Search Results

Search found 18648 results on 746 pages for 'left join'.

Page 691/746 | < Previous Page | 687 688 689 690 691 692 693 694 695 696 697 698  | Next Page >

  • NOOB Memory Problem - EXC_BAD_ACCESS

    - by Michael Bordelon
    I have been banging my head against the wall for a couple days and need some help. I have a feeling that I am doing something really silly here, but I cannot find the issue. This is the controller for a table view. I put the SQL in line to simplify it as part of the troubleshooting of this error. Normally, it would be in an accessor method in a model class. It gets through the SQL read just fine. Finds the two objects, loads them into the todaysWorkout array and then builds the cells for the table view. The table view actually comes up on the scree and then it throws the EXC_BAD_ACCESS. I ran instruments and it shows the following: 0 CFString Malloc 1 00:03.765 0x3946470 176 Foundation -[NSPlaceholderString initWithFormat:locale:arguments:] 1 CFString Autorelease 00:03.765 0x3946470 0 Foundation NSRecordAllocationEvent 2 CFString CFRelease 0 00:03.767 0x3946470 0 Bring It -[WorkoutViewController viewDidLoad] 3 CFString Zombie -1 00:03.917 0x3946470 0 Foundation NSPopAutoreleasePool Here is the source code for the controller. I left it all in there just in case there is something extraneous causing the problem. I sincerely appreciate any help I can get: #import "WorkoutViewController.h" #import "MoveListViewController.h" #import "Profile.h" static sqlite3 *database = nil; @implementation WorkoutViewController @synthesize todaysWorkouts; @synthesize woNoteCell; @synthesize bi; //@synthesize woSwitchCell; - (void)viewDidLoad { [super viewDidLoad]; bi = [[BIUtility alloc] init]; todaysWorkouts = [[NSMutableArray alloc] init]; NSString *query; sqlite3_stmt *statement; //open the database if (sqlite3_open([[BIUtility getDBPath] UTF8String], &database) != SQLITE_OK) { sqlite3_close(database); NSAssert(0, @"Failed to opendatabase"); } query = [NSString stringWithFormat:@"SELECT IWORKOUT.WOINSTANCEID, IWORKOUT.WORKOUTID, CWORKOUTS.WORKOUTNAME FROM CWORKOUTS JOIN IWORKOUT ON IWORKOUT.WORKOUTID = CWORKOUTS.WORKOUTID AND DATE = '%@'", [BIUtility todayDateString]]; if (sqlite3_prepare_v2(database, [query UTF8String], -1, &statement, nil) == SQLITE_OK) { while (sqlite3_step(statement) == SQLITE_ROW) { Workout *wo = [[Workout alloc] init]; wo.woInstanceID = sqlite3_column_int(statement, 0); wo.workoutID = sqlite3_column_int(statement, 1); wo.workoutName = [NSString stringWithUTF8String:(char *)sqlite3_column_text(statement, 2)]; [todaysWorkouts addObject:wo]; [wo release]; } sqlite3_finalize(statement); } if(database) sqlite3_close(database); [query release]; } - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { //todaysWorkouts = [BIUtility todaysScheduledWorkouts]; static NSString *noteCellIdentifier = @"NoteCellIdentifier"; UITableViewCell *cell; if (indexPath.section < ([todaysWorkouts count])) { cell = [tableView dequeueReusableCellWithIdentifier:@"OtherCell"]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithFrame:CGRectZero reuseIdentifier: @"OtherCell"] autorelease]; cell.accessoryType = UITableViewCellAccessoryNone; } if (indexPath.row == 0) { Workout *wo = [todaysWorkouts objectAtIndex:indexPath.section]; [cell.textLabel setText:wo.workoutName]; } else { [cell.textLabel setText:@"Completed?"]; [cell.textLabel setFont:[UIFont fontWithName:@"Arial" size:15]]; [cell.textLabel setTextColor:[UIColor blueColor]]; } } else { cell = (NoteCell *)[tableView dequeueReusableCellWithIdentifier:noteCellIdentifier]; if (cell == nil) { NSArray *nib = [[NSBundle mainBundle] loadNibNamed:@"NoteCell" owner:self options:nil]; cell = [nib objectAtIndex:0]; } } return cell; //[cell release]; } - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { NSUInteger row = [indexPath row]; if (indexPath.section < ([todaysWorkouts count]) && (row == 0)) { MoveListViewController *moveListController = [[MoveListViewController alloc] initWithStyle:UITableViewStylePlain]; moveListController.workoutID = [[todaysWorkouts objectAtIndex:indexPath.section] workoutID]; moveListController.workoutName = [[todaysWorkouts objectAtIndex:indexPath.section] workoutName]; moveListController.woInstanceID = [[todaysWorkouts objectAtIndex:indexPath.section] woInstanceID]; NSLog(@"Workout Selected: %@", [[todaysWorkouts objectAtIndex:indexPath.section] workoutName]); Bring_ItAppDelegate *delegate = [[UIApplication sharedApplication] delegate]; [delegate.workoutNavController pushViewController:moveListController animated:YES]; } else { UITableViewCell *cell = [tableView cellForRowAtIndexPath:indexPath]; if (indexPath.section < ([todaysWorkouts count]) && (row == 1)) { if (cell.accessoryType == UITableViewCellAccessoryNone) { cell.accessoryType = UITableViewCellAccessoryCheckmark; } else { cell.accessoryType = UITableViewCellAccessoryNone; } } } [tableView deselectRowAtIndexPath:indexPath animated:YES]; } - (CGFloat)tableView:(UITableView *)tableView heightForRowAtIndexPath:(NSIndexPath *)indexPath { NSInteger h = 35; return h; } - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { return ([todaysWorkouts count] + 1); //return ([todaysWorkouts count]); } - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { if (section < ([todaysWorkouts count])) { return 2; } else { return 1; } } - (NSString *)tableView:(UITableView *)tableView titleForHeaderInSection:(NSInteger)section { if (section < ([todaysWorkouts count])) { return @"Workout"; } else { return @"How Was Your Workout?"; } } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { [super viewDidUnload]; // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)dealloc { [todaysWorkouts release]; [bi release]; [super dealloc]; } @end

    Read the article

  • Android draw using SurfaceView and Thread

    - by Morten Høgseth
    I am trying to draw a ball to my screen using 3 classes. I have read a little about this and I found a code snippet that works using the 3 classes on one page, Playing with graphics in Android I altered the code so that I have a ball that is moving and shifts direction when hitting the wall like the picture below (this is using the code in the link). Now I like to separate the classes into 3 different pages for not making everything so crowded, everything is set up the same way. Here are the 3 classes I have. BallActivity.java Ball.java BallThread.java package com.brick.breaker; import android.app.Activity; import android.os.Bundle; import android.view.Window; import android.view.WindowManager; public class BallActivity extends Activity { private Ball ball; @Override protected void onCreate(Bundle savedInstanceState) { // TODO Auto-generated method stub super.onCreate(savedInstanceState); requestWindowFeature(Window.FEATURE_NO_TITLE); getWindow().setFlags(WindowManager.LayoutParams.FLAG_FULLSCREEN,WindowManager.LayoutParams.FLAG_FULLSCREEN); ball = new Ball(this); setContentView(ball); } @Override protected void onPause() { // TODO Auto-generated method stub super.onPause(); setContentView(null); ball = null; finish(); } } package com.brick.breaker; import android.content.Context; import android.graphics.Bitmap; import android.graphics.BitmapFactory; import android.graphics.Canvas; import android.view.SurfaceHolder; import android.view.SurfaceView; public class Ball extends SurfaceView implements SurfaceHolder.Callback { private BallThread ballThread = null; private Bitmap bitmap; private float x, y; private float vx, vy; public Ball(Context context) { super(context); // TODO Auto-generated constructor stub bitmap = BitmapFactory.decodeResource(getResources(), R.drawable.ball); x = 50.0f; y = 50.0f; vx = 10.0f; vy = 10.0f; getHolder().addCallback(this); ballThread = new BallThread(getHolder(), this); } protected void onDraw(Canvas canvas) { update(canvas); canvas.drawBitmap(bitmap, x, y, null); } public void update(Canvas canvas) { checkCollisions(canvas); x += vx; y += vy; } public void checkCollisions(Canvas canvas) { if(x - vx < 0) { vx = Math.abs(vx); } else if(x + vx > canvas.getWidth() - getBitmapWidth()) { vx = -Math.abs(vx); } if(y - vy < 0) { vy = Math.abs(vy); } else if(y + vy > canvas.getHeight() - getBitmapHeight()) { vy = -Math.abs(vy); } } public int getBitmapWidth() { if(bitmap != null) { return bitmap.getWidth(); } else { return 0; } } public int getBitmapHeight() { if(bitmap != null) { return bitmap.getHeight(); } else { return 0; } } public void surfaceChanged(SurfaceHolder holder, int format, int width, int height) { // TODO Auto-generated method stub } public void surfaceCreated(SurfaceHolder holder) { // TODO Auto-generated method stub ballThread.setRunnable(true); ballThread.start(); } public void surfaceDestroyed(SurfaceHolder holder) { // TODO Auto-generated method stub boolean retry = true; ballThread.setRunnable(false); while(retry) { try { ballThread.join(); retry = false; } catch(InterruptedException ie) { //Try again and again and again } break; } ballThread = null; } } package com.brick.breaker; import android.graphics.Canvas; import android.view.SurfaceHolder; public class BallThread extends Thread { private SurfaceHolder sh; private Ball ball; private Canvas canvas; private boolean run = false; public BallThread(SurfaceHolder _holder,Ball _ball) { sh = _holder; ball = _ball; } public void setRunnable(boolean _run) { run = _run; } public void run() { while(run) { canvas = null; try { canvas = sh.lockCanvas(null); synchronized(sh) { ball.onDraw(canvas); } } finally { if(canvas != null) { sh.unlockCanvasAndPost(canvas); } } } } public Canvas getCanvas() { if(canvas != null) { return canvas; } else { return null; } } } Here is a picture that shows the outcome of these classes. I've tried to figure this out but since I am pretty new to Android development I thought I could ask for help. Does any one know what is causing the ball to be draw like that? The code is pretty much the same as the one in the link and I have tried to experiment to find a solution but no luck. Thx in advance for any help=)

    Read the article

  • convert arabic html to pdf

    - by Mariam
    <div> <table border="1" width="500px"> <tr> <td colspan="2"> aspdotnetcodebook ????? ???????</td> </tr> <tr> <td> cell1 </td> <td> cell2 </td> </tr> <tr> <td colspan="2"> <asp:Label ID="lblLabel" runat="server" Text=""></asp:Label> <img alt="" src="logo.gif" style="width: 174px; height: 40px" /></td> </tr> <tr> <td colspan="2" dir="rtl"> <h1> <img alt="" height="168" src="http://a.cksource.com/c/1/inc/img/demo-little-red.jpg" style="margin-left: 10px; margin-right: 10px; float: left;" width="120" />????? ????? ??? ??? ?? ?? ??</h1> <p> ?????? ??????? ??????? ???? ?????? ????? ??????? ?????? ???? ?????? ?????? ??????? ????????. ???????? ??? ??????? ??????? ????? ?????? ??????? ?? ??????? ??? ?????? ????? ????? ?????? ????? ???????? ?? ????? ????? ???? ????? ?? ????? ?????? ??????? ??????? ????? ??????? ?????????. <a href="http://en.wikipedia.org/wiki/Brothers_Grimm"> ??????? ????/a> ?????? ??????? ??????? ???? ?????? ????? ??????? ?????? ???? ?????? ?????? ??????? ????????. ???????? ??? ??????? ??????? ????? ?????? ??????? ?? ??????? ??? ?????? ????? ????? ?????? ????? ???????? ?? ????? ????? ???? ????? ?? ????? ?????? ??????? ??????? ????? ??????? ?????????. <a href="http://en.wikipedia.org/wiki/Hood_(headgear%2529" title="Hood (headgear)">?</a><a href="http://en.wikipedia.org/wiki/Hood_(headgear%2529">?????</a> <a href="http://en.wikipedia.org/wiki/Cape" title="Cape">?</a><a href="http://en.wikipedia.org/wiki/Cape">??</a> ?? <a href="http://en.wikipedia.org/wiki/Cloak" title="?????????">?????????</a> ?????? ??????? ??????? ???? ?????? ????? ??????? ?????? ???? ?????? ?????? ??????? ????????. ???????? ??? ??????? ??????? ????? ?????? ??????? ?? ??????? ??? ?????? ????? ????? ?????? ????? ???????? ?? ????? ????? ???? ????? ?? ????? ?????? ??????? ??????? ????? ??????? ?????????. .</p> <p> ?????? ??????? ??????? ???? ?????? ????? ??????? ?????? ???? ?????? ?????? ??????? ????????. ???????? ??? ??????? ??????? ????? ?????? ??????? ?? ??????? ??? ?????? ????? ????? ?????? ????? ???????? ?? ????? ????? ???? ????? ?? ????? ?????? ??????? ??????? ????? ??????? ?????????.</p> <p> ?????? ??????? ??????? ???? ?????? ????? ??????? ?????? ???? ?????? ?????? ??????? ????????. ???????? ??? ??????? ??????? ????? ?????? ??????? ?? ??????? ??? ?????? ????? ????? ?????? ????? ???????? ?? ????? ????? ???? ????? ?? ????? ?????? ??????? ??????? ????? ??????? ?????????.</p> <p> ?????? ??????? ??????? ???? ?????? ????? ??????? ?????? ???? ?????? ?????? ??????? ????????. ???????? ??? ??????? ??????? ????? ?????? ??????? ?? ??????? ??? ?????? ????? ????? ?????? ????? ???????? ?? ????? ????? ???? ????? ?? ????? ?????? ??????? ??????? ????? ??????? ?????????. <a href="http://en.wikipedia.org/wiki/Hunter">??????</a>, ?????? ??????? ??????? ???? ?????? ????? ??????? ?????? ???? ?????? ?????? ??????? ????????. ???????? ??? ??????? ??????? ????? ?????? ??????? ?? ??????? ??? ?????? ????? ????? ?????? ????? ???????? ?? ????? ????? ???? ????? ?? ????? ?????? ??????? ??????? ????? ??????? ?????????. ??????? ??????? ???? ?????? ????? ??????? ?????? ???? ?????? ?????? ??????? ????????. ???????? ??? ??????? ??????? ????? ?????? ??????? ?? ??????? ??? ?????? ????? ????? ?????? ????? ???????? ?? ????? ????? ???? ????? ?? ????? ?????? ??????? ??????? ????? ??????? ?????????.</p> <p> ?????? ??????? ??????? ???? ?????? ????? ??????? ?????? ???? ?????? ?????? ??????? ????????. ???????? ??? ??????? ??????? ????? ?????? ??????? ?? ??????? ??? ?????? ????? ????? ?????? ????? ???????? ?? ????? ????? ???? ????? ?? ????? ?????? ??????? ??????? ????? ??????? ?????????. <a href="http://en.wikipedia.org/wiki/Enchanted_forest">??????</a>, ?????? ??????? ??????? ???? ?????? ????? ??????? ?????? ???? ?????? ?????? ??????? ????????. ???????? ??? ??????? ??????? ????? ?????? ??????? ?? ??????? ??? ?????? ????? ????? ?????? ????? ???????? ?? ????? ????? ???? ????? ?? ????? ?????? ??????? ??????? ????? ??????? ?????????. </p> </td> </tr> </table> </div> i use itextsharp to convert this content which is stored in DB to pdf file to be downloaded to the user i cant achieve this

