Search Results

Search found 36645 results on 1466 pages for 'local content'.

Page 678/1466 | < Previous Page | 674 675 676 677 678 679 680 681 682 683 684 685  | Next Page >

  • Spamassassin one-liner to tag & move mail with an X-Spam-Flag: YES to a new directory?

    - by ane
    Say you have a directory with tens of thousands of messages in it. And you want to separate the spam from the non-spam. Specifically, you would like to: Run spamassassin against the directory, tagging each message with an X-Spam-Flag: YES if it thinks it's spam Have a tcsh shell or perl one-liner grep all mail with the flag and move those mails to /tmp/spam What command can you run to accomplish this? For example, some pseudocode: /usr/local/bin/spamassassin -eL ./Maildir/cur/* | grep "X-Spam-Flag: YES" | mv %1 /tmp/spam

    Read the article

  • Rule of thumb in RAM estimate for static pages? [closed]

    - by IMB
    Possible Duplicate: How do you do Load Testing and Capacity Planning for Web Sites I've seen tutorials saying they can run decent websites on 64MB RAM (Debian/Lighttpd/PHP/MySQL) however it's not clearly defined how much hits/traffic a "decent" site gets. Is there a rule of thumb on how much RAM a web server needs? To keep things simple, let's say you're running a site with static content and it's averaging at 100,000 hits per hour (HTML + images combined, no MySQL). How much RAM is the minimum requirement for that?

    Read the article

  • How to install PHP in a new directory in Windows

    - by jasondavis
    I am using Xampp for a local dev server, I am trying to upgrade it so I can use the latest version of PHP. I had it installed in my c drive c:\webserver\php I just installed everything new in a new drive D d:\webserver\php I then boot everything up and then I run phpinfo() and it is still showing my old version of PHP and even points to the old php installation C:\webserver\php\php.ini Am I missing something obvious here?

    Read the article

  • Copying SharePoint DB to a new SharePoint 2010 server

    - by LJe
    Hi - we would like to know what is the best and easy way to configure a new SharePoint 2010 Server, we have backup the existing DB of SharePoint 2007 (up and running). We would like to mirror the same settings and content of our current SharePoint setup to the new server using the SharePoint 2010.

    Read the article

  • How is it possible that a 4.5gb DVD claims 415gb of contents?

    - by romilnagrani
    I am copying a 4.7 GB dvd contents into my local drive but the total size of DVD is being shown as 415 GB!. How is that possible? Because of which it is showing less space (as my drive is of 150 GB) and thus cannot be copied? I am surprised that how a 4.7 GB dvd contains 415 GB data? Its a movie DVD (contains dual subtitles and dual language, if that helps) Attached is the image for reference Inside the DVD the video folder shows 415 GB

    Read the article

  • Windows TCP timeout

    - by hs2d
    Is there on windows any default timeout for tcp connection? So when no answere is received the connection would be closed. Why im asking is that on one machine the connection is closed afther 5 minutes.(Windows XP) Running the same client - server connection on other machine the connection is kept open forever like it should be. Or maybe there is some global java virtual machine setting somewhere i should know about? The server and client run on the same local machine

    Read the article

  • Make Chrome browser prefer DNS over searching

    - by dronus
    Is it possible to let the Chrome browser prefer all DNS resolvable URLs over a search? Everytime I use a local name not matching a usual domain scheme, I got search results for it. I first thought that no nonsense DNS lookup is made if the URL seems to be a search keyword, however Chrome always detect this condition and asks me if I like to go to my domain instead. So the DNS lookup is made anyway.

    Read the article

  • What windows licence can I purchase to run a web service in intranet? [closed]

    - by user63580
    Possible Duplicate: Can you help me with my software licensing question? One of my customers wants me to provide my web-app to be installed in his local area network, behind the firewall - it will not be accessible from the Internet. They require the server to be run on windows (linux is not acceptable). What windows licence shoud I purchase to run my web-based app for 400 users not violating Microsoft licencing terms?

    Read the article

  • IIS, SSL, and Virtual Directories

    - by yodie
    I'm running a webserver on WS 2k3, IIS 6.0. Some of the content is on that server, but most is in a virtual directory linked to another server. Everything works (almost) fine when no SSL is used. However, when using SSL, I cannot access the files in the virtual directory. Instead I get a generic error 500. Any advice?

    Read the article

  • After exiting, the home folder cannot be visited?

