Search Results

Search found 19949 results on 798 pages for 'print css'.

Page 786/798 | < Previous Page | 782 783 784 785 786 787 788 789 790 791 792 793  | Next Page >

  • Very simple, terse and easy GUI programming “frameworks”

    - by jetxee
    Please list GUI programming libraries, toolkits, frameworks which allow to write GUI apps quickly. I mean in such a way, that GUI is described entirely in a human-readable (and human-writable) plain text file (code) code is terse (1 or 2 lines of code per widget/event pair), suitable for scripting structure and operation of the GUI is evident from the code (nesting of widgets and flow of events) details about how to build the GUI are hidden (things like mainloop, attaching event listeners, etc.) auto-layouts are supported (vboxes, hboxes, etc.) As answers suggest, this may be defined as declarative GUI programming, but it is not necessarily such. Any approach is OK if it works, is easy to use and terse. There are some GUI libraries/toolkits like this. They are listed below. Please extend the list if you see a qualifying toolkit missing. Indicate if the project is crossplatform, mature, active, and give an example if possible. Please use this wiki to discuss only Open Source projects. This is the list so far (in alphabetical order): Fudgets Fudgets is a Haskell library. Platform: Unix. Status: Experimental, but still maintained. An example: import Fudgets main = fudlogue (shellF "Hello" (labelF "Hello, world!" >+< quitButtonF)) GNUstep Renaissance Renaissance allows to describe GUI in simple XML. Platforms: OSX/GNUstep. Status: part of GNUstep. An example below: <window title="Example"> <vbox> <label font="big"> Click the button below to quit the application </label> <button title="Quit" action="terminate:"/> </vbox> </window> HTML HTML-based GUI (HTML + JS). Crossplatform, mature. Can be used entirely on the client side. Looking for a nice “helloworld” example. JavaFX JavaFX is usable for standalone (desktop) apps as well as for web applications. Not completely crossplatform, not yet completely open source. Status: 1.0 release. An example: Frame { content: Button { text: "Press Me" action: operation() { System.out.println("You pressed me"); } } visible: true } Screenshot is needed. Phooey Phooey is another Haskell library. Crossplatform (wxWidgets), HTML+JS backend planned. Mature and active. An example (a little more than a helloworld): ui1 :: UI () ui1 = title "Shopping List" $ do a <- title "apples" $ islider (0,10) 3 b <- title "bananas" $ islider (0,10) 7 title "total" $ showDisplay (liftA2 (+) a b) PythonCard PythonCard describes GUI in a Python dictionary. Crossplatform (wxWidgets). Some apps use it, but the project seems stalled. There is an active fork. I skip PythonCard example because it is too verbose for the contest. Shoes Shoes for Ruby. Platforms: Win/OSX/GTK+. Status: Young but active. A minimal app looks like this: Shoes.app { @push = button "Push me" @note = para "Nothing pushed so far" @push.click { @note.replace "Aha! Click!" } } Tcl/Tk Tcl/Tk. Crossplatform (its own widget set). Mature (probably even dated) and active. An example: #!/usr/bin/env wish button .hello -text "Hello, World!" -command { exit } pack .hello tkwait window . tekUI tekUI for Lua (and C). Platforms: X11, DirectFB. Status: Alpha (usable, but API still evolves). An example: #/usr/bin/env lua ui = require "tek.ui" ui.Application:new { Children = { ui.Window:new { Title = "Hello", Children = { ui.Text:new { Text = "_Hello, World!", Style = "button", Mode = "button", }, }, }, }, }:run() Treethon Treethon for Python. It describes GUI in a YAML file (Python in a YAML tree). Platform: GTK+. Status: work in proress. A simple app looks like this: _import: gtk view: gtk.Window() add: - view: gtk.Button('Hello World') on clicked: print view.get_label() Yet unnamed Python library by Richard Jones: This one is not released yet. The idea is to use Python context managers (with keyword) to structure GUI code. See Richard Jones' blog for details. with gui.vertical: text = gui.label('hello!') items = gui.selection(['one', 'two', 'three']) with gui.button('click me!'): def on_click(): text.value = items.value text.foreground = red XUL XUL + Javascript may be used to create stand-alone desktop apps with XULRunner as well as Mozilla extensions. Mature, open source, crossplatform. <?xml version="1.0"?> <?xml-stylesheet href="chrome://global/skin/" type="text/css"?> <window id="main" title="My App" width="300" height="300" xmlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"> <caption label="Hello World"/> </window> Thank your for contributions!