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Perl LWP::UserAgent mishandling UTF-8 response

    - by RedGrittyBrick
    When I use LWP::UserAgent to retrieve content encoded in UTF-8 it seems LWP::UserAgent doesn't handle the encoding correctly. Here's the output after setting the Command Prompt window to Unicode by the command chcp 65001 Note that this initially gives the appearance that all is well, but I think it's just the shell reassembling bytes and decoding UTF-8, From the other output you can see that perl itself is not handling wide characters correctly. C:\perl getutf8.pl ====================================================================== HTTP/1.1 200 OK Connection: close Date: Fri, 31 Dec 2010 19:24:04 GMT Accept-Ranges: bytes Server: Apache/2.2.8 (Win32) PHP/5.2.6 Content-Length: 75 Content-Type: application/xml; charset=utf-8 Last-Modified: Fri, 31 Dec 2010 19:20:18 GMT Client-Date: Fri, 31 Dec 2010 19:24:04 GMT Client-Peer: 127.0.0.1:80 Client-Response-Num: 1 <?xml version="1.0" encoding="UTF-8"? <nameBudejovický Budvar</name ====================================================================== response content length is 33 ....v....1....v....2....v....3....v....4 <nameBudejovický Budvar</name . . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . 3c6e616d653e427564c49b6a6f7669636bc3bd204275647661723c2f6e616d653e < n a m e B u d ? ? j o v i c k ? ? B u d v a r < / n a m e Above you can see the payload length is 31 characters but Perl thinks it is 33. For confirmation, in the hex, we can see that the UTF-8 sequences c49b and c3bd are being interpreted as four separate characters and not as two Unicode characters. Here's the code #!perl use strict; use warnings; use LWP::UserAgent; my $ua = LWP::UserAgent-new(); my $response = $ua-get('http://localhost/Bud.xml'); if (! $response-is_success) { die $response-status_line; } print '='x70,"\n",$response-as_string(), '='x70,"\n"; my $r = $response-decoded_content((charset = 'UTF-8')); $/ = "\x0d\x0a"; # seems to be \x0a otherwise! chomp($r); # Remove any xml prologue $r =~ s/^<\?.*\?\x0d\x0a//; print "Response content length is ", length($r), "\n\n"; print "....v....1....v....2....v....3....v....4\n"; print $r,"\n"; print ". . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . \n"; print unpack("H*", $r), "\n"; print join(" ", split("", $r)), "\n"; Note that Bud.xml is UTF-8 encoded without a BOM. How can I persuade LWP::UserAgent to do the right thing? P.S. Ultimately I want to translate the Unicode data into an ASCII encoding, even if it means replacing each non-ASCII character with one question mark or other marker. I have accepted Ysth's "upgrade" answer - because I know it is the right thing to do when possible. However I am going to use a work-around (which may depress Tom further): $r = encode("cp437", decode("utf8", $r));

    Read the article

  • HTML5 Form: Page Is Reloading Instantly After Restyling (And It Shouldn't Be)

    - by user3689753
    I have a form. I have made it so that if your name is not put in, a red border is put on the name field. That works, BUT...it's for a split second, and then the page reloads. I want the red border to appear, and then stay there. For some reason it's for a split second. Can someone help me make it so the page doesn't reload after displaying the red border? Here's the script. window.onload = function() { document.getElementById("Hogwarts").onsubmit = function () { window.alert("Form submitted. Owl being sent..."); var fname = document.getElementById("fName"); if(!fName.value.match("^[A-Z][A-Za-z]+( [A-Z][A-Za-z]*)*$")) { window.alert("You must enter your name."); addClass(fName, "errorDisp"); document.getElementById("fName").focus(); } else return true; } } function addClass(element, classToAdd) { var currentClassValue = element.className; if (currentClassValue.indexOf(classToAdd) == -1) { if ((currentClassValue == null) || (currentClassValue === "")) { element.className = classToAdd; } else { element.className += " " + classToAdd; } } } function removeClass(element, classToRemove) { var currentClassValue = element.className; if (currentClassValue == classToRemove) { element.className = ""; return; } var classValues = currentClassValue.split(" "); var filteredList = []; for (var i = 0 ; i < classValues.length; i++) { if (classToRemove != classValues[i]) { filteredList.push(classValues[i]); } } element.className = filteredList.join(" "); } Here's the HTML. <!DOCTYPE HTML> <html lang="en"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1"> <title>Hogwarts School of Witchcraft And Wizardry Application Form</title> <link rel="stylesheet" type="text/css" href="main.css" media="screen"/> <script src="script.js" type="text/javascript"></script> </head> <body> <section> <header> <h1>Hogwarts School of Witchcraft And Wizardry</h1> <nav></nav> </header> <main> <form method="post" id="Hogwarts"> <!--<form action="showform.php" method="post" id="Hogwarts">--!> <fieldset id="aboutMe"> <legend id="aboutMeLeg">About Me</legend> <div class="fieldleading"> <label for="fName" class="labelstyle">First name:</label> <input type="text" id="fName" name="fName" autofocus maxlength="50" value="" placeholder="First Name" size="30"> <label for="lName" class="labelstyle">Last name:</label> <input type="text" id="lName" name="lName" required maxlength="50" value="" placeholder="Last Name" pattern="^[A-Za-z ]{3,}$" size="30"> <label for="age" class="labelstyle">Age:</label> <input type="number" id="age" name="age" required min="17" step="1" max="59" value="" placeholder="Age"> </div> <div class="fieldleading"> <label for="date" class="labelstyle">Date Of Birth:</label> <input type="date" name="date1" id="date" required autofocus value=""> </div> <div id="whitegender"> <div class="fieldleading"> <label class="labelstyle">Gender:</label> </div> <input type="radio" name="sex" value="male" class="gender" required="required">Male<br/> <input type="radio" name="sex" value="female" class="gender" required="required">Female<br/> <input type="radio" name="sex" value="other" class="gender" required="required">Other </div> </fieldset> <fieldset id="contactInfo"> <legend id="contactInfoLeg">Contact Information</legend> <div class="fieldleading"> <label for="street" class="labelstyle">Street Address:</label> <input type="text" id="street" name="street" required autofocus maxlength="50" value="" placeholder="Street Address" pattern="^[0-9A-Za-z\. ]+{5,}$" size="35"> <label for="city" class="labelstyle">City:</label> <input type="text" id="city" name="city" required autofocus maxlength="30" value="" placeholder="City" pattern="^[A-Za-z ]{3,}$" size="35"> <label for="State" class="labelstyle">State:</label> <select required id="State" name="State" > <option value="Select Your State">Select Your State</option> <option value="Delaware">Delaware</option> <option value="Pennsylvania">Pennsylvania</option> <option value="New Jersey">New Jersey</option> <option value="Georgia">Georgia</option> <option value="Connecticut">Connecticut</option> <option value="Massachusetts">Massachusetts</option> <option value="Maryland">Maryland</option> <option value="New Hampshire">New Hampshire</option> <option value="New York">New York</option> <option value="Virginia">Virginia</option> </select> </div> <div class="fieldleading"> <label for="zip" class="labelstyle">5-Digit Zip Code:</label> <input id="zip" name="zip" required autofocus maxlength="5" value="" placeholder="Your Zip Code" pattern="^\d{5}$"> <label for="usrtel" class="labelstyle">10-Digit Telephone Number:</label> <input type="tel" name="usrtel" id="usrtel" required autofocus value="" placeholder="123-456-7890" pattern="^\d{3}[\-]\d{3}[\-]\d{4}$"> </div> <div class="fieldleading"> <label for="email1" class="labelstyle">Email:</label> <input type="email" name="email1" id="email1" required autofocus value="" placeholder="[email protected]" pattern="^[a-z0-9._%+-]+@[a-z0-9.-]+\.[a-z]{2,4}$" size="35"> <label for="homepage1" class="labelstyle">Home Page:</label> <input type="url" name="homepage1" id="homepage1" required autofocus value="" placeholder="http://www.hp.com" pattern="https?://.+" size="35"> </div> </fieldset> <fieldset id="yourInterests"> <legend id="yourInterestsLeg">Your Interests</legend> <label for="Major" class="labelstyle">Major/Program Choice:</label> <select required id="Major" name="Major" > <option value="">Select Your Major</option> <option value="Magic1">Magic Horticulture</option> <option value="Magic2">Black Magic</option> <option value="White">White Magic</option> <option value="Blue">Blue Magic</option> <option value="Non">Non-Wizardry Studies</option> </select> </fieldset> <button type="submit" value="Submit" class="submitreset">Submit</button> <button type="reset" value="Reset" class="submitreset">Reset</button> </form> </main> <footer> &copy; 2014 Bennett Nestok </footer> </section> </body> </html> Here's the CSS. a:link { text-decoration: none !important; color:black !important; } a:visited { text-decoration: none !important; color:red !important; } a:active { text-decoration: none !important; color:green !important; } a:hover { text-decoration: none !important; color:blue !important; background-color:white !important; } ::-webkit-input-placeholder { color: #ffffff; } /* gray80 */ :-moz-placeholder { color: #ffffff; } /* Firefox 18- (one color)*/ ::-moz-placeholder { color: #ffffff; } /* Firefox 19+ (double colons) */ :-ms-input-placeholder { color: #ffffff; } body { margin: 0px auto; text-align:center; background-color:grey; font-weight:normal; font-size:12px; font-family: verdana; color:black; background-image:url('bgtexture.jpg'); background-repeat:repeat; } footer { text-align:center; margin: 0px auto; bottom:0px; position:absolute; width:100%; color:white; background-color:black; height:20px; padding-top:4px; } h1 { color:white; text-align:center; margin: 0px auto; margin-bottom:50px; width:100%; background-color:black; padding-top: 13px; padding-bottom: 14px; -moz-box-shadow: 0 1px 3px rgba(0,0,0,0.5); -webkit-box-shadow: 0 1px 3px rgba(0,0,0,0.5); text-shadow: 0 -1px 1px rgba(0,0,0,0.25); } button.submitreset { -moz-border-radius: 400px; -webkit-border-radius: 400px; border-radius: 400px; -moz-box-shadow: 0 1px 3px rgba(0,0,0,0.5); -webkit-box-shadow: 0 1px 3px rgba(0,0,0,0.5); text-shadow: 0 -1px 1px rgba(0,0,0,0.25); } .labelstyle { background-color:#a7a7a7; color:black; -moz-border-radius: 400px; -webkit-border-radius: 400px; border-radius: 400px; padding:3px 3px 3px 3px; } #aboutMe, #contactInfo, #yourInterests { margin-bottom:30px; text-align:left !important; padding: 10px 10px 10px 10px; } #Hogwarts { text-align:center; margin:0px auto; width:780px; padding-top: 20px !important; padding-bottom: 20px !important; background: -webkit-linear-gradient(#474747, grey); /* For Safari 5.1 to 6.0 */ background: -o-linear-gradient(#474747, grey); /* For Opera 11.1 to 12.0 */ background: -moz-linear-gradient(#474747, grey); /* For Firefox 3.6 to 15 */ background: linear-gradient(#474747, grey); /* Standard syntax */ border-color:black; border-style: solid; border-width: 2px; -moz-box-shadow: 0 1px 3px rgba(0,0,0,0.5); -webkit-box-shadow: 0 1px 3px rgba(0,0,0,0.5); text-shadow: 0 -1px 1px rgba(0,0,0,0.25); } @media (max-width: 800px){ .labelstyle { display: none; } #Hogwarts { width:300px; } h1 { width:304px; margin-bottom:0px; } .fieldleading { margin-bottom:0px !important; } ::-webkit-input-label { /* WebKit browsers */ color: transparent; } :-moz-label { /* Mozilla Firefox 4 to 18 */ color: transparent; } ::-moz-label { /* Mozilla Firefox 19+ */ color: transparent; } :-ms-input-label { /* Internet Explorer 10+ */ color: transparent; } ::-webkit-input-placeholder { /* WebKit browsers */ color: grey !important; } :-moz-placeholder { /* Mozilla Firefox 4 to 18 */ color: grey !important; } ::-moz-placeholder { /* Mozilla Firefox 19+ */ color: grey !important; } :-ms-input-placeholder { /* Internet Explorer 10+ */ color: grey !important; } #aboutMe, #contactInfo, #yourInterests { margin-bottom:10px; text-align:left !important; padding: 5px 5px 5px 5px; } } br { display: block; line-height: 10px; } .fieldleading { margin-bottom:10px; } legend { color:white; } #whitegender { color:white; } #moreleading { margin-bottom:10px; } /*opera only hack attempt*/ @media not all and (-webkit-min-device-pixel-ratio:0) { .fieldleading { margin-bottom:30px !important; } } .errorDisp { border-color: red; border-style: solid; border-width: 2px; }

    Read the article

  • Transaction issue in java with hibernate - latest entries not pulled from database

