Search Results

Search found 21350 results on 854 pages for 'url parsing'.

Page 757/854 | < Previous Page | 753 754 755 756 757 758 759 760 761 762 763 764  | Next Page >

• How to deploy SQL Reporting 2005 when Data Sources are locked?

  - by spoulson

  The DBAs here maintain all SQL Server and SQL Reporting servers. I have a custom developed SQL Reporting 2005 project in Visual Studio that runs fine on my local SQL Database and Reporting instances. I need to deploy to a production server, so I had a folder created on a SQL Reporting 2005 server with permissions to upload files. Normally, a deploy from within Visual Studio is all that is needed to upload the report files. However, for security purposes, data sources are maintained explicitly by DBAs and stored in a separated locked down common folder on the reporting server. I had them create the data source for me. When I attempt to deploy from VS, it gives me the error "The item '/Data Sources' already exists." I get this whether I'm deploying the whole project or just a single report file. I already set OverwriteDataSources=false in the project properties. The TargetServer URL and folder are verified correct. I suppose I could copy the files manually, but I'd like to be able to deploy from within VS. What could I be doing wrong?

  Read the article

• Webpage shared with like button not showing in users timeline

  - by einar

  I have a single pages and a one page that lists all of the single pages. On the overview page you can like each single page with their url. And of corse you can do the same when you are viewing a single page. My issue is very strange. Most of the pages that I would like show up on my timeline. But then there are some that don't show after I click like, not even if I click on "Post to Facebook". This page will not show in a users timeline if liked ore "Post'ed to Facebook". http://www.inspiredbyiceland.com/inspiration/iceland-airwaves/valdimar/ But this one will http://www.inspiredbyiceland.com/inspiration/iceland-airwaves/snorri-helgason/ But these pages are excls the same, they use the same template so the code should not be any different, and in fact I cant see any differents between these pages that could be causing this kind of problem. You can view the overview page here http://www.inspiredbyiceland.com/inspiration/iceland-airwaves/ . Most of the single pages work fine and show up on users timeline. Most of the content on the site works fine so far as I know. There is an Facebook application defined on the page. I'm not sure if that is related to this problem.

  Read the article

• rails application on production not working

  - by Steven

  i have a rails application on production which is running using mongrel, I can successfully start the mogrel for the application but when i try to access the application on the URL it is not responding... it is just hanging. This is the mongrel log... but when I hit xxx.xxx.xxx.xx:3001 it is not showing the website but on developent is working fine. ** Starting Mongrel listening at 0.0.0.0:3001 ** Initiating groups for "name.co.za":"name.co.za". ** Changing group to "name.co.za". ** Changing user to "name.co.za". ** Starting Rails with production environment... ** Rails loaded. ** Loading any Rails specific GemPlugins ** Signals ready. TERM = stop. USR2 = restart. INT = stop (no restart). ** Rails signals registered. HUP = reload (without restart). It might not work well. ** Mongrel 1.1.5 available at 0.0.0.0:3001 ** Writing PID file to /home/name.co.za/shared/log/mongrel.pid

  Read the article

• How can I create an automatically generated alteranate table row color ?

  - by UXdesigner

  Good day, I've been trying to make this CSS code work: table.mytable { margin: 0; padding: 0; border: 0; font-size: 0.8em; border-collapse: collapse; } table.mytable td, table.mytable th { width: auto; padding: 2px 4px; vertical-align: top; } table.mytable th { color: #fff; background:url(images/header-bg.gif); text-align: left; } table.mytable tr.alternateColor { background-color:#E9F3FC; } well, it works, if I do write it manually. But as the tables are going to be generated thru asp.NET (Aspx) , which is not manually created- I'd like my table to generate the alternate rows. I've been trying to make this work with Javascript, but I can't figure it out and I believe this is a good resource site. I've been using a manual table with Adobe Dreamweaver cs4 as a test, but I have to put the class of "alternatecolors" in order to make them appear, and I can't do this normally.: Question is , can someone provide me a good Javascript that I would put in the header of the file, and actually help me out to make this work ? I think I'm burned...or maybe I can't see what others see quickly due to the amount of time I've spent. I just tried posting the code of my table here, but I couldn't get it well formatted and I got to run... I'm not using an 'id' on this table, but the class is 'mytable'. Thank you so much for your good help.