    Read the article

  • Qt drag & drop button; drop not detecting

    - by Thomas Verbeke
    I'm creating a 2D game in QT and i'm trying to implement a drag & drop into my program. For some reason the drop is not registered: qDebug should print a message on dropping but this doesn't happen. #include "dialog.h" #include "ui_dialog.h" #include "world.h" #include <vector> Dialog::Dialog(QWidget *parent) : QDialog(parent), ui(new Ui::Dialog) { ui->setupUi(this); scene = new QGraphicsScene(this); ui->graphicsView->setScene(scene); MySquare *item; QGraphicsRectItem *enemyItem; World *myWorld = new World(); std::vector<Tile*> tiles = myWorld->createWorld(":/texture.jpg"); int count = 0; foreach (Tile *tile, tiles){ count++; item = new MySquare(tile->getXPos()*4,tile->getYPos()*4,4,4); item->setBrush(QColor(tile->getValue()*255,tile->getValue()*255,tile->getValue()*255)); item->setAcceptDrops(true); scene->addItem(item); } player = new MySquare(10,20,10,10); player->setAcceptDrops(true); scene->addItem(player); //drag & drop part QPushButton *pushButton = new QPushButton("Click Me",this); connect(pushButton,SIGNAL(pressed()),this,SLOT(makeDrag())); setAcceptDrops(true); } void Dialog::makeDrag() { QDrag *dr = new QDrag(this); // The data to be transferred by the drag and drop operation is contained in a QMimeData object QMimeData *data = new QMimeData; data->setText("This is a test"); // Assign ownership of the QMimeData object to the QDrag object. dr->setMimeData(data); // Start the drag and drop operation dr->start(); } mysquare.cpp #include "mysquare.h" MySquare::MySquare(int _x,int _y, int _w, int _h) { isPlayer=false; Pressed=false; setFlag(ItemIsMovable); setFlag(ItemIsFocusable); setAcceptDrops(true); color=Qt::red; color_pressed = Qt::green; x = _x; y = _y; w = _w; h = _h; } QRectF MySquare::boundingRect() const { return QRectF(x,y,w,h); } void MySquare::paint(QPainter *painter, const QStyleOptionGraphicsItem *option, QWidget *widget) { QRectF rec = boundingRect(); QBrush brush(color); if (Pressed){ brush.setColor(color); } else { brush.setColor(color_pressed); } painter->fillRect(rec,brush); painter->drawRect(rec); } void MySquare::mousePressEvent(QGraphicsSceneMouseEvent *event) { Pressed=true; update(); QGraphicsItem::mousePressEvent(event); qDebug() << "mouse Pressed"; } void MySquare::mouseReleaseEvent(QGraphicsSceneMouseEvent *event) { Pressed=false; update(); QGraphicsItem::mousePressEvent(event); qDebug() << "mouse Released"; } void MySquare::keyPressEvent(QKeyEvent *event){ int x = pos().x(); int y = pos().y(); //key handling QGraphicsItem::keyPressEvent(event); } void MySquare::dropEvent(QDropEvent *event) { qDebug("dropEvent - square"); // Unpack dropped data and handle it the way you want qDebug("Contents: %s", event->mimeData()->text().toLatin1().data()); } void MySquare::dragMoveEvent(QDragMoveEvent *event){ qDebug("dragMoveEvent - square "); event->accept(); } void MySquare::dragEnterEvent(QDragEnterEvent *event){ event->setAccepted(true); qDebug("dragEnterEvent - square"); event->acceptProposedAction(); } void MySquare::setBrush(QColor _color){ color = _color; color_pressed = _color; update(); //repaint } edit; there is no problem with qDebug() i'm just using it to test them i'm inside the drag events..which i'm not