    - by Gearóid
    Hi, I'm having what seems to be a transactional issue in my application. I'm using Java 1.6 and Hibernate 3.2.5. My application runs a monthly process where it creates billing entries for a every user in the database based on their monthly activity. These billing entries are then used to create Monthly Bill object. The process is: Get users who have activity in the past month Create the relevant billing entries for each user Get the set of billing entries that we've just created Create a Monthly Bill based on these entries Everything works fine until Step 3 above. The Billing Entries are correctly created (I can see them in the database if I add a breakpoint after the Billing Entry creation method), but they are not pulled out of the database. As a result, an incorrect Monthly Bill is generated. If I run the code again (without clearing out the database), new Billing Entries are created and Step 3 pulls out the entries created in the first run (but not the second run). This, to me, is very confusing. My code looks like the following: for (User user : usersWithActivities) { createBillingEntriesForUser(user.getId()); userBillingEntries = getLastMonthsBillingEntriesForUser(user.getId()); createXMLBillForUser(user.getId(), userBillingEntries); } The methods called look like the following: @Transactional public void createBillingEntriesForUser(Long id) { UserManager userManager = ManagerFactory.getUserManager(); User user = userManager.getUser(id); List<AccountEvent> events = getLastMonthsAccountEventsForUser(id); BillingEntry entry = new BillingEntry(); if (null != events) { for (AccountEvent event : events) { if (event.getEventType().equals(EventType.ENABLE)) { Calendar cal = Calendar.getInstance(); Date eventDate = event.getTimestamp(); cal.setTime(eventDate); double startDate = cal.get(Calendar.DATE); double numOfDaysInMonth = cal.getActualMaximum(Calendar.DAY_OF_MONTH); double numberOfDaysInUse = numOfDaysInMonth - startDate; double fractionToCharge = numberOfDaysInUse/numOfDaysInMonth; BigDecimal amount = BigDecimal.valueOf(fractionToCharge * Prices.MONTHLY_COST); amount.scale(); entry.setAmount(amount); entry.setUser(user); entry.setTimestamp(eventDate); userManager.saveOrUpdate(entry); } } } } @Transactional public Collection<BillingEntry> getLastMonthsBillingEntriesForUser(Long id) { if (log.isDebugEnabled()) log.debug("Getting all the billing entries for last month for user with ID " + id); //String queryString = "select billingEntry from BillingEntry as billingEntry where billingEntry>=:firstOfLastMonth and billingEntry.timestamp<:firstOfCurrentMonth and billingEntry.user=:user"; String queryString = "select be from BillingEntry as be join be.user as user where user.id=:id and be.timestamp>=:firstOfLastMonth and be.timestamp<:firstOfCurrentMonth"; //This parameter will be the start of the last month ie. start of billing cycle SearchParameter firstOfLastMonth = new SearchParameter(); firstOfLastMonth.setTemporalType(TemporalType.DATE); //this parameter holds the start of the CURRENT month - ie. end of billing cycle SearchParameter firstOfCurrentMonth = new SearchParameter(); firstOfCurrentMonth.setTemporalType(TemporalType.DATE); Query query = super.entityManager.createQuery(queryString); query.setParameter("firstOfCurrentMonth", getFirstOfCurrentMonth()); query.setParameter("firstOfLastMonth", getFirstOfLastMonth()); query.setParameter("id", id); List<BillingEntry> entries = query.getResultList(); return entries; } public MonthlyBill createXMLBillForUser(Long id, Collection<BillingEntry> billingEntries) { BillingHistoryManager manager = ManagerFactory.getBillingHistoryManager(); UserManager userManager = ManagerFactory.getUserManager(); MonthlyBill mb = new MonthlyBill(); User user = userManager.getUser(id); mb.setUser(user); mb.setTimestamp(new Date()); Set<BillingEntry> entries = new HashSet<BillingEntry>(); entries.addAll(billingEntries); String xml = createXmlForMonthlyBill(user, entries); mb.setXmlBill(xml); mb.setBillingEntries(entries); MonthlyBill bill = (MonthlyBill) manager.saveOrUpdate(mb); return bill; } Help with this issue would be greatly appreciated as its been wracking my brain for weeks now! Thanks in advance, Gearoid.

    Read the article

  • Cannot see the variable In my own JQuery plugin's function.

    - by qinHaiXiang
    I am writing one of my own JQuery plugin. And I got some strange which make me confused. I am using JQuery UI datepicker with my plugin. ;(function($){ var newMW = 1, mwZIndex = 0; // IgtoMW contructor Igtomw = function(elem , options){ var activePanel, lastPanel, daysWithRecords, sliding; // used to check the animation below is executed to the end. // used to access the plugin's default configuration this.opts = $.extend({}, $.fn.igtomw.defaults, options); // intial the model window this.intialMW(); }; $.extend(Igtomw.prototype, { // intial model window intialMW : function(){ this.sliding = false; //this.daysWithRecords = []; this.igtoMW = $('<div />',{'id':'igto'+newMW,'class':'igtoMW',}) .css({'z-index':mwZIndex}) // make it in front of all exist model window; .appendTo('body') .draggable({ containment: 'parent' , handle: '.dragHandle' , distance: 5 }); //var igtoWrapper = igtoMW.append($('<div />',{'class':'igtoWrapper'})); this.igtoWrapper = $('<div />',{'class':'igtoWrapper'}).appendTo(this.igtoMW); this.igtoOpacityBody = $('<div />',{'class':'igtoOpacityBody'}).appendTo(this.igtoMW); //var igtoHeaderInfo = igtoWrapper.append($('<div />',{'class':'igtoHeaderInfo dragHandle'})); this.igtoHeaderInfo = $('<div />',{'class':'igtoHeaderInfo dragHandle'}) .appendTo(this.igtoWrapper); this.igtoQuickNavigation = $('<div />',{'class':'igtoQuickNavigation'}) .css({'color':'#fff'}) .appendTo(this.igtoWrapper); this.igtoContentSlider = $('<div />',{'class':'igtoContentSlider'}) .appendTo(this.igtoWrapper); this.igtoQuickMenu = $('<div />',{'class':'igtoQuickMenu'}) .appendTo(this.igtoWrapper); this.igtoFooter = $('<div />',{'class':'igtoFooter dragHandle'}) .appendTo(this.igtoWrapper); // append to igtoHeaderInfo this.headTitle = this.igtoHeaderInfo.append($('<div />',{'class':'headTitle'})); // append to igtoQuickNavigation this.igQuickNav = $('<div />', {'class':'igQuickNav'}) .html('??') .appendTo(this.igtoQuickNavigation); // append to igtoContentSlider this.igInnerPanelTopMenu = $('<div />',{'class':'igInnerPanelTopMenu'}) .appendTo(this.igtoContentSlider); this.igInnerPanelTopMenu.append('<div class="igInnerPanelButtonPreWrapper"><a href="" class="igInnerPanelButton Pre" action="" style="background-image:url(images/igto/igInnerPanelTopMenu.bt.bg.png);"></a></div>'); this.igInnerPanelTopMenu.append('<div class="igInnerPanelSearch"><input type="text" name="igInnerSearch" /><a href="" class="igInnerSearch">??</a></div>' ); this.igInnerPanelTopMenu.append('<div class="igInnerPanelButtonNextWrapper"><a href="" class="igInnerPanelButton Next" action="sm" style="background-image:url(images/igto/igInnerPanelTopMenu.bt.bg.png); background-position:-272px"></a></div>' ); this.igInnerPanelBottomMenu = $('<div />',{'class':'igInnerPanelBottomMenu'}) .appendTo(this.igtoContentSlider); this.icWrapper = $('<div />',{'class':'icWrapper','id':'igto'+newMW+'Panel'}) .appendTo(this.igtoContentSlider); this.icWrapperCotentPre = $('<div class="slider pre"></div>').appendTo(this.icWrapper); this.icWrapperCotentShow = $('<div class="slider firstShow "></div>').appendTo(this.icWrapper); this.icWrapperCotentnext = $('<div class="slider next"></div>').appendTo(this.icWrapper); this.initialPanel(); this.initialQuickMenus(); console.log(this.leftPad(9)); newMW++; mwZIndex++; this.igtoMW.bind('mousedown',function(){ var $this = $(this); //alert($this.css('z-index') + ' '+mwZIndex); if( parseInt($this.css('z-index')) === (mwZIndex-1) ) return; $this.css({'z-index':mwZIndex}); mwZIndex++; //alert(mwZIndex); }); }, initialPanel : function(){ this.defaultPanelNum = this.opts.initialPanel; this.activePanel = this.defaultPanelNum; this.lastPanel = this.defaultPanelNum; this.defaultPanel = this.loadPanelContents(this.defaultPanelNum); $(this.defaultPanel).appendTo(this.icWrapperCotentShow); }, initialQuickMenus : function(){ // store the current element var obj = this; var defaultQM = this.opts.initialQuickMenu; var strMenu = ''; var marginFirstEle = '8'; $.each(defaultQM,function(key,value){ //alert(key+':'+value); if(marginFirstEle === '8'){ strMenu += '<a href="" class="btPanel" panel="'+key+'" style="margin-left: 8px;" >'+value+'</a>'; marginFirstEle = '4'; } else{ strMenu += '<a href="" class="btPanel" panel="'+key+'" style="margin-left: 4px;" >'+value+'</a>'; } }); // append to igtoQuickMenu this.igtoQMenu = $(strMenu).appendTo(this.igtoQuickMenu); this.igtoQMenu.bind('click',function(event){ event.preventDefault(); var element = $(this); if(element.is('.active')){ return; } else{ $(obj.igtoQMenu).removeClass('active'); element.addClass('active'); } var d = new Date(); var year = d.getFullYear(); var month = obj.leftPad( d.getMonth() ); var inst = null; if( obj.sliding === false){ console.log(obj.lastPanel); var currentPanelNum = parseInt(element.attr('panel')); obj.checkAvailability(); obj.getDays(year,month,inst,currentPanelNum); obj.slidePanel(currentPanelNum); obj.activePanel = currentPanelNum; console.log(obj.activePanel); obj.lastPanel = obj.activePanel; obj.icWrapper.find('input').val(obj.activePanel); } }); }, initialLoginPanel : function(){ var obj = this; this.igPanelLogin = $('<div />',{'class':"igPanelLogin"}); this.igEnterName = $('<div />',{'class':"igEnterName"}).appendTo(this.igPanelLogin); this.igInput = $('<input type="text" name="name" value="???" />').appendTo(this.igEnterName); this.igtoLoginBtWrap = $('<div />',{'class':"igButtons"}).appendTo(this.igPanelLogin); this.igtoLoginBt = $('<a href="" class="igtoLoginBt" action="OK" >??</a>\ <a href="" class="igtoLoginBt" action="CANCEL" >??</a>\ <a href="" class="igtoLoginBt" action="ADD" >????</a>').appendTo(this.igtoLoginBtWrap); this.igtoLoginBt.bind('click',function(event){ event.preventDefault(); var elem = $(this); var action = elem.attr('action'); var userName = obj.igInput.val(); obj.loadRootMenu(); }); return this.igPanelLogin; }, initialWatchHistory : function(){ var obj = this; // for thirt part plugin used if(this.sliding === false){ this.watchHistory = $('<div />',{'class':'igInnerPanelSlider'}).append($('<div />',{'class':'igInnerPanel_pre'}).addClass('igInnerPanel')) .append($('<div />',{'class':'igInnerPanel'}).datepicker({ dateFormat: 'yy-mm-dd',defaultDate: '2010-12-01' ,showWeek: true,firstDay: 1, //beforeShow:setDateStatistics(), onChangeMonthYear:function(year, month, inst) { var panelNum = 1; month = obj.leftPad(month); obj.getDays(year,month,inst,panelNum); } , beforeShowDay: obj.checkAvailability, onSelect: function(dateText, inst) { obj.checkAvailability(); } }).append($('<div />',{'class':'extraMenu'})) ) .append($('<div />',{'class':'igInnerPanel_next'}).addClass('igInnerPanel')); return this.watchHistory; } }, loadPanelContents : function(panelNum){ switch(panelNum){ case 1: alert('inside loadPanelContents') return this.initialWatchHistory(); break; case 2: return this.initialWatchHistory(); break; case 3: return this.initialWatchHistory(); break; case 4: return this.initialWatchHistory(); break; case 5: return this.initialLoginPanel(); break; } }, loadRootMenu : function(){ var obj = this; var mainMenuPanel = $('<div />',{'class':'igRootMenu'}); var currentMWId = this.igtoMW.attr('id'); this.activePanel = 0; $('#'+currentMWId+'Panel .pre'). queue(function(next){ $(this). html(mainMenuPanel). addClass('panelShow'). removeClass('pre'). attr('panelNum',0); next(); }). queue(function(next){ $('<div style="width:0;" class="slider pre"></div>'). prependTo('#'+currentMWId+'Panel').animate({width:348}, function(){ $('#'+currentMWId+'Panel .slider:last').remove() $('#'+currentMWId+'Panel .slider:last').replaceWith('<div class="slider next"></div>'); $('.btMenu').remove(); // remove bottom quick menu obj.sliding = false; $(this).removeAttr('style'); }); $('.igtoQuickMenu .active').removeClass('active'); next(); }); }, slidePanel : function(currentPanelNum){ var currentMWId = this.igtoMW.attr('id'); var obj = this; //alert(obj.loadPanelContents(currentPanelNum)); if( this.activePanel > currentPanelNum){ $('#'+currentMWId+'Panel .pre'). queue(function(next){ alert('inside slidePanel') //var initialDate = getPanelDateStatus(panelNum); //console.log('intial day in bigger panel '+initialDate) $(this). html(obj.loadPanelContents(currentPanelNum)). addClass('panelShow'). removeClass('pre'). attr('panelNum',currentPanelNum); $('#'+currentMWId+'Panel .next').remove(); next(); }). queue(function(next){ $('<div style="width:0;" class="slider pre"></div>'). prependTo('#'+currentMWId+'Panel').animate({width:348}, function(){ //$('#igto1Panel .slider:last').find(setPanel(currentPanelNum)).datepicker('destroy'); $('#'+currentMWId+'Panel .slider:last').empty().removeClass('panelShow').addClass('next').removeAttr('panelNum'); $('#'+currentMWId+'Panel .slider:last').replaceWith('<div class="slider next"></div>') obj.sliding = false;console.log('inuse inside animation: '+obj.sliding); $(this).removeAttr('style'); }); next(); }); } else{ ///// current panel num smaller than next $('#'+currentMWId+'Panel .next'). queue(function(next){ $(this). html(obj.loadPanelContents(currentPanelNum)). addClass('panelShow'). removeClass('next'). attr('panelNum',currentPanelNum); $('<div class="slider next">empty</div>').appendTo('#'+currentMWId+'Panel'); next(); }). queue(function(next){ $('#'+currentMWId+'Panel .pre').animate({width:0}, function(){ $(this).remove(); //$('#igto1Panel .slider:first').find(setPanel(currentPanelNum)).datepicker('destroy'); $('#'+currentMWId+'Panel .slider:first').empty().removeClass('panelShow').addClass('pre').removeAttr('panelNum').removeAttr('style'); $('#'+currentMWId+'Panel .slider:first').replaceWith('<div class="slider pre"></div>') obj.sliding = false; console.log('inuse inside animation: '+obj.sliding); }); next(); }); } }, getDays : function(year,month,inst,panelNum){ var obj = this; // depand on the mysql qurey condition var table_of_record = 'moviewh';//getTable(panelNum); var date_of_record = 'watching_date';//getTableDateCol(panelNum); var date_to_find = year+'-'+month; var node_of_xml_date_list = 'whDateRecords';//getXMLDateNode(panelNum); var user_id = '1';//getLoginUserId(); //var daysWithRecords = []; // empty array before asigning this.daysWithRecords.length = 0; $.ajax({ type: "GET", url: "include/get.date.list.process.php", data:({ table_of_record : table_of_record,date_of_record:date_of_record,date_to_find:date_to_find,user_id:user_id,node_of_xml_date_list:node_of_xml_date_list }), dataType: "json", cache: false, // force broser don't cache the xml file async: false, // using this option to prevent datepicker refresh ??NO success:function(data){ // had no date records if(data === null) return; obj.daysWithRecords = data; } }); //setPanelDateStatus(year,month,panelNum); console.log('call from getdays() ' + this.daysWithRecords); }, checkAvailability : function(availableDays) { // var i; var checkdate = $.datepicker.formatDate('yy-mm-dd', availableDays); //console.log( checkdate); // for(var i = 0; i < this.daysWithRecords.length; i++) { // // if(this.daysWithRecords[i] == checkdate){ // // return [true, "available"]; // } // } //console.log('inside check availablility '+ this.daysWithRecords); //return [true, "available"]; console.log(typeof this.daysWithRecords) for(i in this.daysWithRecords){ //if(this.daysWithRecords[i] == checkdate){ console.log(typeof this.daysWithRecords[i]); //return [true, "available"]; //} } return [true, "available"]; //return [false, ""]; }, leftPad : function(num) { return (num < 10) ? '0' + num : num; } }); $.fn.igtomw = function(options){ // Merge options passed in with global defaults var opt = $.extend({}, $.fn.igtomw.defaults , options); return this.each(function() { new Igtomw(this,opt); }); }; $.fn.igtomw.defaults = { // 0:mainMenu 1:whatchHistor 2:requestHistory 3:userManager // 4:shoppingCart 5:loginPanel initialPanel : 5, // default panel is LoginPanel initialQuickMenu : {'1':'whatchHIstory','2':'????','3':'????','4':'????'} // defalut quick menu }; })(jQuery); usage: $('.openMW').click(function(event){ event.preventDefault(); $('<div class="">').igtomw(); }) HTML code: <div id="taskBarAndStartMenu"> <div class="taskBarAndStartMenuM"> <a href="" class="openMW" >??IGTO</a> </div> <div class="taskBarAndStartMenuO"></div> </div> In my work flow: when I click the "whatchHistory" button, my plugin would load a panel with JQuery UI datepicker applied which days had been set to be availabled or not. I am using the function "getDays()" to get the available days list and stored the data inside daysWithRecords, and final the UI datepicker's function "beforeShowDay()" called the function "checkAvailability()" to set the days. the variable "daysWithRecords" was declared inside Igtomw = function(elem , options) and was initialized inside the function getDays() I am using the function "initialWatchHistory()" to initialization and render the JQuery UI datepicker in the web. My problem is the function "checkAvailability()" cannot see the variable "daysWithRecords".The firebug prompts me that "daysWithRecords" is "undefined". this is the first time I write my first plugin. So .... Thank you very much for any help!!

