Search Results

Search found 56780 results on 2272 pages for 'system design'.

Page 706/2272 | < Previous Page | 702 703 704 705 706 707 708 709 710 711 712 713  | Next Page >

• missing entry in launchctl after restart

  - by Nobik

  I have a deamon which is registered with launchctl to run as system-wide-daemon and to load automatically with every system startup or if the daemon crashes. I have registered this daemon with: sudo launchctl load -w /Library/LaunchDaemons/plist.file Everything works fine. My daemon is registered and with sudo launchctl list I can find the entry at launchctl But on some Macs after the user restarts the system, my daemon is not running. And with the command sudo launchctl list I can't find the entry anymore. Any ideas, why the entry is missing???

  Read the article

• Problem with running c# application on another PC

  - by draghia-aurelian

  I wrote a Windows Form Application in C# and it works well for my computer. But on another PC, an error occurs when i try to do some stuff. code 1 private void rUNToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in rUNToolStripMenuItem_Click!"); ... } code 2 private void dataPositionToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in dataPositionToolStripMenuItem_Click!"); ... } Running on my computer: code1: MessageBox appears! code2: MessageBox appears! Running on another computer: code1: MessageBox doesn't appear and the error happens! code2: MessageBox appears! The error is: Method not found: "Void Microsoft.CSharp.RuntimeBinder.CSharpGetMemberBider..ctor(System.String.System.Type, System.Collections.Generic.IEnumerable'1)'. This is the PrintScreen with error: Please help me to solve the problem!

  Read the article

• iphone build error that makes me want to buy a nail gun

  - by sol

  I'm just trying to build a simple update (which I have done before) for an iphone app, but now for some reason I'm getting this error. Can anyone tell me what it means? Command/Developer/Library/Xcode/Plug-ins/CoreBuildTasks.xcplugin/Contents/Resources/copyplist failed with exit code 127 sh: plutil: command not found Here are the Build Results: CopyPNGFile /Users/me/path/build/Dist-iphoneos/MyApp.app/img_000.png images/img_000.png cd /Users/me/ setenv COPY_COMMAND /Developer/Library/PrivateFrameworks/DevToolsCore.framework/Resources/pbxcp setenv PATH "/Developer/Platforms/iPhoneOS.platform/Developer/usr/bin:/Developer/usr/bin:/System/Library/Frameworks/JavaVM.frameworK/Versions/1.6/Home/" "/Developer/Platforms/iPhoneOS.platform/Developer/Library/Xcode/Plug-ins/iPhoneOS Build System Support.xcplugin/Contents/Resources/copypng" -compress "" /Users/path/images/img_000.png /Users/me/path/build/Dist-iphoneos/MyApp.app/img_000.png sh: dirname: command not found CopyPlistFile /Users/me/path/build/Dist-iphoneos/MyApp.app/Entitlements.plist Entitlements.plist cd /Users/me/ setenv PATH "/Developer/Platforms/iPhoneOS.platform/Developer/usr/bin:/Developer/usr/bin:/System/Library/Frameworks/JavaVM.frameworK/Versions/1.6/Home/" /Developer/Library/Xcode/Plug-ins/CoreBuildTasks.xcplugin/Contents/Resources/copyplist --convert binary1 Entitlements.plist --outdir /Users/me/path/build/Dist-iphoneos/MyApp.app sh: plutil: command not found

  Read the article

• Measuring device drivers CPU/IO utilization caused by my program

  - by Lior Kogan

  Sometimes code can utilize device drivers up to the point where the system is unresponsive. Lately I've optimized a WIN32/VC++ code which made the system almost unresponsive. The CPU usage, however, was very low. The reason was 1000's of creations and destruction of GDI objects (pens, brushes, etc.). Once I refactored the code to create all objects only once - the system became responsive again. This leads me to the question: Is there a way to measure CPU/IO usage of device drivers (GPU/disk/etc) for a given program / function / line of code?

  Read the article

• Problem regarding listShuttle component in richFaces ?