  Read the article

• Some jQuery-powered features not working in Chrome

  - by Enchantner

  I'm using a jCarouselLite plugin for creating two image galleries on the main page of my Django-powered site. The code of elements with navigation arrows is generating dynamically like this: $(document).ready(function () { $('[jq\\:corner]').each(function(index, item) { item = $(item); item.corner(item.attr('jq:corner')) }) $('[jq\\:menu]').each(function (index, item) { item = $(item); item.menu(item.attr('jq:menu')) }) $('[jq\\:carousel]').each(function(index, item) { item = $(item); var args = item.attr('jq:carousel').split(/\s+/) lister = item.parent().attr('class') + '_lister' item.parent().append('<div id="'+ lister +'"></div>'); $('#' + lister).append("<a class='nav left' href='#'></a><a class='nav right' href='#'></a>"); toparrow = $(item).position().top + $(item).height() - 50; widtharrow = $(item).width(); $('#' + lister).css({ 'display': 'inline-block', 'z-index': 10, 'position': 'absolute', 'margin-left': '-22px', 'top': toparrow, 'width': widtharrow }) $('#' + lister + ' .nav.right').css({ 'margin-left': $('#' + lister).width() + 22 }) item.jCarouselLite({ btnNext: '#' + lister + ' .nav.right', btnPrev: '#' + lister + ' .nav.left', visible: parseInt(args[0]) }) }) The problem is that if page is loaded through an url, typed in the adress bar, some functions doesn't work and the second gallery appears with the wrong parameters, but if I came to this page via clicking link - everything works perfectly. It happends only in Google Chrome (Ubuntu, stable 5.0.360.0), but not in Firefox or Opera. What could be the reason?

  Read the article

• background image not showing in html

  - by Registered User

  I am having following css <!DOCTYPE html > <html> <head> <meta charset="utf-8"> <title>Black Goose Bistro Summer Menu</title> <link href='http://fonts.googleapis.com/css?family=Marko+One' rel='stylesheet' type='text/css'> <style> body { font-family: Georgia, serif; font-size: 100%; line-height: 175%; margin: 0 15% 0; background-image:url(images/bullseye.png); } #header { margin-top: 0; padding: 3em 1em 2em 1em; text-align: center; } a { text-decoration: none; } h1 { font: bold 1.5em Georgia, serif; text-shadow: .1em .1em .2em gray; } h2 { font-size: 1em; text-transform: uppercase; letter-spacing: .5em; text-align: center; } dt { font-weight: bold; } strong { font-style: italic; } ul { list-style-type: none; margin: 0; padding: 0; } #info p { font-style: italic; } .price { font-family: Georgia, serif; font-style: italic; } p.warning, sup { font-size: small; } .label { font-weight: bold; font-variant: small-caps; font-style: normal; } h2 + p { text-align: center; font-style: italic; } ); </style> </head> <body> <div id="header"> <h1>Black Goose Bistro &bull; Summer Menu</h1> <div id="info"> <p>Baker's Corner, Seekonk, Massachusetts<br> <span class="label">Hours: Monday through Thursday:</span> 11 to 9, <span class="label">Friday and Saturday;</span> 11 to midnight</p> <ul> <li><a href="#appetizers">Appetizers</a></li> <li><a href="#entrees">Main Courses</a></li> <li><a href="#toast">Traditional Toasts</a></li> <li><a href="#dessert">Dessert Selection</a></li> </ul> </div> </div> <div id="appetizers"> <h2>Appetizers</h2> <p>This season, we explore the spicy flavors of the southwest in our appetizer collection.</p> <dl> <dt>Black bean purses</dt> <dd>Spicy black bean and a blend of mexican cheeses wrapped in sheets of phyllo and baked until golden. <span class="price">$3.95</span></dd> <dt class="newitem">Southwestern napoleons with lump crab &mdash; <strong>new item!</strong></dt> <dd>Layers of light lump crab meat, bean and corn salsa, and our handmade flour tortillas. <span class="price">$7.95</span></dd> </dl> </div> <div id="entrees"> <h2>Main courses</h2> <p>Big, bold flavors are the name of the game this summer. Allow us to assist you with finding the perfect wine.</p> <dl> <dt class="newitem">Jerk rotisserie chicken with fried plantains &mdash; <strong>new item!</strong></dt> <dd>Tender chicken slow-roasted on the rotisserie, flavored with spicy and fragrant jerk sauce and served with fried plantains and fresh mango. <strong>Very spicy.</strong> <span class="price">$12.95</span></dd> <dt>Shrimp sate kebabs with peanut sauce</dt> <dd>Skewers of shrimp marinated in lemongrass, garlic, and fish sauce then grilled to perfection. Served with spicy peanut sauce and jasmine rice. <span class="price">$12.95</span></dd> <dt>Grilled skirt steak with mushroom fricasee</dt> <dd>Flavorful skirt steak marinated in asian flavors grilled as you like it^*. Served over a blend of sauteed wild mushrooms with a side of blue cheese mashed potatoes. <span class="price">$16.95</span></dd> </dl> </div> <div id="toast"> <h2>Traditional Toasts</h2> <p>The ultimate comfort food, our traditional toast recipes are adapted from <a href="http://www.gutenberg.org/files/13923/13923-h/13923-h.htm"><cite>The Whitehouse Cookbook</cite></a> published in 1887.</p> <dl> <dt>Cream toast</dt> <dd>Simple cream sauce over highest quality toasted bread, baked daily. <span class="price">$3.95</span></dd> <dt>Mushroom toast</dt> <dd>Layers of light lump crab meat, bean and corn salsa, and our handmade flour tortillas. <span class="price">$6.95</span></dd> <dt>Nun's toast</dt> <dd>Onions and hard-boiled eggs in a cream sauce over buttered hot toast. <span class="price">$6.95</span></dd> <dt>Apple toast</dt> <dd>Sweet, cinnamon stewed apples over delicious buttery grilled bread. <span class="price">$6.95</span></dd> </dl> </div> <div id="dessert"> <h2>Dessert Selection</h2> <p>Be sure to save room for our desserts, made daily by our own <a href="http://www.jwu.edu/college.aspx?id=19510">Johnson & Wales</a> trained pastry chef.</p> <dl> <dt class="newitem">Lemon chiffon cake &mdash; <strong>new item!</strong></dt> <dd>Light and citrus flavored sponge cake with buttercream frosting as light as a cloud. <span class="price">$2.95</span></dd> <dt class="newitem">Molten chocolate cake</dt> <dd>Bubba's special dark chocolate cake with a warm, molten center. Served with or without a splash of almond liqueur. <span class="price">$3.95</span></dd> </dl> </div> <p class="warning">^* We are required to warn you that undercooked food is a health risk.</p> </body> </html> but the background image does not appear in body tag you can see background-image:url(images/bullseye.png); this html page is bistro.html and the directory in which it is contained there is a folder images and inside images folder I have a file bullseye.png .I expect the png to appear in background.But that does not happen. For sake of question I am posting the image here also Let me know if the syntax of css wrong? following is image http://i.stack.imgur.com/YUKgg.png