    Read the article

  • Javascript stockticker : not showing data on php page

    - by developer
    iam not getting any javascript errors , code is getting rendered properly only, but still server not displaying data on the page. please check the code below . <style type="text/css"> #marqueeborder { color: #cccccc; background-color: #EEF3E2; font-family:"Lucida Console", Monaco, monospace; position:relative; height:20px; overflow:hidden; font-size: 0.7em; } #marqueecontent { position:absolute; left:0px; line-height:20px; white-space:nowrap; } .stockbox { margin:0 10px; } .stockbox a { color: #cccccc; text-decoration : underline; } </style> </head> <body> <div id="marqueeborder" onmouseover="pxptick=0" onmouseout="pxptick=scrollspeed"> <div id="marqueecontent"> <?php // Original script by Walter Heitman Jr, first published on http://techblog.shanock.com // List your stocks here, separated by commas, no spaces, in the order you want them displayed: $stocks = "idt,iye,mill,pwer,spy,f,msft,x,sbux,sne,ge,dow,t"; // Function to copy a stock quote CSV from Yahoo to the local cache. CSV contains symbol, price, and change function upsfile($stock) { copy("http://finance.yahoo.com/d/quotes.csv?s=$stock&f=sl1c1&e=.csv","stockcache/".$stock.".csv"); } foreach ( explode(",", $stocks) as $stock ) { // Where the stock quote info file should be... $local_file = "stockcache/".$stock.".csv"; // ...if it exists. If not, download it. if (!file_exists($local_file)) { upsfile($stock); } // Else,If it's out-of-date by 15 mins (900 seconds) or more, update it. elseif (filemtime($local_file) <= (time() - 900)) { upsfile($stock); } // Open the file, load our values into an array... $local_file = fopen ("stockcache/".$stock.".csv","r"); $stock_info = fgetcsv ($local_file, 1000, ","); // ...format, and output them. I made the symbols into links to Yahoo's stock pages. echo "<span class=\"stockbox\"><a href=\"http://finance.yahoo.com/q?s=".$stock_info[0]."\">".$stock_info[0]."</a> ".sprintf("%.2f",$stock_info[1])." <span style=\""; // Green prices for up, red for down if ($stock_info[2]>=0) { echo "color: #009900;\">&uarr;"; } elseif ($stock_info[2]<0) { echo "color: #ff0000;\">&darr;"; } echo sprintf("%.2f",abs($stock_info[2]))."</span></span>\n"; // Done! fclose($local_file); } ?> <span class="stockbox" style="font-size:0.6em">Quotes from <a href="http://finance.yahoo.com/">Yahoo Finance</a></span> </div> </div> </body> <script type="text/javascript"> // Original script by Walter Heitman Jr, first published on http://techblog.shanock.com // Set an initial scroll speed. This equates to the number of pixels shifted per tick var scrollspeed=2; var pxptick=scrollspeed; var marqueediv=''; var contentwidth=""; var marqueewidth = ""; function startmarquee(){ alert("hi"); // Make a shortcut referencing our div with the content we want to scroll marqueediv=document.getElementById("marqueecontent"); //alert("marqueediv"+marqueediv); alert("hi"+marqueediv.innerHTML); // Get the total width of our available scroll area marqueewidth=document.getElementById("marqueeborder").offsetWidth; alert("marqueewidth"+marqueewidth); // Get the width of the content we want to scroll contentwidth=marqueediv.offsetWidth; alert("contentwidth"+contentwidth); // Start the ticker at 50 milliseconds per tick, adjust this to suit your preferences // Be warned, setting this lower has heavy impact on client-side CPU usage. Be gentle. var lefttime=setInterval("scrollmarquee()",50); alert("lefttime"+lefttime); } function scrollmarquee(){ // Check position of the div, then shift it left by the set amount of pixels. if (parseInt(marqueediv.style.left)>(contentwidth*(-1))) marqueediv.style.left=parseInt(marqueediv.style.left)-pxptick+"px"; //alert("hikkk"+marqueediv.innerHTML);} // If it's at the end, move it back to the right. else{ alert("marqueewidth"+marqueewidth); marqueediv.style.left=parseInt(marqueewidth)+"px"; } } window.onload=startmarquee; </script> </html> Below is the server displayed page. I have updated with screenshot with your suggestion, i made change in html too, to check what is showing by child dev

