Search Results

Search found 26947 results on 1078 pages for 'util linux'.

Page 737/1078 | < Previous Page | 733 734 735 736 737 738 739 740 741 742 743 744  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Why is there a seemingly identical copy of the JDK 1.5 core runtime in org.osgi.foundation-1.0.0.jar?

    - by Jonathan Neufeld
    I am maintaining a web application that depends on OSGi and Maven pulls-in a jar called org.osgi-foundation-1.0.0.jar that seems to contain the same classes as part of the JDK core runtime such as: java.util.*; java.io.*; etc. and so on. This seems very strange and I have to ask why this is necessary. More-over, my web-application fails to deploy on JBoss 6 because these are "illegal package names" for a third-party library. What is the purpose of org.osgi-foundation-1.0.0.jar ? is it necessary?

    Read the article

  • Type-safe, generic, empty Collections with static generics

    - by Droo
    I return empty collections vs. null whenever possible. I switch between two methods for doing so using java.util.Collections: return Collections.EMPTY_LIST; return Collections.emptyList(); where emptyList() is supposed to be type-safe. But I recently discovered: return Collections.<ComplexObject> emptyList(); return Collections.<ComplexObject> singletonList(new ComplexObject()); etc. I see this method in Eclipse Package Explorer: <clinit> () : void but I don't see how this is done in the source code (1.5). How is this magic tomfoolerie happening!!

    Read the article

  • Understanding the workings of equals and hashCode in a HashMap

    - by andandandand
    I have this test code: import java.util.*; class MapEQ { public static void main(String[] args) { Map<ToDos, String> m = new HashMap<ToDos, String>(); ToDos t1 = new ToDos("Monday"); ToDos t2 = new ToDos("Monday"); ToDos t3 = new ToDos("Tuesday"); m.put(t1, "doLaundry"); m.put(t2, "payBills"); m.put(t3, "cleanAttic"); System.out.println(m.size()); } } class ToDos{ String day; ToDos(String d) { day = d; } public boolean equals(Object o) { return ((ToDos)o).day == this.day; } // public int hashCode() { return 9; } } When // public int hashCode() { return 9; } is uncommented m.size() returns 2, when it's left commented it returns three. Why?

    Read the article

  • Mono doesn't write settings defaults

    - by Petar Minchev
    Hi guys! Here is my problem. If I use only one Windows Forms project and call only - Settings.Default.Save() when running it, Mono creates a user.config file with the default value for each setting. It is fine, so far so good. But now I add a class library project, which is referenced from the Windows Forms project and I move the settings from the Windows Forms project to the Class Library one. Now I do the same - Settings.Default.Save() and to my great surprise, Mono creates a user.config file with EMPTY values(NOT the default ones) for each setting?! What's the difference between having the settings in the Windows Forms Project or in the class library one? And by the way it is not a operating system issue. It is a Mono issue, because it doesn't work both under Windows and Linux. If I don't use Mono everything is fine, but I have to port my application to Linux, so I have to use Mono. I am really frustrated, it is blocking a project:( Thanks in advance for any suggestion you have. Regards, Petar

    Read the article

  • What causes this retainAll exception?

    - by Joren
    java.lang.UnsupportedOperationException: This operation is not supported on Query Results at org.datanucleus.store.query.AbstractQueryResult.contains(AbstractQueryResult.java:250) at java.util.AbstractCollection.retainAll(AbstractCollection.java:369) at namespace.MyServlet.doGet(MyServlet.java:101) I'm attempting to take one list I retrieved from a datastore query, and keep only the results which are also in a list I retrieved from a list of keys. Both my lists are populated as expected, but I can't seem to user retainAll on either one of them. // List<Data> listOne = new ArrayList(query.execute(theQuery)); // DatastoreService ds = DatastoreServiceFactory.getDatastoreService(); // List<Data> listTwo = new ArrayList(ds.get(keys).values()); // listOne.retainAll(listTwo);