    Read the article

  • if isset PHP not working?

    - by Ellie
    Okay, Im trying to set a captcha up, However with this code in, it breaks. if(isset($_POST["captcha"])) if($_SESSION["captcha"]==$_POST["captcha"]) When i do it with out it, the page works, but the captcha is letting incorrect submits through. Parse error: syntax error, unexpected '"', expecting T_STRING or T_VARIABLE or T_NUM_STRING in /hermes/waloraweb085/b2027/moo.lutarinet/jointest.php on line 71 <?php $pagetitle = "Home"; $checkrank = 0; include ($_SERVER['DOCUMENT_ROOT'].'/header.inc.php'); ECHO <<<END <br><br> <b><center><i><u>DO NOT</u> USE YOUR NEOPETS PASSWORD OR PIN NUMBER!!!</b></i></center> <p> ?> <?php session_start() ?> <center><P><FORM ACTION="join.pro.php" enctype="multipart/form-data" METHOD=POST> <table width="393" height="188" border="0" cellpadding="0" cellspacing="0"> <td width="150">Username</td> <td width="243"><input type=text name="name" value="" size=32 maxlength=15></td> </tr> <tr> <td>Password</td> <td><input type=password name="pass1" VALUE="" maxlength=15></td> </tr> <tr> <td>Confirm Password</td> <td><input type=password name="pass2" VALUE="" size=32 maxlength=15></td> </tr> <tr> <td>Security Code (4 Diget Number)</td> <td><input type=password name="security" VALUE="" size=32 maxlength=4></td> </tr> <tr> <td>Email Address</td> <td><INPUT TYPE=text NAME="email" VALUE="" SIZE=32 maxlength=100></td> </tr> <tr> <td height="41" colspan="2" valign="middle"><p><p><center> By registering an account here you agree to all of our <A HREF="$baseurl/tos.php">Terms and Conditions</A>. You can also view our <A HREF="$baseurl/privacy.php">Privacy Policy</A>. </center></p></td> </tr> <tr><td align="center">CAPTCHA:<br> (antispam code, 3 black symbols)<br> <table><tr><td><img src="captcha.php" alt="captcha image"></td><td><input type="text" name="captcha" size="3" maxlength="3"></td></tr></table> </td></tr> <td height="27" colspan="2" valign="middle"> <center><input type=submit name=Submit value="Register"></center> </td> </table> </form> <?php if(isset($_POST["captcha"])) if($_SESSION["captcha"]==$_POST["captcha"]) { //CAPTHCA is valid; proceed the message: save to database, send by e-mail ... echo 'CAPTHCA is valid; proceed the message'; } else { echo 'CAPTHCA is not valid; ignore submission'; } ?> <?php END; include ($_SERVER['DOCUMENT_ROOT'].'/footer.inc.php'); ?> captcha.php <?php session_start(); header("Expires: Mon, 26 Jul 1997 05:00:00 GMT"); header("Last-Modified: " . gmdate("D, d M Y H:i:s") . " GMT"); header("Cache-Control: no-store, no-cache, must-revalidate"); header("Cache-Control: post-check=0, pre-check=0", false); header("Pragma: no-cache"); function _generateRandom($length=6) { $_rand_src = array( array(48,57) //digits , array(97,122) //lowercase chars // , array(65,90) //uppercase chars ); srand ((double) microtime() * 1000000); $random_string = ""; for($i=0;$i<$length;$i++){ $i1=rand(0,sizeof($_rand_src)-1); $random_string .= chr(rand($_rand_src[$i1][0],$_rand_src[$i1][1])); } return $random_string; } $im = @imagecreatefromjpeg("http://sketchedneo.com/images/sitedesigns/captcha.jpg"); $rand = _generateRandom(3); $_SESSION['captcha'] = $rand; ImageString($im, 5, 2, 2, $rand[0]." ".$rand[1]." ".$rand[2]." ", ImageColorAllocate ($im, 0, 0, 0)); $rand = _generateRandom(3); ImageString($im, 5, 2, 2, " ".$rand[0]." ".$rand[1]." ".$rand[2], ImageColorAllocate ($im, 255, 0, 0)); Header ('Content-type: image/jpeg'); imagejpeg($im,NULL,100); ImageDestroy($im); ?> Help please anyone? Line 71: if(isset($_POST["captcha"])) Line 72: if($_SESSION["captcha"]==$_POST["captcha"])

    Read the article

  • Hibernate without primary keys generated by db?

    - by Michael Jones
    I'm building a data warehouse and want to use InfiniDB as the storage engine. However, it doesn't allow primary keys or foreign key constraints (or any constraints for that matter). Hibernate complains "The database returned no natively generated identity value" when I perform an insert. Each table is relational, and contains a unique integer column that was previously used as the primary key - I want to keep that, but just not have the constraint in the db that the column is the primary key. I'm assuming the problem is that Hibernate expects the db to return a generated key. Is it possible to override this behaviour so I can set the primary key field's value myself and keep Hibernate happy? -- edit -- Two of the mappings are as follows: <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <!-- Generated Jun 1, 2010 2:49:51 PM by Hibernate Tools 3.2.1.GA --> <hibernate-mapping> <class name="com.example.project.Visitor" table="visitor" catalog="orwell"> <id name="id" type="java.lang.Long"> <column name="id" /> <generator class="identity" /> </id> <property name="firstSeen" type="timestamp"> <column name="first_seen" length="19" /> </property> <property name="lastSeen" type="timestamp"> <column name="last_seen" length="19" /> </property> <property name="sessionId" type="string"> <column name="session_id" length="26" unique="true" /> </property> <property name="userId" type="java.lang.Long"> <column name="user_id" /> </property> <set name="visits" inverse="true"> <key> <column name="visitor_id" /> </key> <one-to-many class="com.example.project.Visit" /> </set> </class> </hibernate-mapping> and: <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <!-- Generated Jun 1, 2010 2:49:51 PM by Hibernate Tools 3.2.1.GA --> <hibernate-mapping> <class name="com.example.project.Visit" table="visit" catalog="orwell"> <id name="id" type="java.lang.Long"> <column name="id" /> <generator class="identity" /> </id> <many-to-one name="visitor" class="com.example.project.Visitor" fetch="join" cascade="all"> <column name="visitor_id" /> </many-to-one> <property name="visitId" type="string"> <column name="visit_id" length="20" unique="true" /> </property> <property name="startTime" type="timestamp"> <column name="start_time" length="19" /> </property> <property name="endTime" type="timestamp"> <column name="end_time" length="19" /> </property> <property name="userAgent" type="string"> <column name="user_agent" length="65535" /> </property> <set name="pageViews" inverse="true"> <key> <column name="visit_id" /> </key> <one-to-many class="com.example.project.PageView" /> </set> </class> </hibernate-mapping>

    Read the article

  • Using C# to detect whether a filename character is considered international

    - by Morten Mertner
    I've written a small console application (source below) to locate and optionally rename files containing international characters, as they are a source of constant pain with most source control systems (some background on this below). The code I'm using has a simple dictionary with characters to look for and replace (and nukes every other character that uses more than one byte of storage), but it feels very hackish. What's the right way to (a) find out whether a character is international? and (b) what the best ASCII substitution character would be? Let me provide some background information on why this is needed. It so happens that the danish Å character has two different encodings in UTF-8, both representing the same symbol. These are known as NFC and NFD encodings. Windows and Linux will create NFC encoding by default but respect whatever encoding it is given. Mac will convert all names (when saving to a HFS+ partition) to NFD and therefore returns a different byte stream for the name of a file created on Windows. This effectively breaks Subversion, Git and lots of other utilities that don't care to properly handle this scenario. I'm currently evaluating Mercurial, which turns out to be even worse at handling international characters.. being fairly tired of these problems, either source control or the international character would have to go, and so here we are. My current implementation: public class Checker { private Dictionary<char, string> internationals = new Dictionary<char, string>(); private List<char> keep = new List<char>(); private List<char> seen = new List<char>(); public Checker() { internationals.Add( 'æ', "ae" ); internationals.Add( 'ø', "oe" ); internationals.Add( 'å', "aa" ); internationals.Add( 'Æ', "Ae" ); internationals.Add( 'Ø', "Oe" ); internationals.Add( 'Å', "Aa" ); internationals.Add( 'ö', "o" ); internationals.Add( 'ü', "u" ); internationals.Add( 'ä', "a" ); internationals.Add( 'é', "e" ); internationals.Add( 'è', "e" ); internationals.Add( 'ê', "e" ); internationals.Add( '¦', "" ); internationals.Add( 'Ã', "" ); internationals.Add( '©', "" ); internationals.Add( ' ', "" ); internationals.Add( '§', "" ); internationals.Add( '¡', "" ); internationals.Add( '³', "" ); internationals.Add( '­', "" ); internationals.Add( 'º', "" ); internationals.Add( '«', "-" ); internationals.Add( '»', "-" ); internationals.Add( '´', "'" ); internationals.Add( '`', "'" ); internationals.Add( '"', "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 147 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 148 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 153 } )[ 0 ], "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 166 } )[ 0 ], "." ); keep.Add( '-' ); keep.Add( '=' ); keep.Add( '\'' ); keep.Add( '.' ); } public bool IsInternationalCharacter( char c ) { var s = c.ToString(); byte[] bytes = Encoding.UTF8.GetBytes( s ); if( bytes.Length > 1 && ! internationals.ContainsKey( c ) && ! seen.Contains( c ) ) { Console.WriteLine( "X '{0}' ({1})", c, string.Join( ",", bytes ) ); seen.Add( c ); if( ! keep.Contains( c ) ) { internationals[ c ] = ""; } } return internationals.ContainsKey( c ); } public bool HasInternationalCharactersInName( string name, out string safeName ) { StringBuilder sb = new StringBuilder(); Array.ForEach( name.ToCharArray(), c => sb.Append( IsInternationalCharacter( c ) ? internationals[ c ] : c.ToString() ) ); int length = sb.Length; sb.Replace( " ", " " ); while( sb.Length != length ) { sb.Replace( " ", " " ); } safeName = sb.ToString().Trim(); string namePart = Path.GetFileNameWithoutExtension( safeName ); if( namePart.EndsWith( "." ) ) safeName = namePart.Substring( 0, namePart.Length - 1 ) + Path.GetExtension( safeName ); return name != safeName; } } And this would be invoked like this: FileInfo file = new File( "Århus.txt" ); string safeName; if( checker.HasInternationalCharactersInName( file.Name, out safeName ) ) { // rename file }