    Read the article

  • Why can't my main class see the array in my calender class

    - by Rocky Celltick Eadie
    This is a homework problem. I'm already 5 days late and can't figure out what I'm doing wrong.. this is my 1st semester in Java and my first post on this site Here is the assignment.. Create a class called Calendar. The class should contain a variable called events that is a String array. The array should be created to hold 5 elements. Use a constant value to specify the array size. Do not hard code the array size. Initialize the array in the class constructor so that each element contains the string “ – No event planned – “. The class should contain a method called CreateEvent. This method should accept a String argument that contains a one-word user event and an integer argument that represents the day of the week. Monday should be represented by the number 1 and Friday should be represented by the number 5. Populate the events array with the event info passed into the method. Although the user will input one-word events, each event string should prepend the following string to each event: event_dayAppoinment: (where event_day is the day of the week) For example, if the user enters 1 and “doctor” , the first array element should read: Monday Appointment: doctor If the user enters 2 and “PTA” , the second array element should read: Tuesday Appointment: PTA Write a driver program (in a separate class) that creates and calls your Calendar class. Then use a loop to gather user input. Ask for the day (as an integer) and then ask for the event (as a one word string). Pass the integer and string to the Calendar object’s CreateEvent method. The user should be able enter 0 – 5 events. If the user enters -1, the loop should exit and your application should print out all the events in a tabular format. Your program should not allow the user to enter invalid values for the day of the week. Any input other than 1 – 5 or -1 for the day of the week would be considered invalid. Notes: When obtaining an integer from the user, you will need to use the nextInt() method on your Scanner object. When obtaining a string from a user, you will need to use the next() method on your Scanner object. Here is my code so far.. //DRIVER CLASS /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin class driver public class driver { /** * @paramargs the command line arguments */ //begin main method public static void main(String[] args) { //initiates scanner Scanner userInput = new Scanner (System.in); //declare variables int dayOfWeek; String userEvent; //creates object for calender class calendercalenderObject = new calender(); //user prompt System.out.println("Enter day of week for your event in the following format:"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //user prompt System.out.println("Please type in the name of your event"); //collect user input userEvent = userInput.next(); //begin while loop while (dayOfWeek != -1) { //test for valid day of week if ((dayOfWeek>=1) && (dayOfWeek<=5)){ //calls createEvent method in calender class and passes 2 variables calenderObject.createEvent(userEvent,dayOfWeek); } else { //error message System.out.println("You have entered an invalid number"); //user prompts System.out.println("Press -1 to quit or enter another day"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //end data validity test } //end while loop } //prints array to screen int i=0; for (i=0;i<events.length;i++){ System.out.println(events[i]); } //end main method } } /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin calender class public class calender { //creates events array String[] events = new String[5]; //begin calender class constructor public calender() { //Initializes array String[] events = {"-No event planned-","-No event planned-","-No event planned-","-No event planned-","-No event planned-"}; //end calender class constructor } //begin createEvent method public String[] createEvent (String userEvent, int dayOfWeek){ //Start switch test switch (dayOfWeek){ case 1: events[0] = ("Monday Appoinment:") + userEvent; break; case 2: events[1] = ("Tuesday Appoinment:") + userEvent; break; case 3: events[2] = ("WednsdayAppoinment:") + userEvent; break; case 4: events[3] = ("Thursday Appoinment:") + userEvent; break; case 5: events[4] = ("Friday Appoinment:") + userEvent; break; default: break; //End switch test } //returns events array return events; //end create event method } //end calender class }