  Read the article

• binding nested json object value to a form field

  - by Jack

  I am building a dynamic form to edit data in a json object. First, if something like this exists let me know. I would rather not build it but I have searched many times for a tool and have found only tree like structures that require entering quotes. I would be happy to treat all values as strings. This edit functionality is for end users so it needs to be easy an not intimidating. So far I have code that generates nested tables to represent a json object. For each value I display a form field. I would like to bind the form field to the associated nested json value. If I could store a reference to the json value I would build an array of references to each value in a json object tree. I have not found a way to do that with javascript. My last resort approach will be to traverse the table after edits are made. I would rather have dynamic updates but a single submit would be better than nothing. Any ideas? // the json in files nests only a few levels. Here is the format of a simple case, { "researcherid_id":{ "id_key":"researcherid_id", "description":"Use to retrieve bibliometric data", "url_template" :[ { "name": "Author Detail", "url": "http://www.researcherid.com/rid/${key}" } ] } } $.get('file.json',make_json_form); function make_json_form(response) { dataset = $.secureEvalJSON(response); // iterate through the object and generate form field for string values. } // Then after the form is edited I want to display the raw updated json (then I want to save it but that is for another thread) // now I iterate through the form and construct the json object // I would rather have the dataset object var updated on focus out after each edit. function show_json(form_id){ var r = {}; var el = document.getElementById(form_id); table_to_json(r,el,null); $('body').html(formattedJSON(r)); }

  Read the article

• Passing a list of ints to WebMethod using jQuery and ajax.

  - by birdus

  I'm working on a web page (ASP.NET 4.0) and am just starting simple to try and get this ajax call working (I'm an ajax/jQuery neophyte) and I'm getting an error on the call. Here's the js: var TestParams = new Object; TestParams.Items = new Object; TestParams.Items[0] = 1; TestParams.Items[1] = 5; TestParams.Items[2] = 10; var finalObj = JSON.stringify(TestParams); var _url = 'AdvancedSearch.aspx/TestMethod'; $(document).ready(function () { $.ajax({ type: "POST", url: _url, data: finalObj, contentType: "application/json; charset=utf-8", dataType: "json", success: function (msg) { $(".main").html(msg.d); }, error: function (xhr, ajaxOptions, thrownError) { alert(thrownError.toString()); } }); Here's the method in my code behind file: [Serializable] public class TestParams { public List<int> Items { get; set; } } public partial class Search : Page { [WebMethod] public static string TestMethod(TestParams testParams) { // I never hit a breakpoint in here // do some stuff // return some stuff return ""; } } Here's the stringified json I'm sending back: {"Items":{"0":1,"1":5,"2":10}} When I run it, I get this error: Microsoft JScript runtime error: 'undefined' is null or not an object It breaks on the error function. I've also tried this variation on building the json (based on a sample on a website) with this final json: var TestParams = new Object; TestParams.Positions = new Object; TestParams.Positions[0] = 1; TestParams.Positions[1] = 5; TestParams.Positions[2] = 10; var DTO = new Object; DTO.positions = TestParams; var finalObj = JSON.stringify(DTO) {"positions":{"Positions":{"0":1,"1":5,"2":10}}} Same error message. It doesn't seem like it should be hard to send a list of ints from a web page to my webmethod. Any ideas? Thanks, Jay

