Search Results

Search found 140783 results on 5632 pages for 'long time user 2006'.

Page 78/5632 | < Previous Page | 74 75 76 77 78 79 80 81 82 83 84 85  | Next Page >

• User Profile modified dates don't match....what is the difference?

  - by Sean Perkins

  This question came up while I was investigating a server that randomly restarted last night. I was looking through the event logs to see if someone manually restarted the system, but nothing was identified. I went to C:\Users and there wasn't a single profile that had a modify date in a couple of years. When went to User Profiles by way of the System Properties window, I found that a handful of accounts logged in as recently as today. Those same names match to C:\Users, but the modify dates do not match. Why is this?

  Read the article

• Windows: View "all" permissions of a specific user or group

  - by peterchen

  For a Windows domain, is there a way to see for a certain user or group, where the user/group has permissions? Primarily: List which files / folders the user can access on a certain network share. (Kind of a recursive "effective permissions") However, other permissions would be cool as well. I believe I've seen such a tool in action, but I can't remember anything beyond that - so this might be a false memory. Recommendations?

  Read the article

• Long-term backup storage media

  - by Dimitri C.

  Rumors say CDs and DVDs won't remember your data longer than ten years. Are there backup media that do better?

  Read the article

• NTP daemon or ntpdate doesn't synchronize

  - by user2862333

  I'm having some problems with synchronization with an NTP server. 1) The NTP daemon doesn't sync the system clock at all, even though it's running (confirmed with /etc/init.d/ntp status). Forcing to sync with ntpd -q or ntpd -gq does not work either. 2) Stopping the NTP daemon and syncing manually with ntpdate does give me the following output: ~# ntpdate -d 0.debian.pool.ntp.org 6 Nov 16:48:53 ntpdate[4417]: ntpdate [email protected] Sat May 12 09:07:19 UTC 2012 (1) transmit(79.132.237.5) receive(79.132.237.5) transmit(85.234.197.2) receive(85.234.197.2) transmit(194.50.97.34) receive(194.50.97.34) transmit(79.132.237.1) receive(79.132.237.1) transmit(79.132.237.5) receive(79.132.237.5) transmit(85.234.197.2) receive(85.234.197.2) transmit(194.50.97.34) receive(194.50.97.34) transmit(79.132.237.1) receive(79.132.237.1) transmit(79.132.237.5) receive(79.132.237.5) transmit(85.234.197.2) receive(85.234.197.2) transmit(194.50.97.34) receive(194.50.97.34) transmit(79.132.237.1) receive(79.132.237.1) transmit(79.132.237.5) receive(79.132.237.5) transmit(85.234.197.2) receive(85.234.197.2) transmit(194.50.97.34) receive(194.50.97.34) transmit(79.132.237.1) receive(79.132.237.1) server 