    Read the article

  • Java - Parsing a Date from a String

    - by Yatendra Goel
    I want to parse a java.util.Date from a String. I tried the following code but got unexpected output: Date getDate() { Date date = null; SimpleDateFormat sdf = new SimpleDateFormat("EEE MMM dd"); try { date = sdf.parse("Sat May 11"); } catch (ParseException ex) { Logger.getLogger(URLExtractor.class.getName()).log(Level.SEVERE, null, ex); return null; } return date; } When I run the above code, I got the following output: Mon May 11 00:00:00 IST 1970

    Read the article

  • Riddle: Spot the serious bug in this bubble sort implementation

    - by ripper234
    (No, this isn't a homework assignment, I just found the bug and thought it might be useful to share it here) import java.util.List; public class BubbleSorter { public <T extends Comparable<T>> void sort(List<T> list) { while (true) { boolean didWork = false; for (int i = 0; i < list.size() - 1; ++i) { if (list.get(i).compareTo(list.get(i + 1)) > 0) { swap(list, i, i + 1); didWork = true; break; } } if (!didWork) return; } } private static <T> void swap(List<T> list, int i, int j) { T tmp = list.get(i); list.set(i, list.get(j)); list.set(j, tmp); } }

    Read the article

  • Read entire file in Scala?

    - by Brendan OConnor
    What's a simple and canonical way to read an entire file into memory in Scala? (Ideally, with control over character encoding.) The best I can come up with is: scala.io.Source.fromPath("file.txt").getLines.reduceLeft(_+_) or am I supposed to use one of Java's god-awful idioms, the best of which (without using an external library) seems to be: import java.util.Scanner import java.io.File new Scanner(new File("file.txt")).useDelimiter("\\Z").next() From reading mailing list discussions, it's not clear to me that scala.io.Source is even supposed to be the canonical I/O library. I don't understand what its intended purpose is, exactly. ... I'd like something dead-simple and easy to remember. For example, in these languages it's very hard to forget the idiom ... Ruby open("file.txt").read Ruby File.read("file.txt") Python open("file.txt").read()

    Read the article

  • Avoid implicit conversion from date to timestamp for selects with Oracle using Hibernate

    - by sapporo
    I'm using Hibernate 3.2.7.GA criteria queries to select rows from an Oracle Enterprise Edition 10.2.0.4.0 database, filtering by a timestamp field. The field in question is of type java.util.Date in Java, and DATE in Oracle. It turns out that the field gets mapped to java.sql.Timestamp, and Oracle converts all rows to TIMESTAMP before comparing to the passed in value, bypassing the index and thereby ruining performance. One solution would be to use Hibernate's sqlRestriction() along with Oracle's TO_DATE function. That would fix performance, but requires rewriting the application code (lots of queries). So is there a more elegant solution? Since Hibernate already does type mapping, could it be configured to do the right thing? Update: The problem occurs in a variety of configurations, but here's one specific example: Oracle Enterprise Edition 10.2.0.4.0 Oracle JDBC Driver 11.1.0.7.0 Hibernate 3.2.7.GA Hibernate's Oracle10gDialect Java 1.6.0_16

    Read the article

  • Sensible unit test possible?