  - by Hari

  I am a newbee for Richfaces components, When i am using the <rich:listShuttle> the Arraylist specified in the targetValue is now getting updated with the latest data? Kindly help MyJSF File <a4j:region> <rich:listShuttle sourceValue="#{bean.selectItems}" id="one" targetValue="#{bean.selectItemsone}" var="items" listsHeight="150" sourceListWidth="130" targetListWidth="130" sourceCaptionLabel="Intial Items" targetCaptionLabel="Selected Items" converter="Listconverter"> <rich:column> <h:outputText value="#{items.value}"></h:outputText> </rich:column> </rich:listShuttle> </a4j:region> <a4j:region> <a4j:commandButton value="Submit" action="#{bean.action}" /> </a4j:region> My Managed Bean enter code here private List<String> selectedData; private List<BeanItems> selectItems; private List<BeanItems> selectItemsone; public String action() { System.out.println(selectItems); System.out.println(selectItemsone); System.out.println("Select Item List"); Iterator<BeanItems> iterator = selectItems.iterator(); while (iterator.hasNext()) { BeanItems item = (BeanItems) iterator.next(); System.out.println(item.getValue()); } System.out.println("/nSelect Item one list "); Iterator<BeanItems> iterator2 = selectItemsone.iterator(); while (iterator2.hasNext()) { BeanItems item = (BeanItems) iterator2.next(); System.out.println(item.getValue()); } return ""; } public void setSelectedData(List<String> selectedData) { this.selectedData = selectedData; } public List<String> getSelectedData() { return selectedData; } /** * @return the selectItems */ public List<BeanItems> getSelectItems() { if (selectItems == null) { selectItems = new ArrayList<BeanItems>(); selectItems.add(new BeanItems("value4", "label4")); selectItems.add(new BeanItems("value5", "label5")); selectItems.add(new BeanItems("value6", "label6")); selectItems.add(new BeanItems("value7", "label7")); selectItems.add(new BeanItems("value8", "label8")); selectItems.add(new BeanItems("value9", "label9")); selectItems.add(new BeanItems("value10", "label10")); } return selectItems; } /** * @return the selectItemsone */ public List<BeanItems> getSelectItemsone() { if (selectItemsone == null) { selectItemsone = new ArrayList<BeanItems>(); selectItemsone.add(new BeanItems("value1", "label1")); selectItemsone.add(new BeanItems("value2", "label2")); selectItemsone.add(new BeanItems("value3", "label3")); } return selectItemsone; } My Converter Class enter code here public Object getAsObject(FacesContext context, UIComponent component,String value) { int index = value.indexOf(':'); return new BeanItems(value.substring(0, index), value.substring(index + 1)); } public String getAsString(FacesContext context, UIComponent component,Object value) { BeanItems beanItems = (BeanItems) value; return beanItems.getValue() + ":" + beanItems.getData(); } My BeanItems Class enter code here private String data; //Getter & setter private String value; //Getter & setter public BeanItems() { } public BeanItems(String value, String data) { this.value = value; this.data = data; } public int hashCode() { final int prime = 31; int result = 1; result = prime * result + ((data == null) ? 0 : data.hashCode()); result = prime * result + ((value == null) ? 0 : value.hashCode()); return result; } public boolean equals(Object obj) { if (this == obj) return true; if (obj == null) return false; if (getClass() != obj.getClass()) return false; final BeanItems other = (BeanItems) obj; if (data == null) { if (other.data != null) return false; } else if (!data.equals(other.data)) return false; if (value == null) { if (other.value != null) return false; } else if (!value.equals(other.value)) return false; return true; }

  Read the article

• C# Winform : Deployment Problem after using DataRepeater of MS Visual Basics power pack

  - by Mohsan

  hi. Microsoft Visual Studio 2008 Service pack 1 comes with Visual Basic Powerpacks which has the DataRepeater control. I used this control in my c# winform application. in my system everything is running fine. now i copied the debug folder to other system which has only .Net Framework 3.5 SP1 installed. in this system is giving me error cannot load dependency Microsoft.VisualBasic.PowerPacks.dll even i set the Copy Local to "true" for "Microsoft.VisualBasic.dll" and "Microsoft.VisualBasic.PowerPacks.Vs.dll" please tell me how to solve this problem

  Read the article

• What is the Worst Depiction of Computer Use in a Movie

  - by Robert Cartaino

  You know the type: "It's a Unix system. I know this" -- in Jurassic park where a computer-genius girl sees a computer and quickly takes over like a 3-D video game, flying through the file system to shut down the park. [video link to the scene] So what's your favorite movie gaff that shows Hollywood can be completely clueless when it comes to portraying technology?