    Read the article

  • incrementing in php

    - by Michael Stevens
    I have a function that works on other pages but on this particular page its not working 100% the piece of code that is failing to work is: $query = "SELECT * FROM rank_punting JOIN rank_player ON rank_player.full_name=rank_punting.name WHERE active='1' AND class='$class' ORDER BY ABS(`rank_punting`.`rank_final`) ASC"; $rank = 0; $lastpct = 0; $db->setQuery($query); $result = $db->query(); if(mysql_num_rows($result) > 0) { while($row = mysql_fetch_array($result, MYSQL_ASSOC)) { if ($row['rank_final'] > $lastpct) { $rank++; $lastpct = $row['rank_final']; } $name = $row['name']; $s1= $row['s1']; $s2= $row['s2']; $s3= $row['s3']; $s4= $row['s4']; $s5= $row['s5']; $s6= $row['s6']; $s7= $row['s7']; $s8= $row['s8']; $s9= $row['s9']; $c1= $row['c1']; $c2= $row['c2']; $c3= $row['c3']; $c4= $row['c4']; $c5= $row['c5']; $c6= $row['c6']; $v1= $row['v1']; $v2= $row['v2']; $comp= $row['comp_rank_final']; $season= $row['season_rank_final']; $final=$row['rank_final']; $link = "website_url"; $link2 = "<a href=\"http://{$link}\" target='_blank'>{$name}<br>Profile Page</a>"; if ($link = ''){$link2 = "<a href='index.php?option=com_ranking&view=playerprofile&player={$name}' >{$name}<br>Profile Page</a>";} echo '<tr>'; echo " <th scope'row'>{$link2} {$lastpct} </th>"; echo "<td>"; echo 'DEBUG: '; echo $row['rank_final']; echo $lastpct;echo "{$rank}</td>"; echo "<td> Competition</td>"; echo "<td> {$comp}</td>"; echo "<td> {$c1}</td>"; echo "<td> {$c2}</td>"; echo "<td> {$c3}</td>"; echo "<td> {$c4}</td>"; echo "<td> {$c5}</td>"; echo "<td> {$c6}</td>"; echo "<td> {$c7}</td>"; echo "<td> {$c8}</td>"; echo "<td> {$v2}</td>"; echo "</tr>"; echo '<tr>'; echo "<th scope'row'> </th>"; echo "<td> </td>"; echo "<td> Game Film</td>"; echo "<td> {$season}</td>"; echo "<td> {$s1}</td>"; echo "<td> {$s2}</td>"; echo "<td> {$s3}</td>"; echo "<td> {$s4}</td>"; echo "<td> {$s5}</td>"; echo "<td> {$s7}</td>"; echo "<td> {$s8}</td>"; echo "<td> {$s6}</td>"; echo "<td> {$v1}</td>"; echo "</tr>"; } } //---------------- echo '</tbody> </table>'; }

    Read the article

  • How do you overide a class that is called by another class with parent::method

    - by dan.codes
    I am trying to extend Mage_Catalog_Block_Product_View I have it setup in my local directory as its own module and everything works fine, I wasn't getting the results that I wanted. I then saw that another class extended that class as well. The method I am trying to override is the protected function _prepareLayout() This is the function class Mage_Review_Block_Product_View extends Mage_Catalog_Block_Product_View protected function _prepareLayout() { $this-&gt;getLayout()-&gt;createBlock('catalog/breadcrumbs'); $headBlock = $this-&gt;getLayout()-&gt;getBlock('head'); if ($headBlock) { $title = $this-&gt;getProduct()-&gt;getMetaTitle(); if ($title) { $headBlock-&gt;setTitle($title); } $keyword = $this-&gt;getProduct()-&gt;getMetaKeyword(); $currentCategory = Mage::registry('current_category'); if ($keyword) { $headBlock-&gt;setKeywords($keyword); } elseif($currentCategory) { $headBlock-&gt;setKeywords($this-&gt;getProduct()-&gt;getName()); } $description = $this-&gt;getProduct()-&gt;getMetaDescription(); if ($description) { $headBlock-&gt;setDescription( ($description) ); } else { $headBlock-&gt;setDescription( $this-&gt;getProduct()-&gt;getDescription() ); } } return parent::_prepareLayout(); } I am trying to modify it just a bit with the following, keep in mind I know there is a title prefix and suffix but I needed it only for the product page and also I needed to add text to the description. class MyCompany_Catalog_Block_Product_View extends Mage_Catalog_Block_Product_View protected function _prepareLayout() { $storeId = Mage::app()-&gt;getStore()-&gt;getId(); $this-&gt;getLayout()-&gt;createBlock('catalog/breadcrumbs'); $headBlock = $this-&gt;getLayout()-&gt;getBlock('head'); if ($headBlock) { $title = $this-&gt;getProduct()-&gt;getMetaTitle(); if ($title) { if($storeId == 2){ $title = "Pool Supplies Fast - " .$title; $headBlock-&gt;setTitle($title); } $headBlock-&gt;setTitle($title); }else{ $path = Mage::helper('catalog')-&gt;getBreadcrumbPath(); foreach ($path as $name =&gt; $breadcrumb) { $title[] = $breadcrumb['label']; } $newTitle = "Pool Supplies Fast - " . join($this-&gt;getTitleSeparator(), array_reverse($title)); $headBlock-&gt;setTitle($newTitle); } $keyword = $this-&gt;getProduct()-&gt;getMetaKeyword(); $currentCategory = Mage::registry('current_category'); if ($keyword) { $headBlock-&gt;setKeywords($keyword); } elseif($currentCategory) { $headBlock-&gt;setKeywords($this-&gt;getProduct()-&gt;getName()); } $description = $this-&gt;getProduct()-&gt;getMetaDescription(); if ($description) { if($storeId == 2){ $description = "Pool Supplies Fast - ". $this-&gt;getProduct()-&gt;getName() . " - " . $description; $headBlock-&gt;setDescription( ($description) ); }else{ $headBlock-&gt;setDescription( ($description) ); } } else { if($storeId == 2){ $description = "Pool Supplies Fast: ". $this-&gt;getProduct()-&gt;getName() . " - " . $this-&gt;getProduct()-&gt;getDescription(); $headBlock-&gt;setDescription( ($description) ); }else{ $headBlock-&gt;setDescription( $this-&gt;getProduct()-&gt;getDescription() ); } } } return Mage_Catalog_Block_Product_Abstract::_prepareLayout(); } This executs fine but then I notice that the following class Mage_Review_Block_Product_View_List extends which extends Mage_Review_Block_Product_View and that extends Mage_Catalog_Block_Product_View as well. Inside this class they call the _prepareLayout as well and call the parent with parent::_prepareLayout() class Mage_Review_Block_Product_View_List extends Mage_Review_Block_Product_View protected function _prepareLayout() { parent::_prepareLayout(); if ($toolbar = $this-&gt;getLayout()-&gt;getBlock('product_review_list.toolbar')) { $toolbar-&gt;setCollection($this-&gt;getReviewsCollection()); $this-&gt;setChild('toolbar', $toolbar); } return $this; } So obviously this just calls the same class I am extending and runs the function I am overiding but it doesn't get to my class because it is not in my class hierarchy and since it gets called after my class all the stuff in the parent class override what I have set. I'm not sure about the best way to extend this type of class and method, there has to be a good way to do this, I keep finding I am running into issues when trying to overide these prepare methods that are derived from the abstract classes, there seems to be so many classes overriding them and calling parent::method. What is the best way to override these functions?

    Read the article

  • files get uploaded just before they get cancelled

    - by user1763986
    Got a little situation here where I am trying to cancel a file's upload. What I have done is stated that if the user clicks on the "Cancel" button, then it will simply remove the iframe so that it does not go to the page where it uploads the files into the server and inserts data into the database. Now this works fine if the user clicks on the "Cancel" button in quickish time the problem I have realised though is that if the user clicks on the "Cancel" button very late, it sometimes doesn't remove the iframe in time meaning that the file has just been uploaded just before the user has clicked on the "Cancel" button. So my question is that is there a way that if the file does somehow get uploaded before the user clicks on the "Cancel" button, that it deletes the data in the database and removes the file from the server? Below is the image upload form: <form action="imageupload.php" method="post" enctype="multipart/form-data" target="upload_target_image" onsubmit="return imageClickHandler(this);" class="imageuploadform" > <p class="imagef1_upload_process" align="center"> Loading...<br/> <img src="Images/loader.gif" /> </p> <p class="imagef1_upload_form" align="center"> <br/> <span class="imagemsg"></span> <label>Image File: <input name="fileImage" type="file" class="fileImage" /></label><br/> <br/> <label class="imagelbl"><input type="submit" name="submitImageBtn" class="sbtnimage" value="Upload" /></label> </p> <p class="imagef1_cancel" align="center"> <input type="reset" name="imageCancel" class="imageCancel" value="Cancel" /> </p> <iframe class="upload_target_image" name="upload_target_image" src="#" style="width:0px;height:0px;border:0px;solid;#fff;"></iframe> </form> Below is the jquery function which controls the "Cancel" button: $(imageuploadform).find(".imageCancel").on("click", function(event) { $('.upload_target_image').get(0).contentwindow $("iframe[name='upload_target_image']").attr("src", "javascript:'<html></html>'"); return stopImageUpload(2); }); Below is the php code where it uploads the files and inserts the data into the database. The form above posts to this php page "imageupload.php": <body> <?php include('connect.php'); session_start(); $result = 0; //uploads file move_uploaded_file($_FILES["fileImage"]["tmp_name"], "ImageFiles/" . $_FILES["fileImage"]["name"]); $result = 1; //set up the INSERT SQL query command to insert the name of the image file into the "Image" Table $imagesql = "INSERT INTO Image (ImageFile) VALUES (?)"; //prepare the above SQL statement if (!$insert = $mysqli->prepare($imagesql)) { // Handle errors with prepare operation here } //bind the parameters (these are the values that will be inserted) $insert->bind_param("s",$img); //Assign the variable of the name of the file uploaded $img = 'ImageFiles/'.$_FILES['fileImage']['name']; //execute INSERT query $insert->execute(); if ($insert->errno) { // Handle query error here } //close INSERT query $insert->close(); //Retrieve the ImageId of the last uploded file $lastID = $mysqli->insert_id; //Insert into Image_Question Table (be using last retrieved Image id in order to do this) $imagequestionsql = "INSERT INTO Image_Question (ImageId, SessionId, QuestionId) VALUES (?, ?, ?)"; //prepare the above SQL statement if (!$insertimagequestion = $mysqli->prepare($imagequestionsql)) { // Handle errors with prepare operation here echo "Prepare statement err imagequestion"; } //Retrieve the question number $qnum = (int)$_POST['numimage']; //bind the parameters (these are the values that will be inserted) $insertimagequestion->bind_param("isi",$lastID, 'Exam', $qnum); //execute INSERT query $insertimagequestion->execute(); if ($insertimagequestion->errno) { // Handle query error here } //close INSERT query $insertimagequestion->close(); ?> <!--Javascript which will output the message depending on the status of the upload (successful, failed or cancelled)--> <script> window.top.stopImageUpload(<?php echo $result; ?>, '<?php echo $_FILES['fileImage']['name'] ?>'); </script> </body> UPDATE: Below is the php code "cancelimage.php" where I want to delete the cancelled file from the server and delete the record from the database. It is set up but not finished, can somebody finish it off so I can retrieve the name of the file and it's id using $_SESSION? <?php // connect to the database include('connect.php'); /* check connection */ if (mysqli_connect_errno()) { printf("Connect failed: %s\n", mysqli_connect_error()); die(); } //remove file from server unlink("ImageFiles/...."); //need to retrieve file name here where the ... line is //DELETE query statement where it will delete cancelled file from both Image and Image Question Table $imagedeletesql = " DELETE img, img_q FROM Image AS img LEFT JOIN Image_Question AS img_q ON img_q.ImageId = img.ImageId WHERE img.ImageFile = ?"; //prepare delete query if (!$delete = $mysqli->prepare($imagedeletesql)) { // Handle errors with prepare operation here } //Dont pass data directly to bind_param store it in a variable $delete->bind_param("s",$img); //execute DELETE query $delete->execute(); if ($delete->errno) { // Handle query error here } //close query $delete->close(); ?> Can you please provide an sample code in your answer to make it easier for me. Thank you