    - by nkr1pt
    Could a sensible unit test be written for this code which extracts a rar archive by delegating it to a capable tool on the host system if one exists? I can write a test case based on the fact that my machine runs linux and the unrar tool is installed, but if another developer who runs windows would check out the code the test would fail, although there would be nothing wrong with the extractor code. I need to find a way to write a meaningful test which is not binded to the system and unrar tool installed. How would you tackle this? public class Extractor { private EventBus eventBus; private ExtractCommand[] linuxExtractCommands = new ExtractCommand[]{new LinuxUnrarCommand()}; private ExtractCommand[] windowsExtractCommands = new ExtractCommand[]{}; private ExtractCommand[] macExtractCommands = new ExtractCommand[]{}; @Inject public Extractor(EventBus eventBus) { this.eventBus = eventBus; } public boolean extract(DownloadCandidate downloadCandidate) { for (ExtractCommand command : getSystemSpecificExtractCommands()) { if (command.extract(downloadCandidate)) { eventBus.fireEvent(this, new ExtractCompletedEvent()); return true; } } eventBus.fireEvent(this, new ExtractFailedEvent()); return false; } private ExtractCommand[] getSystemSpecificExtractCommands() { String os = System.getProperty("os.name"); if (Pattern.compile("linux", Pattern.CASE_INSENSITIVE).matcher(os).find()) { return linuxExtractCommands; } else if (Pattern.compile("windows", Pattern.CASE_INSENSITIVE).matcher(os).find()) { return windowsExtractCommands; } else if (Pattern.compile("mac os x", Pattern.CASE_INSENSITIVE).matcher(os).find()) { return macExtractCommands; } return null; } }

    Read the article

  • Java: conditional initialization?

    - by HH
    Ruby has conditional initialization. Apparently, Java does not or does it? I try to write more succintly, to limit the range as small as possible. import java.io.*; import java.util.*; public class InitFor{ public static void main(String[] args){ for(int i=7,k=999;i+((String h="hello").size())<10;i++){} System.out.println("It should be: hello = "+h); } } Errors Press ENTER or type command to continue InitFor.java:8: ')' expected for(int i=7,k=999;i+((String h="hello").size())<10;i++){} ^

    Read the article

  • Cross-Platform Language + GUI Toolkit for Prototyping Multimedia Applications

    - by msutherl
    I'm looking for a language + GUI toolkit for rapidly prototyping utility applications for multimedia installations. I've been working with Max/MSP/Jitter for many years, but I'd like to add a text-based language to my 'arsenal' for tasks apart from 'content production'. (When it comes to actual media synthesis, my choices are clear [SuperCollider + MSP for audio, Jitter + Quartz + openFrameworks for video]). I'm looking for something that maintains some of the advantages of Max, but is lower-level, faster, more cross-platfrom (Linux support), and text-based. Integration with powerful sound/video libraries is not a requirement. Some requirements: Cross-platform (at least OSX and Linux, Windows is a plus) Fast and easy cross-platform GUIs with no platform-specific modification GUI code separated from backend code as much as possible Good for interfacing with external serial devices (micro-controllers) Good network support (UDP/TCP) Good libraries for multi-media (video, sound, OSC) are a plus Asynchronous synchronous UNIX integration is a plus The options that come to mind: AS3/Flex (not a fan of AS3 or the idea of running in the Flash Player) openFrameworks (C++ framework, perhaps a bit too low level [looking for fast development time] and biased toward video work) Java w/ Processing libraries (like openFrameworks, just slower) Python + Qt (is Qt appropriate for rapid prototyping?) Python + Another GUI toolkit SuperCollider + Swing (yucky GUI development) Java w/ SWT Any other options? What do you recommend?

    Read the article

  • How do I use the sed command to remove all lines between 2 phrases (including the phrases themselves