  Read the article

• [PHP] Associate different data

  - by Alex Cane

  I will try to be as clear as possible because I can't get anybody to help me around, I am trying to associate some data from a 'videos' table with their respective ID. Lets say, I have column ID, title, serie, season, episode. I am getting my data : <? $result = mysql_query("SELECT * FROM videos WHERE serie = '".$row['serie']."' AND season = '".$row['season']."'"); $total_rows = mysql_num_rows($result); ?> (that is in the page where you see the video itself) So now I can get the number of episodes from a serie and season. What I'm trying to do is have a link for the next episode, and aa link for the previous one. In the URL I am working with the id, so http://website.com/view/id/'video id here'/ So how can I get the ID of the following and previous episodes of the same season AND serie? Help will be much appreciated! The easiest thing I thought of is <?=$row['id'] + 1?> <?=$row['id'] - 1?> But the thing is that it's mixed videos, so it wont work 100%

  Read the article

• How can I make an even more random number in ActionScript 2.0

  - by Theo

  I write a piece of software that runs inside banner ads which generates millions of session IDs every day. For a long time I've known that the random number generator in Flash is't random enough to generate sufficiently unique IDs, so I've employed a number of tricks to get even more random numbers. However, in ActionScript 2.0 it's not easy, and I'm seeing more and more collisions, so I wonder if there is something I've overlooked. As far as I can tell the problem with Math.random() is that it's seeded by the system time, and when you have sufficient numbers of simultaneous attempts you're bound to see collisions. In ActionScript 3.0 I use the System.totalMemory, but there's no equivalent in ActionScript 2.0. AS3 also has Font.enumerateFonts, and a few other things that are different from system to system. On the server side I also add the IP address to the session ID, but even that isn't enough (for example, many large companies use a single proxy server and that means that thousands of people all have the same IP -- and since they tend to look at the same sites, with the same ads, roughly at the same time, there are many session ID collisions). What I need isn't something perfectly random, just something that is random enough to dilute the randomness I get from Math.random(). Think of it this way: there is a certain chance that two people will generate the same random number sequence using only Math.random(), but the chance of two people generating the same sequence and having, say, the exact same list of fonts is significantly lower. I cannot rely on having sufficient script access to use ExternalInterface to get hold of things like the user agent, or the URL of the page. I don't need suggestions of how to do it in AS3, or any other system, only AS2 -- using only what's available in the standard APIs. The best I've come up with so far is to use the list of microphones (Microphone.names), but I've also tried to make some fingerprinting using some of the properties in System.capabilities, I'm not sure how much randomness I can get out of that though so I'm not using that at the moment. I hope I've overlooked something.

  Read the article

• how can I solve a problem with andWhere with symfony/doctrine and odbc?

  - by JaSk

  While following the symfony tutorial (1.4.4) I'm getting an error with ODBC/mssql 2008. SQLSTATE[07002]: COUNT field incorrect: 0 [Microsoft][SQL Server Native Client 10.0]COUNT field incorrect or syntax error (SQLExecute[0] at ext\pdo_odbc\odbc_stmt.c:254). Failing Query: "SELECT [j].[id] AS [j__id], [j].[category_id] AS [j__category_id], [j].[type] AS [j_type], [j].[company] AS [j_company], [j].[logo] AS [j_logo], [j].[url] AS [j_url], [j].[position] AS [j_position], [j].[location] AS [j_location], [j].[description] AS [j__description], [j].[how_to_apply] AS [j__how_to_apply], [j].[token] AS [j__token], [j].[is_public] AS [j__is_public], [j].[is_activated] AS [j__is_activated], [j].[email] AS [j__email], [j].[expires_at] AS [j__expires_at], [j].[created_at] AS [j__created_at], [j].[updated_at] AS [j__updated_at] FROM [jobeet_job] [j] WHERE ([j].[category_id] = '2' AND [j].[expires_at] ?) ORDER BY [j].[expires_at] DESC" I've narrowed the problem to a line that uses parameters public function getActiveJobs(Doctrine_Query $q = null) { if (is_null($q)) { $q = Doctrine_Query::create() -from('JobeetJob j'); } //$q->andWhere('j.expires_at > \''.date('Y-m-d H:i:s', time()).'\'');<-- this works $q->andWhere('j.expires_at > ?', date('Y-m-d H:i:s', time())); //<-- this line has problem $q->addOrderBy('j.expires_at DESC'); return $q->execute(); } can anyone point me in the right direction? Thanks.

