Search Results

Search found 29753 results on 1191 pages for 'best practices'.

Page 677/1191 | < Previous Page | 673 674 675 676 677 678 679 680 681 682 683 684  | Next Page >

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • migrate a portion of a mysql table to SQLite

    - by daniel
    I have a mysql table set up like so: user_id | document 44 [blob] 44 [blob] 44 [blob] 46 [blob] I'd like to export all of user_id 44's data to an SQLite3 file. Best way to go about this without writing a script that reads the data and dumps it into a SQLite file?

    Read the article

  • I need a dictionary-like mapping between characters and other kinds of objects. Which class would be

    - by nullPointerException
    This is in Squeak/Pharo. If I want to have a mapping between Character objects like $a and $b to other kinds of objects, and want to look up those other objects based on the Character, what is the best class to use? Dictionary is an obvious choice, but seems wasteful to be hashing character objects which are basically already numbers. I guess what I want is a kind of array where the character value (number) is used as an index/offset, but I am not sure if this is possible with Unicode.

    Read the article

  • Get the layout mode (landscape or portrait) of a pdf from php/linux

    - by Jonathan Hendler
    Given a PDF, how can one get the layout mode of a PDF (or relative width/height) using a PHP lib or linux command line tool? Using http://www.tecnick.com/public/code/cp%5Fdpage.php?aiocp%5Fdp=tcpdf which can set this variable on new PDFs, but for existing pdfs from adobe. Thought of converting pdfs to ps, or using gs in some other way - like converting it to an image first, and getting the width and height of that. Is this the best way?

    Read the article

  • nsmutablearray and saving to file

    - by Amir
    hello all, I have class named Shop that contain data members (NSString , NSInteger and nsmutablearray that contain another class(that have also NSString and NSInteger) Now if i use nsmutablearray to hold alist of Shops what is the best way to save the list to file and load it later? again the class Shop contain data memeber that is another class both of the classes have NSString and NSinteger (maybe also NSdata and NSdate) i heard somthing about archiver?? thanks.

    Read the article

  • GUI options for emulator c++

    - by dbomb101
    I want to create a Gameboy emulator which runs directly from the exe file, in a similar fashion to visualboy advance. I was wondering in terms of creating a GUI interface for the emulator what would be the best option to accomplish this ?

    Read the article

  • Copying subversion commit messages

    - by Falcor
    I know this isn't the BEST practice, but every once in a while when I'm merging up a huge batch up changes with the trunk (and I know my branch is current), I will simply delete the contents of the trunk and then copy the contents of my branch up, so that I don't have to deal with resolving conflicts for an hour. The problem is that I seem to lose the entire history of commit messages for each file. My branch still has the correct history of commit messages... how can I merge them up?

    Read the article

  • Extended MAPI: How to get the entry ID of messages moved by CopyMessages

    - by marijne
    I have found that if I move a message using IMAPIFolder::CopyMessages (using the MESSAGE_MOVE flag) the message gets a new entry ID. However I do not see any reliable way of getting the entry ID of the message in its new location, or otherwise getting a reference to it. The best suggestion I have had so far involves tagging the message with the old custom property before moving, and then doing a search afterwards, but I was wondering if there is a less convoluted solution.

    Read the article

  • Parsing complicated query parameters

    - by Will
    My Python server receives jobs that contain a list of the items to act against, rather like a search query term; an example input: (Customer:24 OR Customer:24 OR (Group:NW NOT Customer:26)) To complicate matters, customers can join and leave groups at any time, and the job should be updated live when this happens. How is best to parse, apply and store (in my RDBMS) this kind of list of constraints?

    Read the article

  • PHP script sample for iPhone hi-score/survey uploading?

    - by Horace Ho
    I am looking for a PHP example/tutorial which can accept hi-scores/survey upload from an iPhone. Hopefully, the PHP script: accepts POST, in additional to GET works over SSL (https) connects to MySQL In addition, it'd best the iPhone can get a session from the server and submit the session value along with the hi-score. Thanks

    Read the article

  • Android "hello world" - versions

    - by Ianb
    Starter question: My "Hello World" attempt won't run, ("No compatible targets were found"), I think this is bacause I selected the latest version for my project (2.2), and the highest AVD version is 2.0.1. Does this make sense? Can I change my project version (haven't been able to find a way to do this), or do I have to start again? If the versions are not backwards compatible, what is the best version to use for the majority of Android devices out there? Thanks

    Read the article

  • Can I declare the same value for two attributes at once

    - by graphicdivine
    For example, for accessibility reasons I want my onfocus and onmouseover to have identical values. For the sake of maintainability I want to declare this once only. What I'd like to be able to do is this: <a onmouseover,onfocus="assist('hello');">linktext</a> But, of course, that would be too easy, and doesn't work. What's the best way I can achieve this DRYing out of my tags?

    Read the article

  • How to I "scan" a website(or page) for info, and bring it into my program?

    - by James
    Well, I'm pretty much trying to figure out how to pull information from a webpage, and bring it into my program(in Java). For example, if I know the exact page I want info from, for the sake of simplicity a Best Buy item page, how would I get the appropriate info I need off of that page? Like the title, price, description? What would this process even be called? I have no idea were to even began researching this :'(

    Read the article

  • Database design

    - by Hadad
    Hello, I've a system, that have two types of users (Companies and individuals).all types have a shared set of properties but they differ in another. What is the best design merge all in one table that allows null for unmatched properties, or separate them in two tables related to a basic table with a one to one relationship. Thanks.

    Read the article

  • svn: default name for a tag when name is not important?

    - by Jason S
    I need to tag the current state of my source tree in svn. My problem is I don't care what the name is, I just need to mark the current revision in an immutable* manner. (*subject to malicious behavior) What's the best way to do this? branches/ tags/ ??? trunk/ should ??? be the date, an incrementing sequence, the repository rev # ...?

    Read the article

  • Why is there no middleware in Erlang?

    - by Zubair
    I asked a question earlier about ESBs written in Erlang or Java, and there didn't seem to be anything in Erlang, and only products in Java. http://stackoverflow.com/questions/2453641/what-would-be-the-best-language-in-which-to-write-an-esb/2453683#2453683 I guess I find it difficult to understand why a language like Erlang has no such middleware products, especially seeing as it should be ideally suited to the job.

    Read the article

  • Ways to restrict WCF Service so only our apps can access it.

    - by RP
    I have a public WCF Service. I have a WPF Desktop app & a silverlight app. My apps does not have any login requirements. I want to make it difficult for another developer / website to make use of my service. What's the best way to restrict access to my service? Use SSL and have the desktop / silverlight app store a token inside of it?

    Read the article

  • Can I use php's fwrite with 644 file permissions?

    - by filip
    I am trying to set up automated .htaccess updating. This clearly needs to be as secure as possible, however right now the best I can do file permission-wise is 666. What can I do to setup either my server or php code so that my script's fwrite() command will work with 644 or better? For instance is there a way to set my script(s) to run as owner?

    Read the article

  • jQuery ajax.load div, then have parent container access property

    - by Brett
    So I have a tabbed ui "form", each tab is quiet complicated so it is loaded via the .load('item.html'); command. All good, when the user clicks to a different tab, I want to read a property, maybe execute a function from within the ajax loaded div. What is the best way to get to these properties and methods from outsite the ajax loaded div?

    Read the article

< Previous Page | 673 674 675 676 677 678 679 680 681 682 683 684  | Next Page >