    - by fzkl
    I am generating a log from which I want to remove X startup output which looks like this: X.Org X Server 1.7.6 Release Date: 2010-03-17 X Protocol Version 11, Revision 0 Build Operating System: Linux 2.6.31-607-imx51 armv7l Ubuntu Current Operating System: Linux nvidia 2.6.33.2 #1 SMP PREEMPT Mon May 31 21:38:29 PDT 2010 armv7l Kernel command line: mem=448M@0M nvmem=64M@448M mem=512M@512M chipuid=097c81c6425f70d7 vmalloc=320M video=tegrafb console=ttyS0,57600n8 usbcore.old_scheme_first=1 tegraboot=nand root=/dev/nfs ip=:::::usb0:on rw tegra_ehci_probe_delay=5000 smp dvfs tegrapart=recovery:1b80:a00:800,boot:2680:1000:800,environment:3780:40:800,system:38c0:2bc00:800,cache:2f5c0:4000:800,userdata:336c0:c840:800 envsector=3080 Build Date: 23 April 2010 05:19:26PM xorg-server 2:1.7.6-2ubuntu7 (Bryce Harrington <[email protected]>) Current version of pixman: 0.16.4 Before reporting problems, check http://wiki.x.org to make sure that you have the latest version. Markers: (--) probed, (**) from config file, (==) default setting, (++) from command line, (!!) notice, (II) informational, (WW) warning, (EE) error, (NI) not implemented, (??) unknown. (==) Log file: "/var/log/Xorg.0.log", Time: Wed Jun 16 19:52:00 2010 (==) Using config file: "/etc/X11/xorg.conf" (==) Using config directory: "/usr/lib/X11/xorg.conf.d" Is there any way to do this without manually checking pattern for each line?

    Read the article

  • How do implement a breadth first traversal?

    - by not looking for answer
    //This is what I have. I thought pre-order was the same and mixed it up with depth first! import java.util.LinkedList; import java.util.Queue; public class Exercise25_1 { public static void main(String[] args) { BinaryTree tree = new BinaryTree(new Integer[] {10, 5, 15, 12, 4, 8 }); System.out.print("\nInorder: "); tree.inorder(); System.out.print("\nPreorder: "); tree.preorder(); System.out.print("\nPostorder: "); tree.postorder(); //call the breadth method to test it System.out.print("\nBreadthFirst:"); tree.breadth(); } } class BinaryTree { private TreeNode root; /** Create a default binary tree */ public BinaryTree() { } /** Create a binary tree from an array of objects */ public BinaryTree(Object[] objects) { for (int i = 0; i < objects.length; i++) { insert(objects[i]); } } /** Search element o in this binary tree */ public boolean search(Object o) { return search(o, root); } public boolean search(Object o, TreeNode root) { if (root == null) { return false; } if (root.element.equals(o)) { return true; } else { return search(o, root.left) || search(o, root.right); } } /** Return the number of nodes in this binary tree */ public int size() { return size(root); } public int size(TreeNode root) { if (root == null) { return 0; } else { return 1 + size(root.left) + size(root.right); } } /** Return the depth of this binary tree. Depth is the * number of the nodes in the longest path of the tree */ public int depth() { return depth(root); } public int depth(TreeNode root) { if (root == null) { return 0; } else { return 1 + Math.max(depth(root.left), depth(root.right)); } } /** Insert element o into the binary tree * Return true if the element is inserted successfully */ public boolean insert(Object o) { if (root == null) { root = new TreeNode(o); // Create a new root } else { // Locate the parent node TreeNode parent = null; TreeNode current = root; while (current != null) { if (((Comparable)o).compareTo(current.element) < 0) { parent = current; current = current.left; } else if (((Comparable)o).compareTo(current.element) > 0) { parent = current; current = current.right; } else { return false; // Duplicate node not inserted } } // Create the new node and attach it to the parent node if (((Comparable)o).compareTo(parent.element) < 0) { parent.left = new TreeNode(o); } else { parent.right = new TreeNode(o); } } return true; // Element inserted } public void breadth() { breadth(root); } // Implement this method to produce a breadth first // search traversal public void breadth(TreeNode root){ if (root == null) return; System.out.print(root.element + " "); breadth(root.left); breadth(root.right); } /** Inorder traversal */ public void inorder() { inorder(root); } /** Inorder traversal from a subtree */ private void inorder(TreeNode root) { if (root == null) { return; } inorder(root.left); System.out.print(root.element + " "); inorder(root.right); } /** Postorder traversal */ public void postorder() { postorder(root); } /** Postorder traversal from a subtree */ private void postorder(TreeNode root) { if (root == null) { return; } postorder(root.left); postorder(root.right); System.out.print(root.element + " "); } /** Preorder traversal */ public void preorder() { preorder(root); } /** Preorder traversal from a subtree */ private void preorder(TreeNode root) { if (root == null) { return; } System.out.print(root.element + " "); preorder(root.left); preorder(root.right); } /** Inner class tree node */ private class TreeNode { Object element; TreeNode left; TreeNode right; public TreeNode(Object o) { element = o; } } }