  Read the article

• jQuery XML loading and then innerfade effect

  - by Ryan Max

  Hello, I think I can explain myself without code, so for brevity's sake here we go: I am using jquery to pull data from an xml and put it into a ul on the page with each xml entry as a li. This is working great! However, what I am trying to do afterwards is use the innerfade plugin to make a simple animation between each of the li's. It's not working though, as it is still just loading the static list with each item visible (whereas if innerfade was working it would only display the first....then fade into the second, etc) It's not an innerfade problem however, because if I add the list in manually to the page (not injecting it with jquery) then the innerfade works fine. I'm relatively new to DOM scripting, so I think I am missing something here. I'm not quite sure how jQuery sequences everything, and I'm having trouble phrasing my question in a search engine friendly manner so here I am. Is it possible to have jquery pull the data from xml, then inject it into the page, then have innerfade work it's magic? Or am I thinking about this the wrong way? xml code: $.ajax({ type: "GET", url: "xml/playlist.xml", dataType: "xml", success: function(xml) { $(xml).find('song').each(function(){ var name = $(this).attr('title'); var date = $(this).attr('artist'); var message = $(this).attr('path'); $('<li></li>').html('<span id="an_name">'+name+'</span><span id="an_date">'+date+'</span><span id="an_message">'+message+'</span>').appendTo('#anniversary'); }); } }); innerfade code: <script type="text/javascript"> jQuery.noConflict(); jQuery(document).ready( function(){ jQuery('#anniversary').innerfade({ speed: 1000, timeout: 5000, type: 'sequence', }); });

  Read the article

• Get information form WebPage.

  - by william-hu

  I want to set up an app which can get the information from a particular web page. Then i display the value which got from that page to the iPhone user. Detail:In the webpage on server ,there is the schedule for bus time. If the user input origin and terminus then show the user the time information(list on webpage) in a label. That's all. What i have finished is : Open the iphone app, input two value(origin and terminus) to UITextField. Send the URL to server. Get the page, and show in UIWebView. What my problem next is how should i get the information form that page into another two labels to give the user about the bus time. I have store data in my Array receiveData: self.receivedData = data; I am not clear the data i received is XML or what? And how should i pick-up the value i want. (should i save the value to property list and the read the value?) Thank you so much!

  Read the article

• Redirect Desktop Internal Pages to Correct Mobile Internal Pages with Htaccess

  - by Luis Alejandro Ramrez Gallardo

  I have built a Mobile site in a sub-domain. I have successfully implemented the redirect 302 from: www.domain.com to m.domain.com in htaccess. What I'm looking to achieve now it to redirect users from: www.domain.com/internal-page/ > 302 > m.domain.com/internal-page.html Notice that URL name for desktop and mobile is not the same. The code I'm using looks like this: # BEGIN WordPress <IfModule mod_rewrite.c> RewriteEngine On RewriteBase / RewriteRule ^index\.php$ - [L] RewriteCond %{REQUEST_FILENAME} !-f RewriteCond %{REQUEST_FILENAME} !-d RewriteRule . /index.php [L] </IfModule> # END WordPress # Mobile Redirect # Verify Desktop Version Parameter RewriteCond %{QUERY_STRING} (^|&)ViewFullSite=true(&|$) # Set cookie and expiration RewriteRule ^ - [CO=mredir:0:www.domain.com:60] # Prevent looping RewriteCond %{HTTP_HOST} !^m.domain.com$ # Define Mobile agents RewriteCond %{HTTP_ACCEPT} "text\/vnd\.wap\.wml|application\/vnd\.wap\.xhtml\+xml" [NC,OR] RewriteCond %{HTTP_USER_AGENT} "sony|symbian|nokia|samsung|mobile|windows ce|epoc|opera" [NC,OR] RewriteCond %{HTTP_USER_AGENT} "mini|nitro|j2me|midp-|cldc-|netfront|mot|up\.browser|up\.link|audiovox"[NC,OR] RewriteCond %{HTTP_USER_AGENT} "blackberry|ericsson,|panasonic|philips|sanyo|sharp|sie-"[NC,OR] RewriteCond %{HTTP_USER_AGENT} "portalmmm|blazer|avantgo|danger|palm|series60|palmsource|pocketpc"[NC,OR] RewriteCond %{HTTP_USER_AGENT} "smartphone|rover|ipaq|au-mic,|alcatel|ericy|vodafone\/|wap1\.|wap2\.|iPhone|android"[NC] # Verify if not already in Mobile site RewriteCond %{HTTP_HOST} !^m\. # We need to read and write at the same time to set cookie RewriteCond %{QUERY_STRING} !(^|&)ViewFullSite=true(&|$) # Verify that we previously haven't set the cookie RewriteCond %{HTTP_COOKIE} !^.*mredir=0.*$ [NC] # Now redirect the users to the Mobile Homepage RewriteRule ^$ http://m.domain.com [R] RewriteRule $/internal-page/ http://m.domain.com/internal-page.html [R,L]

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Pass checkbox values with Jquery to PHP and display result in div