    Read the article

  • Can't change text color in Microsoft Word 2010

    - by Wesley
    I have Microsoft Office 2010 32-bit running on Windows 7 32-bit. When text is highlighted and a color is selected from the mini-toolbar or the ribbon, the text does not change color. If I change the color for multiple words, and select a different color for each word, the toolbar and ribbon will reflect each of the different colors that I chose, however it is not displayed in the document. So it appears that Word is aware of the text color and not as if it is simply not applying the change. What may be causing this inability to view text colors and how might I fix it? My only troubleshooting attempt so far has been to perform a repair installation of Office. EDIT 1 I created a document, typed a word, selected it and changed the color. I then saved the document as HTML. The text did not change color. This is the HTML in the document: <html xmlns:v="urn:schemas-microsoft-com:vml" xmlns:o="urn:schemas-microsoft-com:office:office" xmlns:w="urn:schemas-microsoft-com:office:word" xmlns:m="http://schemas.microsoft.com/office/2004/12/omml" xmlns="http://www.w3.org/TR/REC-html40"> <head> <meta http-equiv=Content-Type content="text/html; charset=windows-1252"> <meta name=ProgId content=Word.Document> <meta name=Generator content="Microsoft Word 14"> <meta name=Originator content="Microsoft Word 14"> <link rel=File-List href="Document_1_files/filelist.xml"> <!--[if gte mso 9]><xml> <o:DocumentProperties> <o:Author>Name</o:Author> <o:LastAuthor>Name</o:LastAuthor> <o:Revision>2</o:Revision> <o:TotalTime>0</o:TotalTime> <o:Created>2012-01-05T21:43:00Z</o:Created> <o:LastSaved>2012-01-05T21:43:00Z</o:LastSaved> <o:Pages>1</o:Pages> <o:Characters>5</o:Characters> <o:Company>Microsoft</o:Company> <o:Lines>1</o:Lines> <o:Paragraphs>1</o:Paragraphs> <o:CharactersWithSpaces>5</o:CharactersWithSpaces> <o:Version>14.00</o:Version> </o:DocumentProperties> <o:OfficeDocumentSettings> <o:AllowPNG/> </o:OfficeDocumentSettings> </xml><![endif]--> <link rel=themeData href="Document_1_files/themedata.thmx"> <link rel=colorSchemeMapping href="Document_1_files/colorschememapping.xml"> <!--[if gte mso 9]><xml> <w:WordDocument> <w:SpellingState>Clean</w:SpellingState> <w:GrammarState>Clean</w:GrammarState> <w:TrackMoves>false</w:TrackMoves> <w:TrackFormatting/> <w:PunctuationKerning/> <w:ValidateAgainstSchemas/> <w:SaveIfXMLInvalid>false</w:SaveIfXMLInvalid> <w:IgnoreMixedContent>false</w:IgnoreMixedContent> <w:AlwaysShowPlaceholderText>false</w:AlwaysShowPlaceholderText> <w:DoNotPromoteQF/> <w:LidThemeOther>EN-US</w:LidThemeOther> <w:LidThemeAsian>X-NONE</w:LidThemeAsian> <w:LidThemeComplexScript>X-NONE</w:LidThemeComplexScript> <w:Compatibility> <w:BreakWrappedTables/> <w:SnapToGridInCell/> <w:WrapTextWithPunct/> <w:UseAsianBreakRules/> <w:DontGrowAutofit/> <w:SplitPgBreakAndParaMark/> <w:EnableOpenTypeKerning/> <w:DontFlipMirrorIndents/> <w:OverrideTableStyleHps/> </w:Compatibility> <m:mathPr> <m:mathFont m:val="Cambria Math"/> <m:brkBin m:val="before"/> <m:brkBinSub m:val="&#45;-"/> <m:smallFrac m:val="off"/> <m:dispDef/> <m:lMargin m:val="0"/> <m:rMargin m:val="0"/> <m:defJc m:val="centerGroup"/> <m:wrapIndent m:val="1440"/> <m:intLim m:val="subSup"/> <m:naryLim m:val="undOvr"/> </m:mathPr></w:WordDocument> </xml><![endif]--><!--[if gte mso 9]><xml> <w:LatentStyles DefLockedState="false" DefUnhideWhenUsed="true" DefSemiHidden="true" DefQFormat="false" DefPriority="99" LatentStyleCount="267"> <w:LsdException Locked="false" Priority="0" SemiHidden="false" UnhideWhenUsed="false" QFormat="true" Name="Normal"/> <w:LsdException Locked="false" Priority="9" SemiHidden="false" UnhideWhenUsed="false" QFormat="true" Name="heading 1"/> <w:LsdException Locked="false" Priority="9" QFormat="true" Name="heading 2"/> <w:LsdException Locked="false" Priority="9" QFormat="true" Name="heading 3"/> <w:LsdException Locked="false" Priority="9" QFormat="true" Name="heading 4"/> <w:LsdException Locked="false" Priority="9" QFormat="true" Name="heading 5"/> <w:LsdException Locked="false" Priority="9" QFormat="true" Name="heading 6"/> <w:LsdException Locked="false" Priority="9" QFormat="true" Name="heading 7"/> <w:LsdException Locked="false" Priority="9" QFormat="true" Name="heading 8"/> <w:LsdException Locked="false" Priority="9" QFormat="true" Name="heading 9"/> <w:LsdException Locked="false" Priority="39" Name="toc 1"/> <w:LsdException Locked="false" Priority="39" Name="toc 2"/> <w:LsdException Locked="false" Priority="39" Name="toc 3"/> <w:LsdException Locked="false" Priority="39" Name="toc 4"/> <w:LsdException Locked="false" Priority="39" Name="toc 5"/> <w:LsdException Locked="false" Priority="39" Name="toc 6"/> <w:LsdException Locked="false" Priority="39" Name="toc 7"/> <w:LsdException Locked="false" Priority="39" Name="toc 8"/> <w:LsdException Locked="false" Priority="39" Name="toc 9"/> <w:LsdException Locked="false" Priority="35" QFormat="true" Name="caption"/> <w:LsdException Locked="false" Priority="10" SemiHidden="false" UnhideWhenUsed="false" QFormat="true" Name="Title"/> <w:LsdException Locked="false" Priority="1" Name="Default Paragraph Font"/> <w:LsdException Locked="false" Priority="11" SemiHidden="false" UnhideWhenUsed="false" QFormat="true" Name="Subtitle"/> <w:LsdException Locked="false" Priority="22" SemiHidden="false" UnhideWhenUsed="false" QFormat="true" Name="Strong"/> <w:LsdException Locked="false" Priority="20" SemiHidden="false" UnhideWhenUsed="false" QFormat="true" Name="Emphasis"/> <w:LsdException Locked="false" Priority="59" SemiHidden="false" UnhideWhenUsed="false" Name="Table Grid"/> <w:LsdException Locked="false" UnhideWhenUsed="false" Name="Placeholder Text"/> <w:LsdException Locked="false" Priority="1" SemiHidden="false" UnhideWhenUsed="false" QFormat="true" Name="No Spacing"/> <w:LsdException Locked="false" Priority="60" SemiHidden="false" UnhideWhenUsed="false" Name="Light Shading"/> <w:LsdException Locked="false" Priority="61" SemiHidden="false" UnhideWhenUsed="false" Name="Light List"/> <w:LsdException Locked="false" Priority="62" SemiHidden="false" UnhideWhenUsed="false" Name="Light Grid"/> <w:LsdException Locked="false" Priority="63" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Shading 1"/> <w:LsdException Locked="false" Priority="64" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Shading 2"/> <w:LsdException Locked="false" Priority="65" SemiHidden="false" UnhideWhenUsed="false" Name="Medium List 1"/> <w:LsdException Locked="false" Priority="66" SemiHidden="false" UnhideWhenUsed="false" Name="Medium List 2"/> <w:LsdException Locked="false" Priority="67" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 1"/> <w:LsdException Locked="false" Priority="68" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 2"/> <w:LsdException Locked="false" Priority="69" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 3"/> <w:LsdException Locked="false" Priority="70" SemiHidden="false" UnhideWhenUsed="false" Name="Dark List"/> <w:LsdException Locked="false" Priority="71" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful Shading"/> <w:LsdException Locked="false" Priority="72" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful List"/> <w:LsdException Locked="false" Priority="73" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful Grid"/> <w:LsdException Locked="false" Priority="60" SemiHidden="false" UnhideWhenUsed="false" Name="Light Shading Accent 1"/> <w:LsdException Locked="false" Priority="61" SemiHidden="false" UnhideWhenUsed="false" Name="Light List Accent 1"/> <w:LsdException Locked="false" Priority="62" SemiHidden="false" UnhideWhenUsed="false" Name="Light Grid Accent 1"/> <w:LsdException Locked="false" Priority="63" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Shading 1 Accent 1"/> <w:LsdException Locked="false" Priority="64" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Shading 2 Accent 1"/> <w:LsdException Locked="false" Priority="65" SemiHidden="false" UnhideWhenUsed="false" Name="Medium List 1 Accent 1"/> <w:LsdException Locked="false" UnhideWhenUsed="false" Name="Revision"/> <w:LsdException Locked="false" Priority="34" SemiHidden="false" UnhideWhenUsed="false" QFormat="true" Name="List Paragraph"/> <w:LsdException Locked="false" Priority="29" SemiHidden="false" UnhideWhenUsed="false" QFormat="true" Name="Quote"/> <w:LsdException Locked="false" Priority="30" SemiHidden="false" UnhideWhenUsed="false" QFormat="true" Name="Intense Quote"/> <w:LsdException Locked="false" Priority="66" SemiHidden="false" UnhideWhenUsed="false" Name="Medium List 2 Accent 1"/> <w:LsdException Locked="false" Priority="67" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 1 Accent 1"/> <w:LsdException Locked="false" Priority="68" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 2 Accent 1"/> <w:LsdException Locked="false" Priority="69" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 3 Accent 1"/> <w:LsdException Locked="false" Priority="70" SemiHidden="false" UnhideWhenUsed="false" Name="Dark List Accent 1"/> <w:LsdException Locked="false" Priority="71" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful Shading Accent 1"/> <w:LsdException Locked="false" Priority="72" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful List Accent 1"/> <w:LsdException Locked="false" Priority="73" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful Grid Accent 1"/> <w:LsdException Locked="false" Priority="60" SemiHidden="false" UnhideWhenUsed="false" Name="Light Shading Accent 2"/> <w:LsdException Locked="false" Priority="61" SemiHidden="false" UnhideWhenUsed="false" Name="Light List Accent 2"/> <w:LsdException Locked="false" Priority="62" SemiHidden="false" UnhideWhenUsed="false" Name="Light Grid Accent 2"/> <w:LsdException Locked="false" Priority="63" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Shading 1 Accent 2"/> <w:LsdException Locked="false" Priority="64" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Shading 2 Accent 2"/> <w:LsdException Locked="false" Priority="65" SemiHidden="false" UnhideWhenUsed="false" Name="Medium List 1 Accent 2"/> <w:LsdException Locked="false" Priority="66" SemiHidden="false" UnhideWhenUsed="false" Name="Medium List 2 Accent 2"/> <w:LsdException Locked="false" Priority="67" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 1 Accent 2"/> <w:LsdException Locked="false" Priority="68" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 2 Accent 2"/> <w:LsdException Locked="false" Priority="69" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 3 Accent 2"/> <w:LsdException Locked="false" Priority="70" SemiHidden="false" UnhideWhenUsed="false" Name="Dark List Accent 2"/> <w:LsdException Locked="false" Priority="71" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful Shading Accent 2"/> <w:LsdException Locked="false" Priority="72" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful List Accent 2"/> <w:LsdException Locked="false" Priority="73" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful Grid Accent 2"/> <w:LsdException Locked="false" Priority="60" SemiHidden="false" UnhideWhenUsed="false" Name="Light Shading Accent 3"/> <w:LsdException Locked="false" Priority="61" SemiHidden="false" UnhideWhenUsed="false" Name="Light List Accent 3"/> <w:LsdException Locked="false" Priority="62" SemiHidden="false" UnhideWhenUsed="false" Name="Light Grid Accent 3"/> <w:LsdException Locked="false" Priority="63" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Shading 1 Accent 3"/> <w:LsdException Locked="false" Priority="64" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Shading 2 Accent 3"/> <w:LsdException Locked="false" Priority="65" SemiHidden="false" UnhideWhenUsed="false" Name="Medium List 1 Accent 3"/> <w:LsdException Locked="false" Priority="66" SemiHidden="false" UnhideWhenUsed="false" Name="Medium List 2 Accent 3"/> <w:LsdException Locked="false" Priority="67" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 1 Accent 3"/> <w:LsdException Locked="false" Priority="68" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 2 Accent 3"/> <w:LsdException Locked="false" Priority="69" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 3 Accent 3"/> <w:LsdException Locked="false" Priority="70" SemiHidden="false" UnhideWhenUsed="false" Name="Dark List Accent 3"/> <w:LsdException Locked="false" Priority="71" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful Shading Accent 3"/> <w:LsdException Locked="false" Priority="72" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful List Accent 3"/> <w:LsdException Locked="false" Priority="73" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful Grid Accent 3"/> <w:LsdException Locked="false" Priority="60" SemiHidden="false" UnhideWhenUsed="false" Name="Light Shading Accent 4"/> <w:LsdException Locked="false" Priority="61" SemiHidden="false" UnhideWhenUsed="false" Name="Light List Accent 4"/> <w:LsdException Locked="false" Priority="62" SemiHidden="false" UnhideWhenUsed="false" Name="Light Grid Accent 4"/> <w:LsdException Locked="false" Priority="63" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Shading 1 Accent 4"/> <w:LsdException Locked="false" Priority="64" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Shading 2 Accent 4"/> <w:LsdException Locked="false" Priority="65" SemiHidden="false" UnhideWhenUsed="false" Name="Medium List 1 Accent 4"/> <w:LsdException Locked="false" Priority="66" SemiHidden="false" UnhideWhenUsed="false" Name="Medium List 2 Accent 4"/> <w:LsdException Locked="false" Priority="67" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 1 Accent 4"/> <w:LsdException Locked="false" Priority="68" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 2 Accent 4"/> <w:LsdException Locked="false" Priority="69" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 3 Accent 4"/> <w:LsdException Locked="false" Priority="70" SemiHidden="false" UnhideWhenUsed="false" Name="Dark List Accent 4"/> <w:LsdException Locked="false" Priority="71" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful Shading Accent 4"/> <w:LsdException Locked="false" Priority="72" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful List Accent 4"/> <w:LsdException Locked="false" Priority="73" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful Grid Accent 4"/> <w:LsdException Locked="false" Priority="60" SemiHidden="false" UnhideWhenUsed="false" Name="Light Shading Accent 5"/> <w:LsdException Locked="false" Priority="61" SemiHidden="false" UnhideWhenUsed="false" Name="Light List Accent 5"/> <w:LsdException Locked="false" Priority="62" SemiHidden="false" UnhideWhenUsed="false" Name="Light Grid Accent 5"/> <w:LsdException Locked="false" Priority="63" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Shading 1 Accent 5"/> <w:LsdException Locked="false" Priority="64" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Shading 2 Accent 5"/> <w:LsdException Locked="false" Priority="65" SemiHidden="false" UnhideWhenUsed="false" Name="Medium List 1 Accent 5"/> <w:LsdException Locked="false" Priority="66" SemiHidden="false" UnhideWhenUsed="false" Name="Medium List 2 Accent 5"/> <w:LsdException Locked="false" Priority="67" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 1 Accent 5"/> <w:LsdException Locked="false" Priority="68" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 2 Accent 5"/> <w:LsdException Locked="false" Priority="69" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 3 Accent 5"/> <w:LsdException Locked="false" Priority="70" SemiHidden="false" UnhideWhenUsed="false" Name="Dark List Accent 5"/> <w:LsdException Locked="false" Priority="71" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful Shading Accent 5"/> <w:LsdException Locked="false" Priority="72" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful List Accent 5"/> <w:LsdException Locked="false" Priority="73" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful Grid Accent 5"/> <w:LsdException Locked="false" Priority="60" SemiHidden="false" UnhideWhenUsed="false" Name="Light Shading Accent 6"/> <w:LsdException Locked="false" Priority="61" SemiHidden="false" UnhideWhenUsed="false" Name="Light List Accent 6"/> <w:LsdException Locked="false" Priority="62" SemiHidden="false" UnhideWhenUsed="false" Name="Light Grid Accent 6"/> <w:LsdException Locked="false" Priority="63" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Shading 1 Accent 6"/> <w:LsdException Locked="false" Priority="64" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Shading 2 Accent 6"/> <w:LsdException Locked="false" Priority="65" SemiHidden="false" UnhideWhenUsed="false" Name="Medium List 1 Accent 6"/> <w:LsdException Locked="false" Priority="66" SemiHidden="false" UnhideWhenUsed="false" Name="Medium List 2 Accent 6"/> <w:LsdException Locked="false" Priority="67" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 1 Accent 6"/> <w:LsdException Locked="false" Priority="68" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 2 Accent 6"/> <w:LsdException Locked="false" Priority="69" SemiHidden="false" UnhideWhenUsed="false" Name="Medium Grid 3 Accent 6"/> <w:LsdException Locked="false" Priority="70" SemiHidden="false" UnhideWhenUsed="false" Name="Dark List Accent 6"/> <w:LsdException Locked="false" Priority="71" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful Shading Accent 6"/> <w:LsdException Locked="false" Priority="72" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful List Accent 6"/> <w:LsdException Locked="false" Priority="73" SemiHidden="false" UnhideWhenUsed="false" Name="Colorful Grid Accent 6"/> <w:LsdException Locked="false" Priority="19" SemiHidden="false" UnhideWhenUsed="false" QFormat="true" Name="Subtle Emphasis"/> <w:LsdException Locked="false" Priority="21" SemiHidden="false" UnhideWhenUsed="false" QFormat="true" Name="Intense Emphasis"/> <w:LsdException Locked="false" Priority="31" SemiHidden="false" UnhideWhenUsed="false" QFormat="true" Name="Subtle Reference"/> <w:LsdException Locked="false" Priority="32" SemiHidden="false" UnhideWhenUsed="false" QFormat="true" Name="Intense Reference"/> <w:LsdException Locked="false" Priority="33" SemiHidden="false" UnhideWhenUsed="false" QFormat="true" Name="Book Title"/> <w:LsdException Locked="false" Priority="37" Name="Bibliography"/> <w:LsdException Locked="false" Priority="39" QFormat="true" Name="TOC Heading"/> </w:LatentStyles> </xml><![endif]--> <style> <!-- /* Font Definitions */ @font-face {font-family:Calibri; panose-1:2 15 5 2 2 2 4 3 2 4; mso-font-charset:0; mso-generic-font-family:swiss; mso-font-pitch:variable; mso-font-signature:-520092929 1073786111 9 0 415 0;} /* Style Definitions */ p.MsoNormal, li.MsoNormal, div.MsoNormal {mso-style-unhide:no; mso-style-qformat:yes; mso-style-parent:""; margin-top:0in; margin-right:0in; margin-bottom:10.0pt; margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:Calibri; mso-fareast-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} span.GramE {mso-style-name:""; mso-gram-e:yes;} .MsoChpDefault {mso-style-type:export-only; mso-default-props:yes; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:Calibri; mso-fareast-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} .MsoPapDefault {mso-style-type:export-only; margin-bottom:10.0pt; line-height:115%;} @page WordSection1 {size:8.5in 11.0in; margin:1.0in 1.0in 1.0in 1.0in; mso-header-margin:.5in; mso-footer-margin:.5in; mso-paper-source:0;} div.WordSection1 {page:WordSection1;} --> </style> <!--[if gte mso 10]> <style> /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} </style> <![endif]--><!--[if gte mso 9]><xml> <o:shapedefaults v:ext="edit" spidmax="1026"/> </xml><![endif]--><!--[if gte mso 9]><xml> <o:shapelayout v:ext="edit"> <o:idmap v:ext="edit" data="1"/> </o:shapelayout></xml><![endif]--> </head> <body lang=EN-US style='tab-interval:.5in'> <div class=WordSection1> <p class=MsoNormal><o:p>&nbsp;</o:p></p> <p class=MsoNormal><span class=GramE><span style='color:red'>blah</span></span><span style='color:red'><o:p></o:p></span></p> </div> </body> </html> EDIT 2 I recorded a macro and did the following: Typed a word Selected the word Changed the color. Oddly, I had some strange issues while the macro was recorded. I could not select text with my cursor. I had to select the text with control a and then apply the color change. I then couldn't deselect the selected text. Nonetheless, the text showed that it had a different color in the toolbar, but the color did not display in the document. Here's the macro: Sub Change_Text_Color() ' ' Change_Text_Color Macro ' ' Selection.TypeText Text:="Test Text" Selection.WholeStory Selection.WholeStory End Sub EDIT 3 I opened WordPad and created some text and was able to successfully change the color. If I copy and paste the colored text into a Word 2010 document, the color is lost. However, if you place the I-beam in the text and then look at the color selection drop-down menu on the ribbon or mini-toolbar, you can see that the proper color that the text should be in is highlighted. Edit 4 I uninstalled the entire Office 2010 Suite, rebooted and then reinstalled the suite. No change in behavior. Edit 5 Text cannot be colored in Excel either.