    Read the article

  • adjust selected File to FileFilter in a JFileChooser

    - by amarillion
    I'm writing a diagram editor in java. This app has the option to export to various standard image formats such as .jpg, .png etc. When the user clicks File-Export, you get a JFileChooser which has a number of FileFilters in it, for .jpg, .png etc. Now here is my question: Is there a way to have the extension of the default adjust to the selected file filter? E.g. if the document is named "lolcat" then the default option should be "lolcat.png" when the png filter is selected, and when the user selects the jpg file filter, the default should change to "lolcat.jpg" automatically. Is this possible? How can I do it? edit: Based on the answer below, I wrote some code. But it doesn't quite work yet. I've added a propertyChangeListener to the FILE_FILTER_CHANGED_PROPERTY, but it seems that within this method getSelectedFile() returns null. Here is the code. package nl.helixsoft; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.beans.PropertyChangeEvent; import java.beans.PropertyChangeListener; import java.io.File; import java.util.ArrayList; import java.util.List; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.filechooser.FileFilter; public class JFileChooserTest { public class SimpleFileFilter extends FileFilter { private String desc; private List<String> extensions; private boolean showDirectories; /** * @param name example: "Data files" * @param glob example: "*.txt|*.csv" */ public SimpleFileFilter (String name, String globs) { extensions = new ArrayList<String>(); for (String glob : globs.split("\\|")) { if (!glob.startsWith("*.")) throw new IllegalArgumentException("expected list of globs like \"*.txt|*.csv\""); // cut off "*" // store only lower case (make comparison case insensitive) extensions.add (glob.substring(1).toLowerCase()); } desc = name + " (" + globs + ")"; } public SimpleFileFilter(String name, String globs, boolean showDirectories) { this(name, globs); this.showDirectories = showDirectories; } @Override public boolean accept(File file) { if(showDirectories && file.isDirectory()) { return true; } String fileName = file.toString().toLowerCase(); for (String extension : extensions) { if (fileName.endsWith (extension)) { return true; } } return false; } @Override public String getDescription() { return desc; } /** * @return includes '.' */ public String getFirstExtension() { return extensions.get(0); } } void export() { String documentTitle = "lolcat"; final JFileChooser jfc = new JFileChooser(); jfc.setDialogTitle("Export"); jfc.setDialogType(JFileChooser.SAVE_DIALOG); jfc.setSelectedFile(new File (documentTitle)); jfc.addChoosableFileFilter(new SimpleFileFilter("JPEG", "*.jpg")); jfc.addChoosableFileFilter(new SimpleFileFilter("PNG", "*.png")); jfc.addPropertyChangeListener(JFileChooser.FILE_FILTER_CHANGED_PROPERTY, new PropertyChangeListener() { public void propertyChange(PropertyChangeEvent arg0) { System.out.println ("Property changed"); String extold = null; String extnew = null; if (arg0.getOldValue() == null || !(arg0.getOldValue() instanceof SimpleFileFilter)) return; if (arg0.getNewValue() == null || !(arg0.getNewValue() instanceof SimpleFileFilter)) return; SimpleFileFilter oldValue = ((SimpleFileFilter)arg0.getOldValue()); SimpleFileFilter newValue = ((SimpleFileFilter)arg0.getNewValue()); extold = oldValue.getFirstExtension(); extnew = newValue.getFirstExtension(); String filename = "" + jfc.getSelectedFile(); System.out.println ("file: " + filename + " old: " + extold + ", new: " + extnew); if (filename.endsWith(extold)) { filename.replace(extold, extnew); } else { filename += extnew; } jfc.setSelectedFile(new File (filename)); } }); jfc.showDialog(frame, "export"); } JFrame frame; void run() { frame = new JFrame(); JButton btn = new JButton ("export"); frame.add (btn); btn.addActionListener (new ActionListener() { public void actionPerformed(ActionEvent ae) { export(); } }); frame.setSize (300, 300); frame.pack(); frame.setVisible(true); } public static void main(String[] args) { javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { JFileChooserTest x = new JFileChooserTest(); x.run(); } }); } }

    Read the article

  • Why does Java's TreeSet not specify that its type parameter must extend Comparable?