  - by user1343955

  I want to filter realtime results with jQuery (just like on this site http://shop.www.hi.nl/hi/mcsmambo.p?M5NextUrl=RSRCH). So when someones checks a checkbox the results should update realtime (in a div). Now I'm a newbie with jQuery and I've tried lots of examples but I can't get it to work. Here's my code, could anyone tell what I'm doing wrong? Thank you very much! HTML <div id="c_b"> Kleur:<br /> <input type="checkbox" name="kleur[1]" value="Blauw"> Blauw <br /> <input type="checkbox" name="kleur[2]" value="Wit"> Wit <br /> <input type="checkbox" name="kleur[3]" value="Zwart"> Zwart <br /> <br /> Operating System:<br /> <input type="checkbox" name="os[1]" value="Android"> Android <br /> <input type="checkbox" name="os[2]" value="Apple iOS"> Apple iOS <br /> </div> <div id="myResponse">Here should be the result</div> jQuery function updateTextArea() { var allVals = []; $('#c_b :checked').each(function() { allVals.push($(this).val()); }); var dataString = $(allVals).serialize(); $.ajax({ type:'POST', url:'/wp-content/themes/u-design/filteropties.php', data: dataString, success: function(data){ $('#myResponse').html(data); } }); } $(document).ready(function() { $('#c_b input').click(updateTextArea); updateTextArea(); }); PHP //Just to see if the var passing works echo var_export($_POST);

  Read the article

• QUnit Unit Testing: Test Mouse Click

  - by Ngu Soon Hui

  I have the following HTML code: <div id="main"> <form Id="search-form" action="/ViewRecord/AllRecord" method="post"> <div> <fieldset> <legend>Search</legend> <p> <label for="username">Staff name</label> <input id="username" name="username" type="text" value="" /> <label for="softype"> software type</label> <input type="submit" value="Search" /> </p> </fieldset> </div> </form> </div> And the following Javascript code ( with JQuery as the library): $(function() { $("#username").click(function() { $.getJSON("ViewRecord/GetSoftwareChoice", {}, function(data) { // use data to manipulate other controls }); }); }); Now, how to test $("#username").click so that for a given input, it calls the correct url ( in this case, its ViewRecord/GetSoftwareChoice) And, the output is expected (in this case, function(data)) behaves correctly? Any idea how to do this with QUnit? Edit: I read the QUnit examples, but they seem to be dealing with a simple scenario with no AJAX interaction. And although there are ASP.NET MVC examples, but I think they are really testing the output of the server to an AJAX call, i.e., it's still testing the server response, not the AJAX response. What I want is how to test the client side response.

  Read the article

• Preserving SCRIPT tags (and more) in CKEditor

  - by Jonathan Sampson

  Update: I'm thinking the solution to this problem is in CKEDITOR.config.protectedSource(), but my regular-expression experience is proving to be too juvenile to handle this issue. How would I go about exempting all tags that contain the 'preserved' class from being touched by CKEditor? Is it possible to create a block of code within the CKEditor that will not be touched by the editor itself, and will be maintained in its intended-state until explicitly changed by the user? I've been attempting to input javascript variables (bound in script tags) and a flash movie following, but CKEditor continues to rewrite my pasted code/markup, and in doing so breaking my code. I'm working with the following setup: <script type="text/javascript"> var editor = CKEDITOR.replace("content", { height : "500px", width : "680px", resize_maxWidth : "680px", resize_minWidth : "680px", toolbar : [ ['Source','-','Save','Preview'], ['Cut','Copy','Paste','PasteText','PasteFromWord','-','Print', 'SpellChecker', 'Scayt'], ['Undo','Redo','-','Find','Replace','-','SelectAll','RemoveFormat'], ['Bold','Italic','Underline','Strike','-','Subscript','Superscript'], ['NumberedList','BulletedList','-','Outdent','Indent','Blockquote'], ['JustifyLeft','JustifyCenter','JustifyRight','JustifyBlock'], ['Link','Unlink','Anchor'], ['Image','Table','HorizontalRule','SpecialChar'] ] }); CKFinder.SetupCKEditor( editor, "<?php print url::base(); ?>assets/ckfinder" ); </script> UPDATE: I suppose the most ideal solution would be to preserve the contents of any tag that contains class="preserve" enabling much more than the limited exclusives.

  Read the article

• Trouble adding video controls to video selected by XML comboBox

  - by user560128

  Hello, it's been a few years since I've touched flash, so perhaps I'm just overlooking something. If anyone could look at the code and offer any suggestions that would be awesome. What's working, I select a video from a combobox that is populated from an XML file, pick the video and it plays. I've been trying to add pause/play, stop, forward and reverse functionality, once I get that to work I also want to add a video scrubber(slider), and previous/next buttons to go to the previous/next video as listed in the xml file. At the moment I have a component button on the stage called playButton, which I'm trying to use for pause/play functionality. Below is my code, the player control is at the very bottom. Thanks. import fl.data.DataProvider; var nc:NetConnection = new NetConnection(); nc.connect(null); var ns:NetStream = new NetStream(nc); var videosXML:XML = new XML(); var loader:URLLoader = new URLLoader(); var request:URLRequest= new URLRequest("xml/videos.xml"); var videos:Array = new Array({label:"Select a Video",data:""}); var client:Object = new Object(); theVideo.attachNetStream(ns); ns.client = client; loader.addEventListener(Event.COMPLETE,loaderOnComplete); loader.load (request); function loaderOnComplete(event:Event):void{ videosXML = new XML(event.target.data); for each (var video:XML in videosXML.video){ videos.push({label:video.name.toString(),data:video.url.toString()}); } moviesCB.dataProvider = new DataProvider(videos); } moviesCB.addEventListener(Event.CHANGE, changeHandler); function changeHandler(event:Event):void { if(ComboBox(event.target).selectedItem.data != ""){ ns.play(ComboBox(event.target).selectedItem.data); } }; client.onMetaData = metadataHandler; function metadataHandler(md:Object):void{ } //player controls playButton.onRelease = function() { ns.pause(); }