79.132.237.5, port 123 stratum 2, precision -20, leap 00, trust 000 refid [79.132.237.5], delay 0.05141, dispersion 0.00145 transmitted 4, in filter 4 reference time: d624e3b1.f490b90d Wed, Nov 6 2013 16:50:09.955 originate timestamp: d624e457.eaaf787c Wed, Nov 6 2013 16:52:55.916 transmit timestamp: d624e36c.4a7036fd Wed, Nov 6 2013 16:49:00.290 filter delay: 0.08537 0.05141 0.05151 0.06346 0.00000 0.00000 0.00000 0.00000 filter offset: 235.6038 235.6087 235.6095 235.6068 0.000000 0.000000 0.000000 0.000000 delay 0.05141, dispersion 0.00145 offset 235.608782 server 85.234.197.2, port 123 stratum 2, precision -20, leap 00, trust 000 refid [85.234.197.2], delay 0.05151, dispersion 0.00336 transmitted 4, in filter 4 reference time: d624e3e7.dc6cd02b Wed, Nov 6 2013 16:51:03.861 originate timestamp: d624e458.1c91031f Wed, Nov 6 2013 16:52:56.111 transmit timestamp: d624e36c.7da1d882 Wed, Nov 6 2013 16:49:00.490 filter delay: 0.05765 0.07750 0.06013 0.05151 0.00000 0.00000 0.00000 0.00000 filter offset: 235.6048 235.6014 235.6035 235.6078 0.000000 0.000000 0.000000 0.000000 delay 0.05151, dispersion 0.00336 offset 235.607826 server 194.50.97.34, port 123 stratum 3, precision -23, leap 00, trust 000 refid [194.50.97.34], delay 0.03021, dispersion 0.00090 transmitted 4, in filter 4 reference time: d624e38d.2bce952c Wed, Nov 6 2013 16:49:33.171 originate timestamp: d624e458.4dbbc114 Wed, Nov 6 2013 16:52:56.303 transmit timestamp: d624e36c.b0d38834 Wed, Nov 6 2013 16:49:00.690 filter delay: 0.03030 0.03636 0.03091 0.03021 0.00000 0.00000 0.00000 0.00000 filter offset: 235.6095 235.6085 235.6098 235.6105 0.000000 0.000000 0.000000 0.000000 delay 0.03021, dispersion 0.00090 offset 235.610589 server 79.132.237.1, port 123 stratum 3, precision -20, leap 00, trust 000 refid [79.132.237.1], delay 0.05113, dispersion 0.00305 transmitted 4, in filter 4 reference time: d624dfcb.6acea332 Wed, Nov 6 2013 16:33:31.417 originate timestamp: d624e458.838672ad Wed, Nov 6 2013 16:52:56.513 transmit timestamp: d624e36c.e405181c Wed, Nov 6 2013 16:49:00.890 filter delay: 0.06345 0.05113 0.05681 0.05656 0.00000 0.00000 0.00000 0.00000 filter offset: 235.6087 235.6038 235.6010 235.6074 0.000000 0.000000 0.000000 0.000000 delay 0.05113, dispersion 0.00305 offset 235.603888 6 Nov 16:49:00 ntpdate[4417]: step time server 79.132.237.5 offset 235.608782 sec Clearly, ntpdate can reach the NTP server(s), but after checking the clock, it hasn't changed and is still displaying the wrong time. Any ideas what would be the problem would be much appreciated.