    - by Tarski
    e.g. The code below throws a ClassCastException when the second Object is added to the TreeSet. Couldn't TreeSet have been written so that the type parameter can only be a Comparable type? i.e. TreeSet would not compile because Object is not Comparable. That way generics actually do their job - of being typesafe. import java.util.TreeSet; public class TreeSetTest { public static void main(String [] args) { TreeSet<Object> t = new TreeSet<Object>(); t.add(new Object()); t.add(new Object()); } }

    Read the article

  • How do I create a python module from a fortran program with f2py?

    - by Lars Hellemo
    I am trying to read some smps files with python, and found a fortran implementation, so I thought I would give f2py a shot. The problem is that I have no experience with fortran. I have successfully installed gfortran and f2py on my Linux box and ran the example on thew f2py page, but I have some trouble compiling and running the large program. There are two files, one with a file reader wrapper and one with all the logic. They seem to call each other, but when I compile and link or try f2py, I get errors that they somehow can't find each other: f95 -c FILEWR~1.F f95 -c SMPSREAD.F90 f95 -o smpsread SMPSREAD.o FILEWR~1.o FILEWR~1.o In function `file_wrapper_' FILEWR~1.F(.text+0x3d) undefined reference to `chopen_' usrlibgcci486-linux-gnu4.4.1libgfortranbegin.a(fmain.o) In function `main' (.text+0x27) undefined reference to `MAIN__' collect2 ld returned 1 exit status I also tried changing the name to FILE_WRAPPER.F but that did not help. With f2py I found out I had to include a comment to get it to accept free format, and saved this as a new file and tried: f2py -c -m smpsread smpsread.f90 I get a lot of output and warnings, but the error seems to be this one: getctype: No C-type found in "{'typespec': 'type', 'attrspec': ['allocatable'], 'typename': 'node', 'dimension': [':']}", assuming void. The fortran 90 spms reader can be found here. Any help or suggestions appreciated.

    Read the article

  • input file cannot be found

    - by Eric Smith
    I am just messing around with reading input files with java until I got stumped at the most basic of steps... finding the input file! The input.txt file is in the same directory as my class file that is calling it yet eclipse still gives me an error that it cant be found: "Exception in thread "main" java.lang.Error: Unresolved compilation problem: Unhandled exception type FileNotFoundException" My code: package pa; import java.util.Scanner; public class Project { public static void main(String[] args) { java.io.File file = new java.io.File("input.txt"); System.out.println(file.getAbsolutePath()); Scanner input = new Scanner(file); } } input.txt is in the same package, same folder and everything. I'm confused :(

    Read the article

  • What benefits can Java developer have from moving to a *NIX platform?

    - by dave-keiture
    Hi everyone, A friend of mine is a Java developer, who's using *NIX for ages. He claims that *NIX is for real Java geeks, whereas WIN is for dummies (and I'm one of them, according to him) and girls. When I ask him to argue his position, and explain, what's so good for Java developer on *NIX, he starts talking about console, wget, curl and grep. But sorry, wget and curl analogues exist for the WIN platform as well. As for the console - I'm using FAR Commander, and have access to the command line when I need. Moreover, even if I decide moving to *NIX, I will certainly use Netbeans or Eclipse on it, so there will be no big difference. Guys, who use Java on *NIX, could you please give me some real killer examples, when *NIX (any util or technique) dramatically increases Java development productivity (in the way the hints are given in "The Pragmatic Programmer"), or, which is also important, gives more fun from the process. Thanks in advance!