  Read the article

• Bandwidth for Silverlight Apps

  - by JAllen

  I have a idea of building sort of a simple online version of Microsoft Visio. The application will be built using silverlight capabilties. People will be able to design flowcharts similar to how they do in Visio and they will be able to collaborate and work simultaneously on the the design. Now, I need to get an idea of the bandwidth such an application might consume. I am not sure how silverligt internally work so I need to get an idea whether such an application can be built in a way that make it economically feasible to sell such a product in a software as a service model.

  Read the article

• Enable access for assistive device programmatically

  - by Dheeraj

  Hi All, I want to enable Access for assistive devices in System Preferences programmatically. But Problem is that my application is not running as root user and i do not want my application to be as root user and also should not ask for any authentication in between. I want to tap all keyboard events globally. I am using CGEventTapCreate() for the same.In the documentation of CGEventTapCreate() API it is mentioned that, Event taps receive key up and key down events if one of the following conditions is true: The current process is running as the root user. Access for assistive devices is enabled. In Mac OS X v10.4 & later, you can enable this feature using System Preferences, Universal Access panel, Keyboard view. I tried manually by checking the Enable Access for assistive devices from System Preference and it gives me expected output. So is there any way to do the same via program without asking for authentication and also application is not running as root user? Thanks, Dheeraj.

  Read the article

• extend web server to serve static files

  - by Turtle

  Hello, I want to extend a web server which is only able to handle RPC handling now. The web server is written in C#. It provides a abstract handler function like following: public string owsHandler(string request, string path, string param, OSHttpRequest httpRequest, OSHttpResponse httpResponse) And I wrote following code to handle image files: Bitmap queryImg = new Bitmap(path); System.IO.MemoryStream stream = new System.IO.MemoryStream(); queryImg.Save(stream, System.Drawing.Imaging.ImageFormat.Bmp); queryImg.Dispose(); byte[] byteImage = stream.ToArray(); stream.Dispose(); return Convert.ToBase64String(byteImage); And I test it in the browser, the image is returned but the image dimension info is missed. Shall I add something more to the code? Or is any general way to server static files? I do not want to serve it in a ASP.net server. Thanks

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Linking IronPython to WPF

  - by DonnyD

  I just installed VS2010 and the great new IronPython Tools extension. Currently this extension doesn't yet generate event handlers in code upon double-clicking wpf visual controls. Is there anyone that can provide or point me to an example as to how to code wpf event handlers manually in python. I've had no luck finding any and I am new to visual studio. Upon generating a new ipython wpf project the auto-generated code is: import clr clr.AddReference('PresentationFramework') from System.Windows.Markup import XamlReader from System.Windows import Application from System.IO import FileStream, FileMode app = Application() app.Run(XamlReader.Load(FileStream('WpfApplication7.xaml', FileMode.Open))) and the XAML is: <Window xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="WpfApplication7" Height="300" Width="300"> <Button>Click Me</Button> </Window> Any help would be appreciated.

  Read the article

• SSH Advanced Logging

  - by Radek Šimko

  I've installed OpenSUSE on my server and want to set ssh to log every command, which is send to system over it. I've found this in my sshd_config: # Logging # obsoletes QuietMode and FascistLogging #SyslogFacility AUTH #LogLevel INFO I guess that both of those directives has to be uncommented, but I'd like to log every command, not only authorization (login/logout via SSH). I just want to know, if someone breaks into my system, what did he do.

  Read the article

• WxPython Incompatible With Snow Leopard?