  Read the article

• Python to see if a file falls into a date range

  - by tod

  I have a script that I want to have an if statement check if a file falls between several specified date periods as it searches directories. I have been able to get the time in %Y-%m-%d format for the file, but I can't seem to be able to specify a date range for python to go through. Any ideas/help? Here's what I have so far for name in files: f = os.path.join(root, name) dt = os.path.getmtime(f) nwdt = time.gmtime(dt) ndt = time.strftime('%Y-%m-%d', nwdt)

  Read the article

• prevent use of 'net user' command to change passwords on windows vista / xp

  - by guest

  hello the point is, if i'm logged in (and as almost every windows user, i've got an admin-account), and someone comes across my not locked pc, it is possible to change my password the pro-way through using: net user Admin %NEW_PASSWD% what can i do to prevent that, besides not being logged in as admin. i once saw a way, where the 'net user' command was substituted by a .bat file. so if you call 'net user Admin ...', it runs this .bat-file instead, which locks the notebook immediately. problem is, i honestly don't know how i could let windows substitute eg net.exe with a .bat-file. (too little windows knowledge) do you know any way how to do it? i'd appreciate it.

  Read the article

• HP Laptop recognizes hard drive just long enough to install windows

  - by Joe

  I have an HP laptop, DV6500 (CTO). It refused to boot one day, so I ran some diagnostics (a friend lent me "Hirens Boot Disk", "UBCD" and "PC DR 6"). Everything passed, except for the hdd. I replaced the HDD with a used drive of unknown condition. Installed windows with no problems. Installed the wireless driver, tried to reboot ... no luck. So I went to Best Buy, bought a brand new Western Digital 320gb HDD. Put it in the machine, installed windows (vista home premium). Installed the wired networking driver. Tried to reboot. No luck. Put the first hdd back in the machine, reinstalled windows. Started to install some drivers, went to reboot, and the machine won't come back to life. Put the second hdd in the machine, rinse wash and repeat. I've replaced the memory, even though it passed diagnostics. Problem exists with both brand new memory, and old memory. The BIOS recognizes the hard drive. The computer freezes directly after the bios splash screen, and there is no hard drive activity light. I've tried two linux live distros (gentoo and ubuntu). Neither would run on this laptop, but will on a different HP laptop. UBCD and Hirens Boot Disk both ran, as did PC Doctor 6 which refuses to test anything (gets stuck at "enumerating hard disks"). Is there anything else I can try?

  Read the article

• Huge excel sheet taking too long to update links or calculate formulae

  - by user7231

  I have Excel sheet with 5000 rows and columns till AY (size 12MB). Except for the first 6 columns, rest contain either vlookups or formulae. All the vlookups are in separate Excel sheet. I have changed the Excel setting to manually update the links and calculate formulae. Now everytime I try to update the links, either the Excel sheet hangs or it takes something like 15 minutes. Any ideas on how I can get it done quickly.

  Read the article

• Linux security: The dangers of executing malignant code as a standard user

  - by AndreasT

  Slipping some (non-root) user a piece of malignant code that he or she executes might be considered as one of the highest security breaches possible. (The only higher I can see is actually accessing the root user) What can an attacker effectively do when he/she gets a standard, (let's say a normal Ubuntu user) to execute code? Where would an attacker go from there? What would that piece of code do? Let's say that the user is not stupid enough to be lured into entering the root/sudo password into a form/program she doesn't know. Only software from trusted sources is installed. The way I see it there is not really much one could do, is there? Addition: I partially ask this because I am thinking of granting some people shell (non-root) access to my server. They should be able to have normal access to programs. I want them to be able to compile programs with gcc. So there will definitely be arbitrary code run in user-space...

  Read the article

• Moving folders take long in windows 7

  - by acidzombie24

  What can i do to fix this? maybe drop permission properties? maybe not. I have a large folder with 100k files. I moved it into my archive folder and its taking forever to move. Why is that? I know on XP it takes <1sec but not on windows 7. I am sure its a permission thing, is there a way i can disable it and make it faster?

  Read the article

• How to export User cert with private key in PKCS12 format

  - by andreas-h

  I'm running Win2008R2, and have installed an Enterprise CA. I can create user certs, but no matter what I do, I cannot export the private key. I'm using the un-touched User certificate template, and the "allow export of private key" option is selected. Still, whenever I go to the "export" dialogue of the certificate (both as user and as administrator), I don't get asked if I want to export the private key, and the option to select PKCS12 format is grayed out. Any help is greatly appreciated!

  Read the article

• How to make a non-root user to use chown for any user group files?

  - by user1877716

  I would like to make a user super powerful, with almost all root rights but unable to touch a the root user (to change the password of the root). My goal is to user "B" to manage my web server. The problem is user B need to able to run the chown and chmod commands on some files belonging to other users. I tried to put B in root group or use visudo, but it's not enough. I'm working an Centos 6 system. If some body have ideas!

  Read the article

• login .bat script in windows xp user to run with admin rights

  - by Kryan

  if exist C:\Windows\System32\CCM\CcmExec.exe ( net use /del Z: ) else ( net use z: \\c-svsccm01\SMS_CMB\Client start /d "Z:\" CCMSetup.exe ) This is a .bat file i created to run a .exe file in the mapped location "Z:\".it runs perfectly in the administrator account but not in the user account(which dosnt hav admin rights to install a .exe file) in the user account, the mapping can be created and deleted but running the CCMSetup.exe dosnt work. pls help how to run this CCMSetup.exe with admin rights in the user account.