    Read the article

  • Using the stadard Java logging, is it possible to restart logs after a certain period?

    - by Fry
    I have some java code that will be running as an importer for data for a much larger project. The initial logging code was done with the java.util.logging classes, so I'd like to keep it if possible, but it seems to be a little inadequate now given he amount of data passing through the importer. Often times in the system, the importer will get data that the main system doesn't have information for or doesn't match the system's data so it is ignored but a message is written to the log about what information was dropped and why it wasn't imported. The problem is that this tends to grow in size very quickly, so we'd like to be able to start a fresh log daily or weekly. Does anybody have an idea if this can be done in the logging classes or would I have to switch to log4j or custom? Thanks for any help!

    Read the article

  • Stuck with the first record while parsing an XML in Java

    - by Ritwik G
    I am parsing the following XML : <table ID="customer"> <T><C_CUSTKEY>1</C_CUSTKEY><C_NAME>Customer#000000001</C_NAME><C_ADDRESS>IVhzIApeRb ot,c,E</C_ADDRESS><C_NATIONKEY>15</C_NATIONKEY><C_PHONE>25-989-741-2988</C_PHONE><C_ACCTBAL>711.56</C_ACCTBAL><C_MKTSEGMENT>BUILDING</C_MKTSEGMENT><C_COMMENT>regular, regular platelets are fluffily according to the even attainments. blithely iron</C_COMMENT></T> <T><C_CUSTKEY>2</C_CUSTKEY><C_NAME>Customer#000000002</C_NAME><C_ADDRESS>XSTf4,NCwDVaWNe6tEgvwfmRchLXak</C_ADDRESS><C_NATIONKEY>13</C_NATIONKEY><C_PHONE>23-768-687-3665</C_PHONE><C_ACCTBAL>121.65</C_ACCTBAL><C_MKTSEGMENT>AUTOMOBILE</C_MKTSEGMENT><C_COMMENT>furiously special deposits solve slyly. furiously even foxes wake alongside of the furiously ironic ideas. pending</C_COMMENT></T> <T><C_CUSTKEY>3</C_CUSTKEY><C_NAME>Customer#000000003</C_NAME><C_ADDRESS>MG9kdTD2WBHm</C_ADDRESS><C_NATIONKEY>1</C_NATIONKEY><C_PHONE>11-719-748-3364</C_PHONE><C_ACCTBAL>7498.12</C_ACCTBAL><C_MKTSEGMENT>AUTOMOBILE</C_MKTSEGMENT><C_COMMENT>special packages wake. slyly reg</C_COMMENT></T> <T><C_CUSTKEY>4</C_CUSTKEY><C_NAME>Customer#000000004</C_NAME><C_ADDRESS>XxVSJsLAGtn</C_ADDRESS><C_NATIONKEY>4</C_NATIONKEY><C_PHONE>14-128-190-5944</C_PHONE><C_ACCTBAL>2866.83</C_ACCTBAL><C_MKTSEGMENT>MACHINERY</C_MKTSEGMENT><C_COMMENT>slyly final accounts sublate carefully. slyly ironic asymptotes nod across the quickly regular pack</C_COMMENT></T> <T><C_CUSTKEY>5</C_CUSTKEY><C_NAME>Customer#000000005</C_NAME><C_ADDRESS>KvpyuHCplrB84WgAiGV6sYpZq7Tj</C_ADDRESS><C_NATIONKEY>3</C_NATIONKEY><C_PHONE>13-750-942-6364</C_PHONE><C_ACCTBAL>794.47</C_ACCTBAL><C_MKTSEGMENT>HOUSEHOLD</C_MKTSEGMENT><C_COMMENT>blithely final instructions haggle; stealthy sauternes nod; carefully regu</C_COMMENT></T> </table> with the following java code: package xmlparserformining; import java.util.List; import java.util.Iterator; import org.dom4j.Document; import org.dom4j.DocumentException; import org.dom4j.Node; import org.dom4j.io.SAXReader; public class XmlParserForMining { public static Document getDocument( final String xmlFileName ) { Document document = null; SAXReader reader = new SAXReader(); try { document = reader.read( xmlFileName ); } catch (DocumentException e) { e.printStackTrace(); } return document; } public static void main(String[] args) { String xmlFileName = "/home/r/javaCodez/parsing in java/customer.xml"; String xPath = "//table/T/C_ADDRESS"; Document document = getDocument( xmlFileName ); List<Node> nodes = document.selectNodes( xPath ); System.out.println(nodes.size()); for (Node node : nodes) { String customer_address = node.valueOf(xPath); System.out.println( "Customer address: " + customer_address); } } } However, instead of getting all the various customer records, I am getting the following output: 1500 Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E and so on .. What is wrong here? Why is it printing only the first record ?

