true: The current process is running as the root user. Access for assistive devices is enabled. In Mac OS X v10.4 & later, you can enable this feature using System Preferences, Universal Access panel, Keyboard view. I tried manually by checking the Enable Access for assistive devices from System Preference and it gives me expected output. So is there any way to do the same via program without asking for authentication and also application is not running as root user? Thanks, Dheeraj.

    Read the article

  • Parsing String to Time and insert in mysqldatabase

    - by kawtousse
    Goal: Parse a string from an input type text into TIME type to be inserted in MYSQL Database. String start= request.getParameter("startp"); System.out.println("start:" +start); SimpleDateFormat sdf = new SimpleDateFormat("HH:mm:ss"); long ms=0; try { ms = sdf.parse(start).getTime(); System.out.println(" the value of ms is:" +ms); } catch (ParseException e1) { // TODO Auto-generated catch block e1.printStackTrace(); } Time ts = new Time(ms); System.out.println("the value of ts is:" +ts); start:14:12 (value witch i entered actually in the form at the start field named startp) the value of ts is :01:00:00 java.text.ParseException: Unparseable date: "14:12" at java.text.DateFormat.parse(Unknown Source) ms not displayed I ensure that database type of the following parameter is TIME. Thanks.

    Read the article

  • Storing millions of URLs in a database for fast pattern matching

    - by Paras Chopra
    I am developing a web analytics kind of system which needs to log referring URL, landing page URL and search keywords for every visitor on the website. What I want to do with this collected data is to allow end-user to query the data such as "Show me all visitors who came from Bing.com searching for phrase that contains 'red shoes'" or "Show me all visitors who landed on URL that contained 'campaign=twitter_ad'", etc. Because this system will be used on many big websites, the amount of data that needs to log will grow really, really fast. So, my question: a) what would be the best strategy for logging so that scaling the system doesn't become a pain; b) how to use that architecture for rapid querying of arbitrary requests? Is there a special method of storing URLs so that querying them gets faster? In addition to MySQL database that I use, I am exploring (and open to) other alternatives better suited for this task.

    Read the article

  • How to find all the file handles by a process programmatically?

    - by kumar
    I have a process "x" which uses "system" C function to start ntpd daemon. I observed that ntpd are passed the open file descriptors of "x". ntpd holds on to the file descriptors even after original file is deleted. for ex: Some log files used by "x" are rotated out after sometime, but "ntpd" has file handle opened for these deleted files. Will it cause any problem? Alternatively I thought of setting "FD_CLOEXEC" flag for all the file descriptors before calling "system" function. But as we are running as an extension library to third process "x"( "x" loads our library based on some condition), there is no easy way to know about all the file descriptors process has opened. One way is to read /proc//fd and set "FD_CLOEXEC" for each file handle and reset it back after "system" function returns. I'm using Linux 2.16. Is there any other easy way to find all the file handlers? Thanks,

    Read the article

  • SWT Filedialog Open into home folder

    - by Ivan
    I want to open a FileDialog window into the user home folder (i.e. /home/user or /Users/unsername) I read the user home folder, using System.getProperty: String homefolder = System.getProperty(user.home); And the variable containts the correct home folder. But when i set the filterpath in FileDialog, it opens (in linux) only the /home level not entering into the user home dir. This is the source code: FileDialog dialog = new FileDialog(shell); dialog.setText("Choose a certificate"); String platform = SWT.getPlatform(); String homefolder = System.getProperty("user.home"); dialog.setFilterPath(homefolder); Any idea? Here a screenshot:

    Read the article

  • The unmentioned parts of COBOL's history

    - by be nice to me.
    I'm very curious about old programming languages, especially COBOL, and as Wikipedia couldn't really tell me much about this topic, I decided to ask it here: Was COBOL the first programming language really being used in financial, stock and banking systems? Where exactly was COBOL used? Was it used more frequently than Fortran or BASIC, for example? I don't know if you lived at that time, but how did people react to the rising COBOL? Did they expect it to be the future? When has COBOL actually stopped being used to create new, big systems? Are you sure that there are still important legacy apps written in COBOL out there? I can't believe that somehow.