    Read the article

  • My PHP login no longer works

    - by Matt Clayton
    This page worked like a charm for years... enter the correspondng user id and password and you would be redirected to your directory. Now suddenly, all attempts to log in - valid or otherwise - result in the page remaining static... no message, no redirect, nothing. Nothing in the code has changed, it just plain doesn't work anymore. Could this be the result of some kind of change on the server side? Yeah, I know it's not super secure, but it was good enough for our purposes. I'm certainly open to better suggestions. I just need it to work... and keep working. Please be gentle! I know almost nothing of programming. Here is the page code: <meta http-equiv="Content-Type" content="text/html;charset=utf-8" > <link href="ilium.css" rel="stylesheet" media="screen"> <title>Ilium: Client Login</title> </head> <body bgcolor="#bfbfcc" background="img/loginbg.gif"> <?php /* init vars */ $userExists = false; $userIndex = -1; $authenicated = false; /*********************************************** * edit this to add new users/password * * - add user/pass/directory to the array * * below: must be in same array index to work * ***********************************************/ $user = array('foo', 'bar'); $pass = array('foo', 'bar'); $directory = array('foo', 'bar'); // run user/pass check if data passed if (isset($username) && isset($password)) { // check if user name exists for ($i = 0; $i < count($user); $i++) { if ($user[$i] == $username) { $userExists = true; $userIndex = $i; break; } } // so user exists, now test password if ($userExists) { $message = $message . "Username Valid<br>\n"; if ($pass[$userIndex] == $password) { $authenicated = true; $link = "/incoming/clients050203/" . $directory[$userIndex] . "/"; $message = $message . "Password Valid - Redirecting to your folder...<br>\n"; } else { $message = $message . "Incorrect Password<br>\n"; } } else { $message = $message . "Incorrect User Name<br>\n"; } } ?> <?php // user has been authenicated - move them to the correct directory if ($authenicated) { echo "<META HTTP-EQUIV=Refresh CONTENT=\"0; URL=" . $link . "\">"; } ?> <img src="img/spacer.gif" alt="" width="1" height="112" border="0"> <form action="login.php" method="post"> <table width="496"> <tr> <td width="100"></td> <td colspan="4" width="469"><img src="img/please.gif" alt="" width="469" height="19" border="0"></td> </tr> <tr> <td width="100"><img src="img/spacer.gif" alt="" width="100" height="1" border="0"></td> <td width="227"> <img src="img/spacer.gif" alt="" width="227" height="1" border="0"><br> </td> <td align="right" valign="top" width="84"><input type="text" name="username" size="12"><br></td> <td width="43"><img src="img/spacer.gif" alt="" width="43" height="1" border="0"><br> <br> </td> <td align="right" valign="top" width="109"><input type="password" name="password" size="16"> <p><br> </p> </td> </tr> <tr> <td width="100"></td> <td valign="top" width="227"><div class="messages"><?=$message?></div></td> <td width="84"><br> </td> <td width="43"><br> </td> <td align="right" width="109"><input type="image" src="img/enter.gif" ALT="enter"><br> <br> <br> <br> <br> </td> </tr> </table> </form> </body> </html>