    Read the article

  • CodeIgniter: Passing variables via URL - alternatives to using GET

    - by John Durrant
    I'm new to CodeIgniter and have just discovered the difficulties using the GET method of passing variables via the URL (e.g. domain.com/page.php?var1=1&var2=2). I gather that one approach is to pass the variables in the URI segments but haven't quite figured out how to do that yet as it seems to create the expectation of having a function in the controller named as the specific URI segment???? Anyway Instead of using GET I've decided to use POST by adapting a submit button (disguised as a link) with the variables in hidden input fields. I've created the following solution which seems to work fine, but am wondering whether I'm on the right track here or whether there is an easier way of passing variables via a link within CodeIgniter? I've created the following class in application/libraries/ <?php if ( ! defined('BASEPATH')) exit('No direct script access allowed'); class C_variables { function variables_via_link($action, $link_text, $style, $link_data) { $attributes = array('style' => 'margin:0; padding:0; display: inline;'); echo form_open($action, $attributes); $attributes = array('class' => $style, 'name' => 'link'); echo form_submit($attributes, $link_text); foreach ($link_data as $key => $value){ echo form_hidden($key, $value); } echo form_close(); } } ?> With the following CSS: /* SUBMIT BUTTON AS LINK adapted from thread: http://forums.digitalpoint.com/showthread.php?t=403667 Cross browser support (apparently). */ .submit_as_link { background: transparent; border-top: 0; border-right: 0; border-bottom: 1px solid #00F; border-left: 0; color: #00F; display: inline; margin: 0; padding: 0; cursor: hand /* Added to show hand when hovering */ } *:first-child+html .submit_as_link { /* hack needed for IE 7 */ border-bottom: 0; text-decoration: underline; } * html .submit_as_link { /* hack needed for IE 5/6 */ border-bottom: 0; text-decoration: underline; } Link then created using the following code in the VIEW: <?php $link = new C_variables; $link_data=array('var1' => 1, 'var2' => 2); $link ->variables_via_link('destination_page', 'here is a link!', 'submit_as_link', $link_data); ?> Thanks for your help...

    Read the article

  • Android RelativeLayout fill_parent unexpected behavior in a ListView with varying row heights

    - by Jameel Al-Aziz
    I'm currently working on a small update to a project and I'm having an issue with Relative_Layout and fill_parent in a list view. I'm trying to insert a divider between two sections in each row, much like the divider in the call log of the default dialer. I checked out the Android source code to see how they did it, but I encountered a problem when replicating their solution. To start, here is my row item layout: <?xml version="1.0" encoding="utf-8"?> <RelativeLayout android:id="@+id/RelativeLayout01" android:layout_width="fill_parent" xmlns:android="http://schemas.android.com/apk/res/android" android:padding="10dip" android:layout_height="fill_parent" android:maxHeight="64dip" android:minHeight="?android:attr/listPreferredItemHeight"> <ImageView android:id="@+id/infoimage" android:layout_width="wrap_content" android:layout_height="wrap_content" android:clickable="true" android:src="@drawable/info_icon_big" android:layout_alignParentRight="true" android:layout_centerVertical="true"/> <View android:id="@+id/divider" android:background="@drawable/divider_vertical_dark" android:layout_marginLeft="11dip" android:layout_toLeftOf="@+id/infoimage" android:layout_width="1px" android:layout_height="fill_parent" android:layout_marginTop="5dip" android:layout_marginBottom="5dip" android:layout_marginRight="4dip"/> <TextView android:id="@+id/TextView01" android:textAppearance="?android:attr/textAppearanceLarge" android:layout_width="wrap_content" android:layout_height="wrap_content" android:layout_centerVertical="true" android:layout_toRightOf="@+id/ImageView01" android:layout_toLeftOf="@+id/divider" android:gravity="left|center_vertical" android:layout_marginLeft="4dip" android:layout_marginRight="4dip"/> <ImageView android:id="@+id/ImageView01" android:layout_width="wrap_content" android:layout_height="wrap_content" android:layout_alignParentLeft="true" android:background="@drawable/bborder" android:layout_centerVertical="true"/> </RelativeLayout> The issue I'm facing is that each row has a thumbnail of varying height (ImageView01). If I set the RelativeLayout's layout_height property to fill_parent, the divider does not scale vertically to fill the row (it just remains a 1px dot). If I set layout_height to "?android:attr/listPreferredItemHeight", the divider fills the row, but the thumbnails shrink. I've done some debugging in the getView() method of the adapter, and it seems that the divider's height is not being set properly once the row has it's proper height. Here is a portion of the getView() method: public View getView(int position, View view, ViewGroup parent) { if (view == null) { view = inflater.inflate(R.layout.tag_list_item, parent, false); } The rest of the method simply sets the appropriate text and images for the row. Also, I create the inflater object in the adapter's constructor with: inflater = LayoutInflater.from(context); Am I missing something essential? Or does fill_parent just not work with dynamic heights?

    Read the article

  • WPF Combobox: Autocomplete

    - by user279244
    Hi, I have implemented a Autocomplete enabled Combobox in WPF. It is like below... private void cbxSession_Loaded(object sender, RoutedEventArgs e) { cbxSession.ApplyTemplate(); TextBox textBox = cbxSession.Template.FindName("PART_EditableTextBox", cbxSession) as TextBox; textBox.IsReadOnly = false; if (textBox != null) { textBox.KeyUp += new KeyEventHandler(textBox_KeyUp); textBox.KeyUp += delegate { ///open the drop down and start filtering based on what the user types into the combobox cbxSession.IsDropDownOpen = true; cbxSession.Items.Filter += a => { if (a.ToString().ToUpper().Contains(textBox.Text.ToUpper())) return true; else return false; }; }; } } void textBox_KeyUp(object sender, KeyEventArgs e) { if ((e.Key == System.Windows.Input.Key.Up) || (e.Key == System.Windows.Input.Key.Down)) { e.Handled = true; } else if (e.Key == System.Windows.Input.Key.Enter) { e.Handled = true; cbxSession.IsDropDownOpen = false; } } void textBox_KeyDown(object sender, KeyEventArgs e) { cbxSession.SelectionChanged -= cbxSession_SelectionChanged; if (e.Key == System.Windows.Input.Key.Enter) { e.Handled = true; cbxSession.SelectionChanged += cbxSession_SelectionChanged; } if ((e.Key == System.Windows.Input.Key.Up) || (e.Key == System.Windows.Input.Key.Down)) { e.Handled = true; } } private void cbxSession_DropDownClosed(object sender, EventArgs e) { if (cbxSession.Text != "") { TextBox textBox = cbxSession.Template.FindName("PART_EditableTextBox", cbxSession) as TextBox; if (!cbxSession.Items.Contains(textBox.Text)) { textBox.Text = cbxSession.Text; } } } private void cbxSession_DropDownOpened(object sender, EventArgs e) { cbxSession.Items.Filter += a => { return true; }; } <ComboBox x:Name="cbxSession" Width="260" Canvas.Top="5" Canvas.Left="79" Height="25" Visibility="Visible" SelectionChanged="cbxSession_SelectionChanged" MaxDropDownHeight="200" IsTextSearchEnabled="False" IsEditable="True" IsReadOnly="True" Loaded="cbxSession_Loaded" DropDownClosed="cbxSession_DropDownClosed" StaysOpenOnEdit="True" DropDownOpened="cbxSession_DropDownOpened"> <ComboBox.ItemsPanel> <ItemsPanelTemplate> <VirtualizingStackPanel IsVirtualizing="True" IsItemsHost="True"/> </ItemsPanelTemplate> </ComboBox.ItemsPanel> </ComboBox> But, the problem I am facing is... When I try searching, the first character goes missing. And this happens only once. Secondly, When I am using Arrow buttons to the filtered items, the ComboboxSelectionChanged event is fired. Is there any way to make it fire only on the click of 'Enter'

    Read the article

  • Can't create a fullscreen WPF popup

    - by Scrappydog
    Using WPF .NET 4.0 in VS2010 RTM: I can't create a fullscreen WPF popup. If I create a popup that is sized 50% width and 100% height everything works fine, but if I try to create a "full screen" popup sized to 100% width and height it ends up displaying at 100% width and 75% height... the bottom is truncated. Note: The width and height are actually being expressed in pixels in code, I'm using percent to make the situation a little more understandable... It "feels" like there is some sort of limit preventing the area of a popup from exceeding ~75% of the total area of the screen. UPDATE: Here is a Hello World example that shows the problem. <Window x:Class="TechnologyVisualizer.PopupTest" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="PopupTest" WindowStyle="None" WindowState="Maximized" Background="DarkGray"> <Canvas x:Name="MainCanvas" Width="1920" Height="1080"> <Popup Placement="Center" VerticalAlignment="Center" HorizontalAlignment="Center" Width="1900" Height="1060" Name="popContent"> <TextBlock Background="Red">Hello World</TextBlock> </Popup> <Button Canvas.Left="50" Canvas.Top="50" Content="Menu" Height="60" Name="button1" Width="80" FontSize="22" Foreground="White" Background="Black" Click="button1_Click" /> </Canvas> </Window> using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Windows; using System.Windows.Controls; using System.Windows.Data; using System.Windows.Documents; using System.Windows.Input; using System.Windows.Media; using System.Windows.Media.Imaging; using System.Windows.Shapes; namespace TechnologyVisualizer { /// <summary> /// Interaction logic for PopupTest.xaml /// </summary> public partial class PopupTest : Window { public PopupTest() { InitializeComponent(); } private void button1_Click(object sender, RoutedEventArgs e) { popContent.IsOpen = true; } } } If you run this the bottom 25% of the popup is missing if you change the width of the popup to 500 then it will go full height