  Read the article

• Rails: link_to_remote prototype helper with :with option

  - by Syed Aslam

  I am trying to grab the current value of a drop down list with Prototype and passing it along using :with like this <%= link_to_remote "today", :update => "choices", :url => { :action => "check_availability" } , :with => "'practitioner='+$F('practitioner')&'clinic='+$F('clinic')&'when=today'", :loading => "spinner.show(); $('submit').disable();", :complete => "spinner.hide(); $('submit').enable();" %> However, this is not working as expected. I am unable to access parameters in the controller as the link_to_remote helper is sending parameters like this: Parameters: {"succ"=>"function () {\n return this + 1;\n}", "action"=>"check_availability", "round"=>"function () {\n return __method.apply(null, [this].concat($A(arguments)));\n}", "ceil"=>"function () {\n return __method.apply(null, [this].concat($A(arguments)));\n}", "floor"=>"function () {\n return __method.apply(null, [this].concat($A(arguments)));\n}", "times"=>"function (iterator, context) {\n $R(0, this, true).each(iterator, context);\n return this;\n}", "toPaddedString"=>"function (length, radix) {\n var string = this.toString(radix || 10);\n return \"0\".times(length - string.length) + string;\n}", "toColorPart"=>"function () {\n return this.toPaddedString(2, 16);\n}", "abs"=>"function () {\n return __method.apply(null, [this].concat($A(arguments)));\n}", "controller"=>"main"} Where am I going wrong? Is there a better way to do this?

  Read the article

• Django Image Upload: IOErrno2 Could not find path -- and yet it's saving the image there anyway?

  - by Rob

  I have an issue where the local version of django is handling image upload as expected but my server is not. Note: I am using a Django Container on MediaTemple.net (grid server) Here is my code. def view_settings(request): <snip> if request.POST: success_msgs = () mForm = MainProfileForm(request.POST, request.FILES, instance = mProfile) pForm = ChangePasswordForm(request.POST) eForm = ChangeEmailForm(request.POST) if mForm.is_valid(): m = mForm.save(commit = False) if mForm.cleaned_data['avatar']: m.avatar = upload_photo(request.FILES['avatar'], settings.AVATAR_SAVE_LOCATION) m.save() success_msgs += ('profile pictured updated',) <snip> def upload_photo(data,saveLocation): savePath = os.path.join(settings.MEDIA_ROOT, saveLocation, data.name) destination = open(savePath, 'wb+') for chunk in data.chunks(): destination.write(chunk) destination.close() return os.path.join(saveLocation, data.name) Here's where it gets whacky and I was hoping someone could shed a light on this error, because either a) it's the wrong error code, or b) something is happening with the file before it's completely handled. To recap, the file was actually uploaded to the server in the intended directory - and yet this err msg continues to persist. IOError at /user/settings [Errno 2] No such file or directory: u'/home/user66666/domains/example.com/html/media/images/avatars/DSC03852.JPG' Environment: Request Method: POST Request URL: http://111.111.111.111:2011/user/settings Django Version: 1.0.2 final Python Version: 2.4.4 Installed Applications: ['django.contrib.auth', 'django.contrib.contenttypes', 'django.contrib.sessions', 'django.contrib.sites', 'ctrlme', 'usertools', 'easy_thumbnails'] Installed Middleware: ('django.middleware.common.CommonMiddleware', 'django.contrib.sessions.middleware.SessionMiddleware', 'django.contrib.auth.middleware.AuthenticationMiddleware') Traceback: File "/home/user6666/containers/django/leonidas/usertools/views.py" in view_settings m.avatar = upload_photo(request.FILES['avatar'], settings.AVATAR_SAVE_LOCATION) File "/home/user666666/containers/django/leonidas/usertools/functions.py" in upload_photo destination = open(savePath, 'wb+')