    Read the article

  • Forbid access to DVD/CD/USB for some users

    - by alex2k8
    I need to forbid all users except administrators to write into DVD/CD/USB drives on Windows XP. Googled around and there is a way to disable devices completely: Cdrom: HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\cdrom\Start (from 1 to 4) Usb: HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\USBSTOR (from 3 to 4) but I need to disable them only for particular users.

    Read the article

  • Generate SQL Server Express database from Entity Framework 4 model

    - by Cranialsurge
    I am able to auto-generate a SQL Server CE 4.0 *.sdf file using code-first generation as explained by Scott Guthrie here. The connection string for the same is as follows: <add name="NerdDinners" providerName="System.Data.SqlServerCe.4.0" connectionString="data source=|DataDirectory|NerdDinner.sdf"/> However if I try to generate an mdf instead using the following connection string, it fails to do so with the following error - "The provider did not return a ProviderManifestToken string.". <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="data source=|DataDirectory|NerdDinner.mdf"/> Even directly hooking into a SQLEXPRESS instance using the following connection string fails <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="Data Source=.\SQLEXPRESS;Initial Catalog=NerdDinner;Integrated Security=True"/> Does EF 4 only support SQL CE 4.0 for database creation from a model for now or am I doing something wrong here?

    Read the article

  • Traditional ASP.NET application in subdirectory of an MVC application

    - by David
    Windows Server 2003, IIS6. We're trying to deploy a non-MVC ASP.NET web application as a subdirectory of an MVC application. However the ASP.NET application in the subdirectory is failing with the message "Could not load file or assembly 'System.Web.Mvc, Version=1.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35' or one of its dependencies. The system cannot find the file specified." which is bizarre because it's not an MVC application.

    Read the article

  • Routing and Remote Access Service won't start after full disk

    - by NKCSS
    The HDD of the server was out of disk space, and after a reboot, RRAS won't start anymore on my 2008 R2 server. Error Details: Log Name: System Source: RemoteAccess Date: 2/5/2012 9:39:52 PM Event ID: 20153 Task Category: None Level: Error Keywords: Classic User: N/A Computer: Windows14111.<snip> Description: The currently configured accounting provider failed to load and initialize successfully. The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error. Event Xml: <Event xmlns="http://schemas.microsoft.com/win/2004/08/events/event"> <System> <Provider Name="RemoteAccess" /> <EventID Qualifiers="0">20153</EventID> <Level>2</Level> <Task>0</Task> <Keywords>0x80000000000000</Keywords> <TimeCreated SystemTime="2012-02-05T20:39:52.000Z" /> <EventRecordID>12148869</EventRecordID> <Channel>System</Channel> <Computer>Windows14111.<snip></Computer> <Security /> </System> <EventData> <Data>The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error.</Data> <Binary>2C030000</Binary> </EventData> </Event> I think it has something to do with a corrupt config file, but I am unsure of what to do. I Removed the RRAS role, rebooted, and re-added, but it keeps failing with the same error. Thanks in advance. [UPDATE] If i set the accounting provider from 'Windows' to '' the service starts but VPN won't work. Any ideas how this can be repaired?

    Read the article

  • Problem with running c# application on another PC

    - by draghia-aurelian
    I wrote a Windows Form Application in C# and it works well for my computer. But on another PC, an error occurs when i try to do some stuff. code 1 private void rUNToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in rUNToolStripMenuItem_Click!"); ... } code 2 private void dataPositionToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in dataPositionToolStripMenuItem_Click!"); ... } Running on my computer: code1: MessageBox appears! code2: MessageBox appears! Running on another computer: code1: MessageBox doesn't appear and the error happens! code2: MessageBox appears! The error is: Method not found: "Void Microsoft.CSharp.RuntimeBinder.CSharpGetMemberBider..ctor(System.String.System.Type, System.Collections.Generic.IEnumerable'1)'. This is the PrintScreen with error: Please help me to solve the problem!

    Read the article

  • Can computer crashes and reboots mean weak power supply?

    - by TomA
    Recently I replaced the videocard in my PC for a newer, faster one. All games work perfectly but I get random system crashes and reboots. This happens even when the system is almost idle (browsing, playing music). It never happened with the old card. All drivers are up-to-date. Is it possible that the power supply is not powerful enough for the new card?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 668 669 670 671 672 673 674 675 676 677 678 679  | Next Page >