  - by Alex

  Hello all, Recently I upgraded to Snow Leopard, and now I can't run programs built with wxPython. The errors I get are (from Eclipse + PyDev): import wx File "/var/tmp/wxWidgets/wxWidgets-13~231/2.6/DSTROOT/System/Library/Frameworks /Python.framework/Versions/2.6/Extras/lib/ python/wx-2.8-mac-unicode/wx/__init__.py", line 45, in <module> File "/var/tmp/wxWidgets/wxWidgets-13~231/2.6/DSTROOT /System/Library/Frameworks/Python.framework/Versions/2.6/Extras/lib /python/wx-2.8-mac-unicode/wx/_core.py", line 4, in <module> ImportError:/System/Library/Frameworks /Python.framework/Versions/2.6/Extras/lib/python /wx-2.8-mac-unicode/wx/_core_.so: no appropriate 64-bit architecture (see "man python" for running in 32-bit mode) I don't really understand them and would appreciate if you could help me to do so, also, if you do know what's going on, how can I go about fixing them? Maybe this has something to do with the fact that Snow Leopard is 64-bit? Thanks!!

  Read the article

• MSSQL Search Proper Names Full Text Index vs LIKE + SOUNDEX

  - by Matthew Talbert

  I have a database of names of people that has (currently) 35 million rows. I need to know what is the best method for quickly searching these names. The current system (not designed by me), simply has the first and last name columns indexed and uses "LIKE" queries with the additional option of using SOUNDEX (though I'm not sure this is actually used much). Performance has always been a problem with this system, and so currently the searches are limited to 200 results (which still takes too long to run). So, I have a few questions: Does full text index work well for proper names? If so, what is the best way to query proper names? (CONTAINS, FREETEXT, etc) Is there some other system (like Lucene.net) that would be better? Just for reference, I'm using Fluent NHibernate for data access, so methods that work will with that will be preferred. I'm using MS SQL 2008 currently.

  Read the article

• Location of the fonts on the iPhone?

  - by Kyle

  I'm using the FreeType2 library in an iPhone project, and I'm trying to simply load a TTF file from the system, if possible. FT_Library library; FT_Face face; int error; error = FT_Init_FreeType( &library ); if ( error == 0 ) printf("Initialized FreeType2\r\n"); /* Prints */ error = FT_New_Face(library, "/System/Library/Fonts/Helvetica.ttf", 0, &face); if ( error == FT_Err_Cannot_Open_Resource ) printf("Font not found\r\n"); /* Prints */ That error seems to be for file not found. Is /System/Library/Fonts not the location of the fonts? Or, do iPhone apps simply not have any read access at all to that directory. Thanks!

  Read the article

• Deployment Problem after using DataRepeater of MS Visual Bacis power pack

  - by Mohsan

  hi. Microsoft Visual Studio 2008 Service pack 1 comes with Visual Basic Powerpacks which has the DataRepeater control. I used this control in my c# winform application. in my system everything is running fine. now i copied the debug folder to other system which has only .Net Framework 3.5 SP1 installed. in this system is giving me error cannot load dependency Microsoft.VisualBasic.PowerPacks.dll even i set the Copy Local to "true" for "Microsoft.VisualBasic.dll" and "Microsoft.VisualBasic.PowerPacks.Vs.dll" please tell me how to solve this problem

  Read the article

• A new method of supporting FOSS?