    - by Keating Wang
    I ssh to a ubuntu sever, start a web project(Rails), then I can visit this project. I close the the ssh terminal, then the project says can not find files(view pages,css files and so on). I put the project in the home folder(/home/byht). why? When closing the ssh terminal, the user's folder can not be visited ? You know, when I put the project in another folder(/usr/local), everything goes well.

    Read the article

  • Where should I configure software installed by 3rd-party chef recipes?

    - by FRKT
    I'm provisioning a Vagrant virtual machine with Chef and it's amazing, but I'm unsure where I should put code to configure software installed by 3rd-party chef recipes. For example, I'm installing NGINX with this recipe but I need to configure the default virtual host to serve content from /vagrant/public instead of /var/www/nginx-default. Should I change the template of the 3rd-party recipe, or create another recipe that reconfigures it?

    Read the article

  • Create a certificate file

    - by saeed hardan
    I have a proxy that I want to test. The proxy generates a private key and a certificate like here . I have tried to copy the content as in the link in a file and name it x.CER , then clicked on it and i got the message : This file is invalid for use as the following : Security Certificate how can i install them on windows ? note: I have set in internet options that all the traffic goes throw the proxy

    Read the article

  • How to allow only specific directories to use htaccess?

    - by DisgruntledGoat
    Currently in apache2.conf I have AllowOverride all set for /var/www which simply allows htaccess for all the sites on the server (which is Ubuntu, 9.04). However, I'd rather only allow overrides in each site root directory and nothing else. In other words, /var/www/site1, /var/www/site2, etc. can have a htaccess, but all other directories including /var/www and /var/www/site1/content cannot. Is there a way to do this without having to write a rule for every site on the server?

    Read the article

  • Site Collection search

    - by Don
    When searching your MossFarm, you only get users and Mysites. But no reply on searching local blog site... reply comes back empty I have tried to do the following: 1) net stop osearch 2) net start osearch 3) iisreset /noforce ~ Please help! Don

    Read the article

  • Java application delivery through CDN

    - by tuler
    We have a java application bundled as an applet or as webstart. The client java plugin caches the jar files on the client machine and downloads a new version if there is one. Is it possible to deliver this jar files using a CDN? What are the issues involved? Which CDNs would work for jar delivery? Is this different from static content delivery like images or video?

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • source command in Linux

    - by Rodnower
    My question is: why if I run some file with name aliases for example with content such as: alias lsa="ls -a" directly: $ ./aliases it don't create the alias (may be only in script context). But if I run it with command "source": $ source aliases it do the work? I mean after execution the alias "lsa" existing in context of command shell? "man source" give: "No manual entry for source", and in google I just found that it runs Tcl, but why Tcl influence shell context and bush not?

    Read the article

  • How do I configure Gnome 3 so that it doesn't pop up a dialog for 'open with files' when I mount a drive?

    - by michael
    I am running Gnome 3 on Ubuntu 11.10. In the file manager, when I click a drive under 'Devices', Gnome 3 always pops up a dialog with the choices 'open with files' and 'eject' and then I need to click 'open with files' to get rid of that dialog. Is there a way to configure Gnome 3 not to do that? I am in file manager already, clicking a drive should show the content in the right pane. Why does it still ask me to 'open with files'?

    Read the article

  • define variable in linux that can be access in php

    - by sweb
    I add a variable in whole linux varibale in /etc/profile export MYNAME="My Value" how can i access this value in php source code during run via apache web server? in $_SERVER this value doesn't exist. just this keys appear on $_ENV: _ENV["APACHE_RUN_DIR"] /var/run/apache2 _ENV["APACHE_PID_FILE"] /var/run/apache2.pid _ENV["PATH"] /usr/local/bin:/usr/bin:/bin _ENV["APACHE_LOCK_DIR"] /var/lock/apache2 _ENV["LANG"] C _ENV["APACHE_RUN_USER"] www-data _ENV["APACHE_RUN_GROUP"] www-data _ENV["APACHE_LOG_DIR"] /var/log/apache2 _ENV["PWD"] /

    Read the article

  • Server is sending SPAM but it's not an open relay

    - by alexandernst
    I have a problem with Dovecot + Postfix. My server is sending SPAM from the local user "dovecot", but my server is not configured as an open relay (mails can be sent without auth-ing only from localhost). Also, nobody except me, has SSH access to the server. How can I find what exactly is triggering all those SPAM mails? How can I get something like a backtrace that shows what exactly happened the moments before a SPAM email got in the queue of postfix? Regards

    Read the article

< Previous Page | 674 675 676 677 678 679 680 681 682 683 684 685  | Next Page >