    Read the article

  • PHP submit problem

    - by TaG
    I'm trying to check if the username is available and display it for the user to see when they check there account settings, which I have done. BUT when the user tries to fill out another field I get the Your username is unavailable! which should not pop up because its the users username already. I want to know how can I fix this problem using PHP so that the users name is displayed every time the user views their account settings and it wont cause problems when a user submits additional info? Here is the PHP code. if (isset($_POST['submitted'])) { require_once '../htmlpurifier/library/HTMLPurifier.auto.php'; $config = HTMLPurifier_Config::createDefault(); $config->set('Core.Encoding', 'UTF-8'); $config->set('HTML.Doctype', 'XHTML 1.0 Strict'); $config->set('HTML.TidyLevel', 'heavy'); $config->set('HTML.SafeObject', true); $config->set('HTML.SafeEmbed', true); $purifier = new HTMLPurifier($config); $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"SELECT users.* FROM users WHERE user_id=3"); $first_name = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['first_name'])))); $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if($_POST['username']) { $u = "SELECT user_id FROM users WHERE username = '$username'"; $r = mysqli_query ($mysqli, $u) or trigger_error("Query: $q\n<br />MySQL Error: " . mysqli_error($mysqli)); if (mysqli_num_rows($r) == TRUE) { $username = NULL; echo '<p class="error">Your username is unavailable!</p>'; } else if(mysqli_num_rows($r) == 0) { $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if ($_POST['password1'] == $_POST['password2']) { $sha512 = hash('sha512', $_POST['password1']); $password = mysqli_real_escape_string($mysqli, $purifier->purify(strip_tags($sha512))); } else { $password = NULL; } if($password == NULL) { echo '<p class="error">Your password did not match the confirmed password!</p>'; } else { if (mysqli_num_rows($dbc) == 0) { $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"INSERT INTO users (user_id, first_name, username, password) VALUES ('$user_id', '$first_name', '$username', '$password')"); } if ($dbc == TRUE) { $dbc = mysqli_query($mysqli,"UPDATE users SET first_name = '$first_name', username = '$username', password = '$password' WHERE user_id = '$user_id'"); echo '<p class="changes-saved">Your changes have been saved!</p>'; } if (!$dbc) { print mysqli_error($mysqli); return; } } } } } Here is the html form. <form method="post" action="index.php"> <fieldset> <ul> <li><label for="first_name">First Name: </label><input type="text" name="first_name" id="first_name" size="25" class="input-size" value="<?php if (isset($_POST['first_name'])) { echo stripslashes(htmlentities(strip_tags($_POST['first_name']))); } else if(!empty($first_name)) { echo stripslashes(htmlentities(strip_tags($first_name))); } ?>" /></li> <li><label for="username">UserName: </label><input type="text" name="username" id="username" size="25" class="input-size" value="<?php if (isset($_POST['username'])) { echo stripslashes(htmlentities(strip_tags($_POST['username']))); } else if(!empty($username)) { echo stripslashes(htmlentities(strip_tags($username))); } ?>" /><br /><span>(ex: CSSKing, butterball)</span></li> <li><label for="password1">Password: </label><input type="password" name="password1" id="password1" size="25" class="input-size" value="<?php if (isset($_POST['password1'])) { echo stripslashes(htmlentities(strip_tags($_POST['password1']))); } ?>" /></li> <li><label for="password2">Confirm Password: </label><input type="password" name="password2" id="password2" size="25" class="input-size" value="<?php if (isset($_POST['password2'])) { echo stripslashes(htmlentities(strip_tags($_POST['password2']))); } ?>" /></li> <li><input type="submit" name="submit" value="Save Changes" class="save-button" /> <input type="hidden" name="submitted" value="true" /> <input type="submit" name="submit" value="Preview Changes" class="preview-changes-button" /></li> </ul> </fieldset> </form>

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Page.ClientScript Register a pair of javascript code

    - by blgnklc
    How can I register a javascript code a page? I want to put th javascript function to the aspx.page; I thing it might be like that; string strJS= "<script language = javascript> (function(images, elements) { var fetchImages = function() { if(images.length > 0) { var numImages = 10; while(images.length > 0 && numImages-- > 0) { // assuming your elements are <img> document.getElementById(elements.shift()).src = images.shift(); // if not you could also set the background (or backgroundImage) css property // document.getElementById(elements.shift()).style.background = "url(" + images.shift() + ")"; } setTimeout(fetchImages, 5000); } } // bind to window onload window.onload = fetchImages; // if you're going to use something like jquery then do something like this instead //$(fetchImages); }(['url1', 'url2', 'url3'], ['img1', 'img2', 'img3'])) </script>"; Page.ClientScript.RegisterClientScriptBlock(typeof(ui_SUBMVGInfo), "SmartPenCheck", strJS); The second Questin is; ... ... g(ctrlIDBirthPlaceCode).onchange(); }} </script> <script language = javascript> var url1 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Adiniz'; var url2 ='http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Soyadiniz'; var url3 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_tarih'; var url4 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Adiniz'; var url5 ='http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Soyadiniz'; var url6 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_tarih'; var url7 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Adiniz'; var url8 ='http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Soyadiniz'; var url9 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_tarih'; var url10 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Adiniz'; var url11 ='http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_Soyadiniz'; var url12 = 'http://localhost:3645/ImageHandler.ashx?FormId=XXX.11&FieldId=s1_tarih'; function(images, elements) {var fetchImages = function() {if(images.length > 0) {var numImages = 5; while(images.length > 0 && numImages-- > 0) { document.getElementById(elements.shift()).src = images.shift(); }setTimeout(fetchImages, 5000); }}window.onload = fetchImages; }(['+url1+', '+url2+', '+url3+','+url4+', '+url5+', '+url6+','+url7+', '+url8+', '+url9+','+url10+', '+url11+', '+url12+'], ['ui_taskFormControl$ctl03$ctl00$ctl03$ui_CustomerNameImage', 'ui_taskFormControl$ctl03$ctl00$ctl03$ui_CustomerSurNameImage', 'ui_taskFormControl$ctl03$ctl00$ctl03$ui_MaritalStatusImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_SexImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_BirthDateImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_BirthPlaceCodeImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_BirthPlaceImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_IdNationalityImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_MotherOldSurNameImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_TaxNoImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_CitizenshipNoImage','ui_taskFormControl$ctl03$ctl00$ctl03$ui_HomePhoneImage'])); </script> <script> var ui_BirthPlaceCode_a='Intertech.Utility'; var ui_BirthPlaceCode_c='Intertech.Utility.Common'; var ui_BirthPlaceCode_sbn=''; ... .. What do you think is it allright or how can I do that? And according to second question above; the use of the code is correct? ref:** PS: To see my purpose please continue reading below; There is a web site page which is coded on asp.net with using c# and ajax is enabled too. I want a very fast loading web page; which is going to happen with the following architecture; 1- First all data is shown by the text boxes (There are 50 text boxes, it is an application form.) 2- When the web Page is requested and loaded, then I want all the photos are shown near the each text boxes 10 by 10 from top of the page till the end of it. (Each photo is between 5 kb - 20 kb; ) I know ImageHandler's the question is how can I put all these idea into real life? some examples and ideas will be great ! thanks This issue has been answered and you may have a look - here Regards Bk