  - by James

  I have been kicking an idea around for sometime and wondered if something of it's nature hadn't already been invented. The premise is a website that integrates code management, project/team management, and micro-transactions. Donations, in and of themselves, are a sporadic, and unreliable method of supporting developers. Furthermore most free software that accepts donations is started by programmers ,be it to learn, because of a hobby, or because they saw a niche that needed to be filled. There is no method in place of of saying "hay, the FOSS community needs this kind of software, will someone develop it, and accept donations!?" Programmers should be programming, not busy begging for money. Basically the idea is people can go to the site in question, and start a project or make a request. Anyone signed up with the site can start a request. Each member account is free to support or "upvote" a project request. Requests and the associated number of votes let programmers in the community know the needs of the community. When a project is started a request for developers can be put forth. Developers have a ranking based on commits to other projects. The project founder can send invites to known Developers, or accept invites from members based on developer ranking. Once the project has at least one team-member, an objectives sheet or "draft" can be put out, listing design, goals, and features. The founding member and each team-member may contribute to this sheet. Each "milestone", or "Feature" is represented by an article. An article is any unit of a draft that can be voted on by The Project Founder, Team-members, and contributors...which brings me to the next half of this idea. --Microtransactions-- People signed up with this hypothetical website can purchase credits which then can be transfered to projects they would like to support. Anyone who transfers credits to a project is known as a contributor to that project. At anytime a Founder, or the lead team-member may submit an article, or a design (multiple articles) for consideration. All team-members, as well as the Founder, can vote once for each article freely. Contributors may vote yes or no on a number of articles (independent of any given meeting where a particular design or article is considered) equal to the number of credits they have placed into a contributors fund for that particular project. A contributors fund is a proxy between a sites credit account, and a projects credit account. It is sort of like a promise to contribute, instead of an actual contribution. Contributers may place constraints on particular articles such that if those constraints (a yes or no vote) are satisfied then a manually specified amount of credits is automatically transfered to the project account. This allows a project to develop based on the needs of those who may (in the future) financially rely on the project. --- Code commits & milestones --- When a team-member makes a commit, they may specify if it's a minor commit, a bug fix, a compatibility patch (i.e. for a new platform), or a milestone (an article voted on previously). People signed up with the website, may download the updated project and test it to see if the programmer's assertion is true about the commit. A report may then be filed on a small form, giving a one or two paragraphs, and a positive or negative confirmation of the programmer's goal for that particular commit. After all milestones for a particular draft are complete, a new draft is submitted for voting. Also funds may withdrawn by each team-member based on the proportion of commits and milestones confirmed (fulfilled the stated purpose) for each programmer. --- voting --- Members, contributor, and non-contributor, may make priority requests for particular articles of a draft. The project founder may or may not opt to fill those requests based on the volume of upvotes. A fulfilled priority request means that any team-member that makes a community-confirmed commit for an article is, when all articles for the draft are fulfilled, granted a portion of project credits in proportion to the average priority of all the articles he committed. ---- Notes --- While this is horribly prone to design-by-committee the one saving grace is that the lead team-member may place constraints on a draft such that some, or ALL articles must be voted yes. Commits may not begin until a draft satisfying said constraints is approved. What does SO think, is this idea feasible? Does anyone see major problems with this? Is there any insights, or improvements that could be made?

  Read the article

• Networking: Adding specific route for printer, on Mac Connected to Two Networks

  - by Jordan

  I have a Mac connected to two different networks (wireless en1 and ethernet en0 ). The ethernet network is the preferred (System Preferences-Set Service Order). I'd like to be able to print to a printer on the wireless network side, without having to go to System Preferences and make the wireless network come first in the service order. Is there a way to add a route for a specific printer?

  Read the article

• How to take a screenshot with Mono C#?

  - by vagabond

  I'm trying to use use code get a screenshot in Mono C# but I'm getting a System.NotImplementedException when I call CopyFromScreen. My code works with .NET, so is there an alternate way of getting a screenshot using Mono? Bitmap bitmap = new Bitmap(Screen.PrimaryScreen.Bounds.Width, Screen.PrimaryScreen.Bounds.Height); Graphics graphics = Graphics.FromImage(bitmap as Image); graphics.CopyFromScreen(0, 0, 0, 0, bitmap.Size); System.IO.MemoryStream memoryStream = new System.IO.MemoryStream(); bitmap.Save(memoryStream, imageFormat); bitmap.Save(@"\tmp\screenshot.png", ImageFormat.Png); I am using Mono JIT compiler version 2.4.2.3 (Debian 2.4.2.3+dfsg-2)

  Read the article

• jquery slideUp() and slideDown() problems

  - by nhoss2

  Hello, I am very crap at jquery, and im having some trouble with the slideUp() and slideDown() animations. I have been working on a vCard design similar to tim van damme's site. here is a the link to the design: link. When you click on the portfolio or work button, the text or image appears first before the div finishes sliding down. I would like the div to slide down first and then show the text... This currently works when you click on the contact button or the home button on the top navigation bar, but does not work for the portfolio button and the work button. I have a hunch that this may not even be a jquery problem, and that its just my bad css code, but I have skimmed through the css code, and changed things like z-index, but that hasnt worked.