  Read the article

• Network folder image thumbnails taking long time to load

  - by Steve

  Our internal network folder can take up to 5 seconds to generate a thumbnail for each photo in a network folder. Usually, only 10% of thumbnails actually display; the rest are default jpg icons. A thumbs.db file already exists inside this folder, so presumably the thumbnails have been generated before. Why do they have to be generated again? The PC is Win7 64-bit. The server is Windows 2003 Server SP2.

  Read the article

• Exchange Full Access issue

  - by Benjamin Jones

  I was just hired as a System Admin for a small company. They use Exchange 2010 for their Mail Server. I've never had a permission issue like this with Exchange because I worked for a larger firm with less responsibility before. Their old system admin is LONG GONE, so I can't ask him what he did. The issue: Right now ANYONE can gain access to a mailbox and view the mail in the mailbox. This is disabled by default you say and you have to grant them full access ? You are right, but the old System Admin I guess didn't know what he was doing. SO right now user A can open up user B mailbox with out being granted permission. So here is what I found out. Every user in EMC Full Access Permission has Exchange Server group granted. Within the Exchange Server Group, Domain User's is a Member Of. Within Domain User's all user's are listed as Members. So my guess is because of this all users can access ANY mailbox? Well GOOD News. The company is small (35 people) and they are not computer savvy, so hopefully no one has figured out they can open anyone's mailbox.(From what I can tell no). Next thing I did was with my domain user in EMC, delete Exchange Servers Group in FUll Access Permissions and grant access to my user. I made sure that my memeber was apart of the Exchange Server Group. Went to our OWA site and now I don't have permission to my own mailbox. Re did everything to the way it was with my user and now I'm stuck. Any help? I would think granting a single user that is in the Exchange Server group, Full Access to that mailbox would enable them to open that mailbox???? I guess I am wrong.

  Read the article

• It takes a long time until windows xp recognize I connected USB diks

  - by Pavol G

  Hello IT guys, I have a problem with my new USB disk. When I connect it to my laptop with Windows XP SP2 it takes about 4-5min until Windows recognized it and show it as a new disk. I can also see (disk's LED is blinking) that something is scaning the disk when I connect it, when this is done Windows imediately recognize it. Also when I'm copying data to this disk the speed is about 3.5MB/sec. It's connected using USB2.0. I tried to check for spyware (using spybot), also run windows in safe mode. But still have the same problems. Do you have any idea what could help to solve this problem? On Windows Vista (another laptop) everything is ok, disk loads in about 15sec and speed is about 20-30MB/sec. Thanks a lot for every advice!

  Read the article

• Windows takes a very long time to shut down even in safe mode

  - by user1526247

  On Windows 7 the computer freezes for about 5 minutes once it gets to "Shutting down...". I can't remember when it started happening. I just lived with it for a while. The first thing I tried was a full scan using Microsoft Security Essentials. This did not solve the problem. I then went into msconfig and turned off everything I could get away with in the startup and services tabs. This did not solve the problem. I then uninstalled every program on this computer save the most basic programs. This did not solve the problem (did not uninstall drivers or catalyst). I then went through and turned off every single service and did a reboot. This did not solve the problem. I then booted into safe mode and just tried shutting it down. The problem even happens in safe mode. I have tried examining the event logs but with no success. They just say things like "blah blah has entered the stopped state" with no real clues about what program is causing me all this grief. *it may be worth noting that Ubuntu is installed on the same computer and the ubuntu boot loader is the one being used.

  Read the article

• sed or grep or awk to match very very long lines

  - by yael

  more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

  Read the article

• How long would this file transfer take?

  - by CT

  I have 12 hours to backup 2 TB of data. I would like to backup to a network share to a computer using consumer WD 2TB Black 7200rpm hard drives. Gigabit Ethernet. What other variables would I need to consider to see if this is feasible? How would I set up this calculation?

  Read the article

• New User of UPK?