    Read the article

  • VHDL - Problem with std_logic_vector

    - by wretrOvian
    Hi, i'm coding a 4-bit binary adder with accumulator: library ieee; use ieee.std_logic_1164.all; entity binadder is port(n,clk,sh:in bit; x,y:inout std_logic_vector(3 downto 0); co:inout bit; done:out bit); end binadder; architecture binadder of binadder is signal state: integer range 0 to 3; signal sum,cin:bit; begin sum<= (x(0) xor y(0)) xor cin; co<= (x(0) and y(0)) or (y(0) and cin) or (x(0) and cin); process begin wait until clk='0'; case state is when 0=> if(n='1') then state<=1; end if; when 1|2|3=> if(sh='1') then x<= sum & x(3 downto 1); y<= y(0) & y(3 downto 1); cin<=co; end if; if(state=3) then state<=0; end if; end case; end process; done<='1' when state=3 else '0'; end binadder; The output : -- Compiling architecture binadder of binadder ** Error: C:/Modeltech_pe_edu_6.5a/examples/binadder.vhdl(15): No feasible entries for infix operator "xor". ** Error: C:/Modeltech_pe_edu_6.5a/examples/binadder.vhdl(15): Type error resolving infix expression "xor" as type std.standard.bit. ** Error: C:/Modeltech_pe_edu_6.5a/examples/binadder.vhdl(16): No feasible entries for infix operator "and". ** Error: C:/Modeltech_pe_edu_6.5a/examples/binadder.vhdl(16): Bad expression in right operand of infix expression "or". ** Error: C:/Modeltech_pe_edu_6.5a/examples/binadder.vhdl(16): No feasible entries for infix operator "and". ** Error: C:/Modeltech_pe_edu_6.5a/examples/binadder.vhdl(16): Bad expression in left operand of infix expression "or". ** Error: C:/Modeltech_pe_edu_6.5a/examples/binadder.vhdl(16): Bad expression in right operand of infix expression "or". ** Error: C:/Modeltech_pe_edu_6.5a/examples/binadder.vhdl(16): Type error resolving infix expression "or" as type std.standard.bit. ** Error: C:/Modeltech_pe_edu_6.5a/examples/binadder.vhdl(28): No feasible entries for infix operator "&". ** Error: C:/Modeltech_pe_edu_6.5a/examples/binadder.vhdl(28): Type error resolving infix expression "&" as type ieee.std_logic_1164.std_logic_vector. ** Error: C:/Modeltech_pe_edu_6.5a/examples/binadder.vhdl(39): VHDL Compiler exiting I believe i'm not handling std_logic_vector's correctly. Please tell me how? :(

    Read the article

  • Disable Windows 8 edge gestures/hot corners for multi-touch applications while running in full screen

    - by Bondye
    I have a full screen AS3 game maby with Adobe AIR that runs in Windows 7. In this game it may not be easy to exit (think about kiosk mode, only exit by pressing esc and enter a password). Now I want this game to run in Windows 8. The game is working like expected but the anoying things are these edge gestures/hot corners (left, top, right, bottom) and the shortcuts. I've read articles but none helped me. People talk about registery edits, but I dont get this working + the user needs to restart his/hers computer. I want to open my game, turn off gestures/hot corners and when the game closes the gestures/hot corners need to come back available again. I have seen some applications doing the same what I want to accomplish. I found this so I am able to detect the gestures. But how to ignore they're actions? I also read ASUS Smart Gestures but this is for the touch-pad. And I have tried Classic Shell but I need to disable the edge gestures/hot corners without such programs, just on-the-fly. I also found this but I don't know how to implement this. HRESULT SetTouchDisableProperty(HWND hwnd, BOOL fDisableTouch) { IPropertyStore* pPropStore; HRESULT hrReturnValue = SHGetPropertyStoreForWindow(hwnd, IID_PPV_ARGS(&pPropStore)); if (SUCCEEDED(hrReturnValue)) { PROPVARIANT var; var.vt = VT_BOOL; var.boolVal = fDisableTouch ? VARIANT_TRUE : VARIANT_FALSE; hrReturnValue = pPropStore->SetValue(PKEY_EdgeGesture_DisableTouchWhenFullscreen, var); pPropStore->Release(); } return hrReturnValue; } Does anyone know how I can do this? Or point me into the right direction? I have tried some in C# and C++, but I aint a skilled C#/C++ developer. Also the game is made in AS3 so it will be hard to implement this in C#/C++. I work on the Lenovo aio (All in one) with Windows 8.

    Read the article

  • Combining mousedown and mousemove events together with Javascript (JQUERY?)

    - by webzide
    Dear experts, I would like to combine a the mousedown and mousemove and mouseup events together. Basically the application of this would be making a UI for selecting elements. Like selecting icons in windows when the mouse is clicked down and as you move it, a dotted border dynamically moves with it. I know this is possible with the predefined UI of Jquery. But I am building a web application that requires the integration of this and would like to know the technique. I spend hours on this and it just doesn't work. here's is the code i have so far and the logic behind it: $(document).bind('mousedown', function (evt) { evt = (evt) ? evt : event; startX = evt.clientX; startY = evt.clientY; div = document.createElement("div"); div.style.position = "absolute"; div.style.left = startX + "px"; div.style.top = startY + "px"; div.style.border = "1px dotted #DDDDDD"; $(document).bind('mousemove', function(evt){ evt=(evt) ? evt: event; alert("TESTING OF THIS WORKS"); }); }); $(document).bind('mouseup',function(evt) { var evt = (evt) ? evt : event; var endX = evt.clientX; var endY = evt.clientY; difX = (endX - startX); difY = (endY - startY) if ((difX || difY) > 0) { div.style.width = difX + "px"; div.style.height = difY + "px"; document.body.appendChild(div); } $(this).unbind('mousemove'); }); As you can see I have placed an event binding of mousemove into the event function of mousedown so that it can only be invoked when the mouse is down. but the problem is, once that event is binded, it does not come off. The borders does not move dynamically as expected. Maybe my logic is entirely messed up. If anyone could point me the the right direction that would be great. THanks in advance.

    Read the article

  • WPF - Overlapping Custom Tabs in a TabControl and ZIndex

    - by Rachel
    Problem I have a custom tab control using Chrome-shaped tabs that binds to a ViewModel. Because of the shape, the edges overlap a bit. I have a function that sets the tabItem's ZIndex on TabControl_SelectionChanged which works fine for selecting tabs, and dragging/dropping tabs, however when I Add or Close a tab via a Relay Command I am getting unusual results. Does anyone have any ideas? Default View http://i193.photobucket.com/albums/z197/Lady53461/tabs_default.jpg Removing Tabs http:/i193.photobucket.com/albums/z197/Lady53461/tabs_removing.jpg Adding 2 or more Tabs in a row http:/i193.photobucket.com/albums/z197/Lady53461/tabs_adding.jpg Code to set ZIndex private void PrimaryTabControl_SelectionChanged(object sender, SelectionChangedEventArgs e) { if (e.Source is TabControl) { TabControl tabControl = sender as TabControl; ItemContainerGenerator icg = tabControl.ItemContainerGenerator; if (icg.Status == System.Windows.Controls.Primitives.GeneratorStatus.ContainersGenerated) { foreach (object o in tabControl.Items) { UIElement tabItem = icg.ContainerFromItem(o) as UIElement; Panel.SetZIndex(tabItem, (o == tabControl.SelectedItem ? 100 : 90 - tabControl.Items.IndexOf(o))); } } } } By using breakpoints I can see that it is correctly setting the ZIndex to what I want it to, however the layout is not displaying the changes. I know some of the changes are in effect because if none of them were working then the tab edges would be reversed (the right tabs would be drawn on top of the left ones). Clicking a tab will correctly set the zindex of all tabs (including the one that should be drawn on top) and dragging/dropping them to rearrange them also renders correctly (which removes and reinserts the tab item). The only difference I can think of is I am using the MVVM design pattern and the buttons that Add/Close tabs are relay commands. Does anyone have any idea why this is happening and how I can fix it?? p.s. I did try setting a ZIndex in my ViewModel and binding to it, however the same thing happens when adding/removing tabs via the relay command. EDIT: Being a new user I couldn't post images and could only post 1 link. Images just show a picture of what the tags render as after each scenario. Adding more then 1 at a time will not reset the zindex of other recently-added tabs so they go behind the tab on the Right, and closing tabs does not correctly render the ZIndex of the SelectedTab that replaces it and it shows up behind the tab on its right.

    Read the article

  • Silverlight animation not smooth

    - by Andrej
    Hi, When trying to animate objects time/frame based in Silverlight (in contrast to using something like DoubleAnimation or Storyboard, which is not suitable e.g. for fast paced games), for example moving a spaceship in a particular direction every frame, the movement is jumpy and not really smooth. The screen even seems to tear. There seems to be no difference between CompositionTarget and DistpatcherTimer. I use the following approach (in pseudocode): Register Handler to Tick-Event of a DispatcherTimer In each Tick: Compute the elapsed time from the last frame in milliseconds Object.X += movementSpeed * ellapsedMilliseconds This should result in a smooth movement, right? But it doesn't. Here is an example (Controls: WASD and Mouse): Silverlight Game. Although the effect I described is not too prevalent in this sample, I can assure you that even moving a single rectangle over a canvas produces a jumpy animation. Does someone have an idea how to minimize this. Are there other approaches to to frame based animation exept using Storyboards/DoubleAnimations which could solve this? Edit: Here a quick and dirty approach, animating a rectangle with minimum code (Controls: A and D) Animation Sample Xaml: <Grid x:Name="LayoutRoot" Background="Black"> <Canvas Width="1000" Height="400" Background="Blue"> <Rectangle x:Name="rect" Width="48" Height="48" Fill="White" Canvas.Top="200" Canvas.Left="0"/> </Canvas> </Grid> C#: private bool isLeft = false; private bool isRight = false; private DispatcherTimer timer = new DispatcherTimer(); private double lastUpdate; public Page() { InitializeComponent(); timer.Interval = TimeSpan.FromMilliseconds(1); timer.Tick += OnTick; lastUpdate = Environment.TickCount; timer.Start(); } private void OnTick(object sender, EventArgs e) { double diff = Environment.TickCount - lastUpdate; double x = Canvas.GetLeft(rect); if (isRight) x += 1 * diff; else if (isLeft) x -= 1 * diff; Canvas.SetLeft(rect, x); lastUpdate = Environment.TickCount; } private void UserControl_KeyDown(object sender, KeyEventArgs e) { if (e.Key == Key.D) isRight = true; if (e.Key == Key.A) isLeft = true; } private void UserControl_KeyUp(object sender, KeyEventArgs e) { if (e.Key == Key.D) isRight = false; if (e.Key == Key.A) isLeft = false; } Thanks! Andrej

    Read the article

  • Wpf Combobox in Master/Detail MVVM

    - by isak
    I have MVVM master /details like this: <Window.Resources> <DataTemplate DataType="{x:Type model:EveryDay}"> <views:EveryDayView/> </DataTemplate> <DataTemplate DataType="{x:Type model:EveryMonth}"> <views:EveryMonthView/> </DataTemplate> </Window.Resources> <Grid> <ListBox Margin="12,24,0,35" Name="schedules" IsSynchronizedWithCurrentItem="True" ItemsSource="{Binding Path=Elements}" SelectedItem="{Binding Path=CurrentElement}" DisplayMemberPath="Name" HorizontalAlignment="Left" Width="120"/> <ContentControl Margin="168,86,32,35" Name="contentControl1" Content="{Binding Path=CurrentElement.Schedule}" /> <ComboBox Height="23" Margin="188,24,51,0" Name="comboBox1" VerticalAlignment="Top" IsSynchronizedWithCurrentItem="True" ItemsSource="{Binding Path=Schedules}" SelectedItem="{Binding Path=CurrentElement.Schedule}" DisplayMemberPath="Name" SelectedValuePath="ID" SelectedValue="{Binding Path=CurrentElement.Schedule.ID}" /> </Grid> This Window has DataContext class: public class MainViewModel : INotifyPropertyChanged { public MainViewModel() { _elements.Add(new Element("first", new EveryDay("First EveryDay object"))); _elements.Add(new Element("second", new EveryMonth("Every Month object"))); _elements.Add(new Element("third", new EveryDay("Second EveryDay object"))); _schedules.Add(new EveryDay()); _schedules.Add(new EveryMonth()); } private ObservableCollection<ScheduleBase> _schedules = new ObservableCollection<ScheduleBase>(); public ObservableCollection<ScheduleBase> Schedules { get { return _schedules; } set { _schedules = value; this.OnPropertyChanged("Schedules"); } } private Element _currentElement = null; public Element CurrentElement { get { return this._currentElement; } set { this._currentElement = value; this.OnPropertyChanged("CurrentElement"); } } private ObservableCollection<Element> _elements = new ObservableCollection<Element>(); public ObservableCollection<Element> Elements { get { return _elements; } set { _elements = value; this.OnPropertyChanged("Elements"); } } #region INotifyPropertyChanged Members public event PropertyChangedEventHandler PropertyChanged; protected void OnPropertyChanged(string propertyName) { PropertyChangedEventHandler handler = PropertyChanged; if (handler != null) { handler(this, new PropertyChangedEventArgs(propertyName)); } } #endregion } One of Views: <UserControl x:Class="Views.EveryDayView" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" > <Grid > <GroupBox Header="Every Day Data" Name="groupBox1" VerticalAlignment="Top"> <Grid HorizontalAlignment="Stretch" VerticalAlignment="Stretch"> <TextBox Name="textBox2" Text="{Binding Path=AnyDayData}" /> </Grid> </GroupBox> </Grid> I have problem with SelectedItem in ComboBox.It doesn't works correctly.

    Read the article

< Previous Page | 687 688 689 690 691 692 693 694 695 696 697 698  | Next Page >