  Read the article

• Should I worry about the integrity of my linux software RAID5 after a crash or kernel panic?

  - by Josh

  I have a dual core Intel i5 Ubuntu Server 10.04 LTS system running kernel 2.6.32-22-server #33-Ubuntu SMP with three 1TB SATA hard drives set up in a RAID5 array using linux md devices. I have read about the RAID5 write hole and am concerned: if my linux system locks up or kernel panics, should I be assume that the integrety of my data has been compromised and restore from backup? How can I know if the data on the RAID5 array is "safe"?

  Read the article

• Routing and Remote Access Service won't start after full disk

  - by NKCSS

  The HDD of the server was out of disk space, and after a reboot, RRAS won't start anymore on my 2008 R2 server. Error Details: Log Name: System Source: RemoteAccess Date: 2/5/2012 9:39:52 PM Event ID: 20153 Task Category: None Level: Error Keywords: Classic User: N/A Computer: Windows14111.<snip> Description: The currently configured accounting provider failed to load and initialize successfully. The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error. Event Xml: <Event xmlns="http://schemas.microsoft.com/win/2004/08/events/event"> <System> <Provider Name="RemoteAccess" /> <EventID Qualifiers="0">20153</EventID> <Level>2</Level> <Task>0</Task> <Keywords>0x80000000000000</Keywords> <TimeCreated SystemTime="2012-02-05T20:39:52.000Z" /> <EventRecordID>12148869</EventRecordID> <Channel>System</Channel> <Computer>Windows14111.<snip></Computer> <Security /> </System> <EventData> <Data>The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error.</Data> <Binary>2C030000</Binary> </EventData> </Event> I think it has something to do with a corrupt config file, but I am unsure of what to do. I Removed the RRAS role, rebooted, and re-added, but it keeps failing with the same error. Thanks in advance. [UPDATE] If i set the accounting provider from 'Windows' to '' the service starts but VPN won't work. Any ideas how this can be repaired?

  Read the article

• C# LINQ Where Predicate Type Arguments

  - by blu

  I have an XElement with values for mock data. I have an expression to query the xml: Expression<Func<XElement, bool>> simpleXmlFunction = b => int.Parse(b.Element("FooId").Value) == 12; used in: var simpleXml = xml.Elements("Foo").Where(simpleXmlFunction).First(); The design time error is: The type arguments for method 'System.Linq.Enumerable.Where(System.Collections.Generic.IEnumerable, System.Func)' cannot be inferred from the usage. Try specifying the type arguments explicitly' The delegate supplied to Where should take in an XElement and return a bool, marking if the item matches the query, I am not sure how to add anything more to the delegate or the where clause to mark the type. Also, the parallel method for the real function against the Entity Framework does not have this issue. What is not correct with the LINQ-to-XML version?

  Read the article

• WebConfigurationManager error after adding siteMap

  - by aron

  Hello I'm getting this error: Compiler Error Message: CS0118: 'Configuration' is a 'namespace' but is used like a 'type' Configuration myWebConfig = WebConfigurationManager.OpenWebConfiguration("~/"); This code has been in place for 5+ months without this issues, only today after adding this sitemap code do I have this issue. <siteMap defaultProvider="ExtendedSiteMapProvider" enabled="true"> <providers> <clear/> <add name="ExtendedSiteMapProvider" type="Configuration.ExtendedSiteMapProvider" siteMapFile="Web.sitemap" securityTrimmingEnabled="true"/> </providers> </siteMap> I tried adding "System.Web." before the "Configuration ", but that did not work either: System.Web.Configuration myWebConfig = WebConfigurationManager.OpenWebConfiguration("~/"); Error 1 'System.Web.Configuration' is a 'namespace' but is used like a 'type'

  Read the article

< Previous Page | 702 703 704 705 706 707 708 709 710 711 712 713  | Next Page >