  - by [email protected]

  The UPK Developer comes with a variety of manuals to help support your organization in the development and deployment of content. The Developer manuals can be found in the \Documentation\Language Code\Reference folder where the Developer has been installed. As of 3.5.x the documentation can also be accessed via the Start menu, Start\Programs\User Productivity Kit\Documentation\Reference. Content Deployment.pdf: This manual provides information on how to deploy content to your audience. Content Development.pdf: This manual provides information on how to create, maintain, and publish content using the Developer. The content of this manual also appears in the Developer help system. Content Player.pdf: This manual provides instructions on how to view content using the Player. The content of this manual also appears in the Player help system. In-Application Support Guide.pdf: This manual provides information on how implement content-sensitive, in-application support for enterprise applications using Player content. Installation & Administration.pdf: This manual provides instructions for installing the Developer in a single-user or multi-user environment as well as information on how to add and manage users and content in a multi-user installation. An Administration help system also appears in the Developer for authors configured as administrators. This manual also provides instructions for installing and configuring Usage Tracking. Upgrade.pdf: This manual provides information on how to upgrade from a previous version to the current version. Usage Tracking Administration & Reporting.pdf: This manual provides instructions on how to manage users and usage tracking reports. - Kathryn Lustenberger, Oracle UPK Outbound Product Management

  Read the article

• Oracle Spatial User Conference, Directions, and the US Census

  - by stephen.garth

  This year's Oracle Spatial User Conference should be a winner, featuring new workshops and case studies presented by Oracle Spatial customers on applications as diverse as natural resource management, gold mining, the growing of wine grapes, and the United States Census. This podcast by Directions Media, official media sponsor of the Oracle Spatial User Conference, provides a glimpse of what's in store at the conference. In the podcast, Directions interviewed senior cartographers from the US Census Bureau to explore the enormous challenges of database management, mapping and spatial analysis associated with the 2010 US Census. The Oracle Spatial User Conference is in Phoenix, AZ on April 29, held in conjunction with the GITA Geospatial Infrastructure Solutions Conference. Register for the Oracle Spatial User Conference Listen to the Directions podcast on the 2010 US Census Find out more about Oracle Spatial var gaJsHost = (("https:" == document.location.protocol) ? "https://ssl." : "http://www."); document.write(unescape("%3Cscript src='" + gaJsHost + "google-analytics.com/ga.js' type='text/javascript'%3E%3C/script%3E")); try { var pageTracker = _gat._getTracker("UA-13185312-1"); pageTracker._trackPageview(); } catch(err) {}

  Read the article

• Middleware Day at UK Oracle User Group Conference 2012

  - by JuergenKress

  Registration has opened for UK Oracle User Group Conference 2012, the UK’s largest Independent Oracle Technology & E-Business Suite conference from 3rd - 5th December, 2012. The conference will attract over 1,700 attendees from the UK and internationally. Spanning three days and featuring over 250 presentations which range from end-users telling their war stories to Oracle unveiling the latest product roadmaps. We have always been trusted to provide exceptional events with innovative content and renowned speakers and our 2012 event is no exception. It is just not our words, 95% of attendees from the last years conference, highly recommend the experience to other Oracle user. You can get an overview of the conference, listen what last year's delegates thought and explore the full agenda on the conference website: www.ukoug.org/ukoug2012. Join the UK Oracle User Group for ‘Middleware Sunday’ - an event packed with technical content for WebLogic administrators taking place on 2nd December the day before the start of UKOUG Conference 2012. The day has been organised by middleware enthusiasts Simon Haslam and Jacco Landlust and is free to UKOUG 2012 delegates. The content level will be pitched intermediate to advanced. So delegates are expected to be comfortable with WebLogic and its configuration terms, such as domains and managed servers. We will also have a fun, hands-on session for which you’ll need a quick laptop to join our mega-cluster! For more information visit the UKOUG 2012 website: www.ukoug.org/2012. WebLogic Partner Community For regular information become a member in the WebLogic Partner Community please visit: http://www.oracle.com/partners/goto/wls-emea ( OPN account required). If you need support with your account please contact the Oracle Partner Business Center. BlogTwitterLinkedInMixForumWiki Technorati Tags: simon Haslam,UK user group,middleware sunday,conference,WebLogic Community,Oracle,OPN,Jürgen Kress