  Read the article

• Flash/Flex sending XML to Rails App

  - by bdicasa

  I'm trying to send some XML to a rails app in Flex. I'm using the URLRequest and URLLoader objects. However, I'm having trouble determining how to send the XML and _method parameter to the rails app using these flash objects. Below is how I'm currently trying to achieve this. var request:URLRequest = new URLRequest(); request.method = URLRequestMethod.POST; request.data = new Object(); request.data.xml = Blog.xml.toXMLString(); request.contentType = "text/xml"; var loader:URLLoader = new URLLoader(); loader.addEventListener(Event.COMPLETE, saveCompleteHandler); var saveUrl:String = ""; saveUrl = BASE_URL; if (Blog.isNewBlog) { // Set the rails REST method. request.data._method = "POST"; saveUrl += "blogs.xml"; } else { // Set the rails REST method. request.data._method = "PUT"; saveUrl += "blogs/" + Blog.id.toString() + ".xml"; } request.url = saveUrl; //trace(request.data.toString()); loader.load(request); However the only data that is getting sent to the server is [Object object]. If some one could let me know where I'm going wrong I'd greatly appreciate it. Thanks.

  Read the article

• .NET 4.0 Forms Authentication change?

  - by James Koch

  I'm seeing some new behavior in Forms Authentication after upgrading to .NET 4.0. This occurs only on IIS 6, not on 7. Background - In web.config, we configure Forms Authentication, and then use <authorization tags to globally deny anonymous/unauthenticated users access. Then we explicitly allow access to a login.aspx page using a <location tag. Generally, this works fine, as it did when we were on .NET 2.0 (3.5). The issue only occurs when we visit the root path of the site, ie "http://myserver/". Our default document is configured in IIS to be login.aspx. Under .NET 4.0, upon visiting that URL, we're redirected to "http://myserver/login.aspx?ReturnUrl=/". If you log in from here, you're logged in and returned back at the log in page (yuck). Just wanted to post this here to see if anyone else is experiencing this. It's not listed on any "breaking changes" documentation I've been able to find. Either I'm missing something, or the UrlAuthorization module has changed and is no longer "smart" about IIS default documents.

  Read the article

• Sys.WebForms.PageRequestManagerServerErrorException: .... The status code returned from the server w

  - by webnoob

  Hi All, I have seen a few posts regarding this issue but not one specific to my problem and I have no ideas as to what I need to do to debug this. I have some combo boxes on an aspx pages, when I select a value from the first one, it fills the second with value and so on with the third and fourth. This works with no problems until I wrap an asp.net UpdatePanel around the combo boxes and try to "ajaxify" the whole process so the page isn't dancing around. The exact error I get is: Sys.WebForms.PageRequestManagerServerErrorException: An unknown error occurred while processing the request on the server. The status code returned from the server was: 404 Some things to note: I am using URL rewriting - This is what I think is causing the problem The error will occur whenever I choose a selection for a SECOND time. This means that I could select a value from the first combo box and get the same error (so it is happening on the second postback - No matter which combo box it's from). I have tried setting the EnablePartialRendering="false" on teh scriptmanager but as I said, it works when not using ajax, so I don't know how to debug the issue. My server is Windows 2008 running IIS& with ASP.NET 2.0. I would really appreciate your help Thanks in advance.

  Read the article

• Python - Open default mail client using mailto, with multiple recipients

  - by victorhooi

  Hi, I'm attempting to write a Python function to send an email to a list of users, using the default installed mail client. I want to open the email client, and give the user the opportunity to edit the list of users or the email body. I did some searching, and according to here: http://www.sightspecific.com/~mosh/WWW_FAQ/multrec.html It's apparently against the RFC spec to put multiple comma-delimited recipients in a mailto link. However, that's the way everybody else seems to be doing it. What exactly is the modern stance on this? Anyhow, I found the following two sites: http://2ality.blogspot.com/2009/02/generate-emails-with-mailto-urls-and.html http://www.megasolutions.net/python/invoke-users-standard-mail-client-64348.aspx which seem to suggest solutions using urllib.parse (url.parse.quote for me), and webbrowser.open. I tried the sample code from the first link (2ality.blogspot.com), and that worked fine, and opened my default mail client. However, when I try to use the code in my own module, it seems to open up my default browser, for some weird reason. No funny text in the address bar, it just opens up the browser. The email_incorrect_phone_numbers() function is in the Employees class, which contains a dictionary (employee_dict) of Employee objects, which themselves have a number of employee attributes (sn, givenName, mail etc.). Full code is actually here (http://stackoverflow.com/questions/2963975/python-converting-csv-to-objects-code-design) from urllib.parse import quote import webbrowser .... def email_incorrect_phone_numbers(self): email_list = [] for employee in self.employee_dict.values(): if not PhoneNumberFormats.standard_format.search(employee.telephoneNumber): print(employee.telephoneNumber, employee.sn, employee.givenName, employee.mail) email_list.append(employee.mail) recipients = ', '.join(email_list) webbrowser.open("mailto:%s?subject=%s&body=%s" % (recipients, quote("testing"), quote('testing')) ) Any suggestions? Cheers, Victor

  Read the article

< Previous Page | 753 754 755 756 757 758 759 760 761 762 763 764  | Next Page >