    Read the article

  • Creating BlackBerry method stubs using wscompile on WSDL from ColdFusion

    - by Jim B
    I have been working on a BlackBerry application that consumes web services from ColdFusion 7. The Java ME SDK and the Java Wireless Toolkit both require that the generated WSDL be of the document/literal type. Fortunately, I have input on the web service development so I tried setting 'style="document"' in the cfcomponent tag. This generated a document/literal style WSDL but now wscompile generates the following errors in several places: Found unknown simple type: javax.xml.soap.SOAPElement Found unknown simple type: java.util.Calendar Any ideas why this is happening? The WSDL does get parsed correctly by the JWSDP tool but the stubs use namespaces that are not available in the J2ME platform. I would have thought ColdFusion WSDL would work more easily with other products in the Java family.

    Read the article

  • no such file to load -- rubygems (LoadError)

    - by Vineeth
    Hello, I recently installed rails in fedora 12. I'm new to linux as well. Everything works fine on Windows 7. But I'm facing lot of problems in linux. Help please! I've installed all the essentials to my knowledge to get the basic script/server up and running. I have this error from boot.rb popping up when I try script/server. Some of the details I'd like to give here: The directories where rails, ruby and gem are installed, [vineeth@localhost my_app]$ which ruby /usr/local/bin/ruby [vineeth@localhost my_app]$ which rails /usr/bin/rails [vineeth@localhost my_app]$ which gem /usr/bin/gem And when I run the script/server, this is the error. [vineeth@localhost my_app]$ script/server ./script/../config/boot.rb:9:in `require': no such file to load -- rubygems (LoadError) from ./script/../config/boot.rb:9 from script/server:2:in `require' from script/server:2 And the PATH file looks like this [vineeth@localhost my_app]$ cat ~/.bash_profile # .bash_profile # Get the aliases and functions if [ -f ~/.bashrc ]; then . ~/.bashrc fi # User specific environment and startup programs PATH=$PATH:$HOME/bin export PATH="/usr/local/bin:/usr/local/sbin:/usr/bin/ruby:$PATH" I suppose it is something to do with the PATH file. Let me know what I need to change here. If there are other changes I should make, please let me know, Thanks

    Read the article

  • Write a program that allows the user to enter a string and then prints the letters of the String sep

    - by WM
    The output is always a String, for example H,E,L,L,O,. How could I limit the commas? I want the commas only between letters, for example H,E,L,L,O. import java.util.Scanner; import java.lang.String; public class forLoop { public static void main(String[] args) { Scanner Scan = new Scanner(System.in); System.out.print("Enter a string: "); String Str1 = Scan.next(); String newString=""; String Str2 =""; for (int i=0; i < Str1.length(); i++) { newString = Str1.charAt(i) + ","; Str2 = Str2 + newString; } System.out.print(Str2); } }

    Read the article

< Previous Page | 733 734 735 736 737 738 739 740 741 742 743 744  | Next Page >