  Read the article

• Amazon Kindle Fire User Agent String

  - by Gopinath

  Today I was searching for Amazon Kindle Fire user agent string so that I can trick websites as if I’m browsing using Kindle Fire. To my surprise I found the following two variants of user agents listed on blogs but not sure which one is right or if Kindle Fire generating two types of User Agent strings. The first one is given by the prominent blogger and WSJ tech columnist Amit Agarwal and I vote for him as he is a highly reputed person. Mozilla/5.0 (Linux; U; Android 2.3.4; en-us; Kindle Fire Build/GINGERBREAD) AppleWebKit/533.1 (KHTML, like Gecko) Version/4.0 Mobile Safari/533.1 The second variant is found on this website and I’m not sure about the authority of the blogger. Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10_6_3; en-us; Silk/1.1.0-80) AppleWebKit/533.16 (KHTML, like Gecko) Version/5.0 Safari/533.16 Silk-Accelerated=true This article titled,Amazon Kindle Fire User Agent String, was originally published at Tech Dreams. Grab our rss feed or fan us on Facebook to get updates from us.

  Read the article

• Middleware Day at UK Oracle User Group Conference 2012

  - by JuergenKress

  Registration has opened for UK Oracle User Group Conference 2012, the UK’s largest Independent Oracle Technology & E-Business Suite conference from 3rd - 5th December, 2012. The conference will attract over 1,700 attendees from the UK and internationally. Spanning three days and featuring over 250 presentations which range from end-users telling their war stories to Oracle unveiling the latest product roadmaps. We have always been trusted to provide exceptional events with innovative content and renowned speakers and our 2012 event is no exception. It is just not our words, 95% of attendees from the last years conference, highly recommend the experience to other Oracle user. You can get an overview of the conference, listen what last year's delegates thought and explore the full agenda on the conference website: www.ukoug.org/ukoug2012. Join the UK Oracle User Group for ‘Middleware Sunday’ - an event packed with technical content for WebLogic administrators taking place on 2nd December the day before the start of UKOUG Conference 2012. The day has been organised by middleware enthusiasts Simon Haslam and Jacco Landlust and is free to UKOUG 2012 delegates. The content level will be pitched intermediate to advanced. So delegates are expected to be comfortable with WebLogic and its configuration terms, such as domains and managed servers. We will also have a fun, hands-on session for which you’ll need a quick laptop to join our mega-cluster! For more information visit the UKOUG 2012 website: www.ukoug.org/2012. SOA & BPM Partner Community For regular information on Oracle SOA Suite become a member in the SOA & BPM Partner Community for registration please visit  www.oracle.com/goto/emea/soa (OPN account required) If you need support with your account please contact the Oracle Partner Business Center. Blog Twitter LinkedIn Mix Forum Technorati Tags: UK user group,middleware day,SOA Community,Oracle SOA,Oracle BPM,Community,OPN,Jürgen Kress

  Read the article

• Two different domains as one user session

  - by Mathew Foscarini

  I have two websites that are run as the same service. Each domain offers articles from a different market. At the top of each page the two domains are shown as menu options. If a user clicks one they can switch to the other domain. See here: http://www.cgtag.com Each domain has a different Google Analytics account, and when a user switches domains Google is counting this as a new session. It's listing the other domain as the "referral" for that new session. When the user switches back to the first domain Google is counting this as a returning visitor. This is messing up my reports. Showing returning visitors values that are higher than reality. It's also increasing hits on landing pages when the user switches, and listing the other domain as a referral site. I've found tips on how to list two domains as one website, but that results in merging the data. I want to keep the two domains separate so that I can track each ones performance, but I don't want to count domain changes as new sessions. Maybe something like treating the two domains as subdomains.

  Read the article

< Previous Page | 74 75 76 77 78 79 80 81 82 83 84 85  | Next Page >