    Read the article

  • i have made a from and want to connect it to a oracle 10g data base using php.can you please assume

    - by nachiket-panse
    http://www.freecsstemplates.org Released for free under a Creative Commons Attribution 2.5 License -- Sitename.com by Free Css Templates MANAGEMEINT INFORMATION SYSTEM   <p class="style2">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;REGISTRY ENTRY FORM </p> <form id="form2" method="post" action=""> <p align="center">&nbsp;</p> <p align="center"><span class="style3">JOB DESCRIPTION :</span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <textarea name="textarea"></textarea> </p> <p align="center"><span class="style3">QUANTITY :</span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <input type="text" name="textfield5" /> </p> <p align="center">&nbsp;<span class="style3">CONTACT PERSON </span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <input type="text" name="textfield3" /> </p> <p align="center">&nbsp;</p> <p align="center"><span class="style3">DIVISION CODE: <textarea name="textarea3"></textarea> </span></p> <p align="center"><span class="style3">ACCEPTANCE DATE </span>: <input type="text" name="textfield4" /> </p> <p align="center"><span class="style3">REFERENCE NUMBER :</span> <input type="text" name="textfield2" /> </p> <p align="center"><span class="style3">CLASSIFICATION :</span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <input type="text" name="textfield" /></p> <p align="center">&nbsp;</p> <p align="center"><span class="style3">CUMULATIVE COST: </span> <select name="select"> </select> </p> <p align="center"><span class="style3">PLANNING ENGR: </span> <textarea name="textarea2"></textarea> </p> <p align="center"><span class="style3">PLANNING: </span> <input type="text" name="textfield6" /> </p> <p align="center"> <span class="style3">FILL THE COMPLETION DATE: </span> <input type="text" name="textfield7" /> </p> <p align="center"><span class="style3">REMARKS: </span> <input type="text" name="textfield8" /> </p> <p align="center">&nbsp;</p> <p align="center"> <input type="submit" name="SAVE" value="SAVE" /> <input type="submit" name="Submit2" value="LIST" /> <input type="submit" name="Submit" value="ADD" /> <input type="submit" name="Submit3" value="CANCEL" /> <input type="submit" name="BACK" value="BACK" /></p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> </form> <p align="center" class="style2">&nbsp;</p>

    Read the article

  • PHP: Strange behaviour while calling custom php functions

    - by baltusaj
    I am facing a strange behavior while coding in PHP with Flex. Let me explain the situation: I have two funcions lets say: populateTable() //puts some data in a table made with flex createXML() //creates an xml file which is used by Fusion Charts to create a chart Now, if i call populateTable() alone, the table gets populated with data but if i call it with createXML(), the table doesn't get populated but createXML() does it's work i.e. creates an xml file. Even if i run following code, only xml file gets generated but table remains empty whereas i called populateTable() before createXML(). Any idea what may be going wrong? MXML Part <mx:HTTPService id="userRequest" url="request.php" method="POST" resultFormat="e4x"> <mx:request xmlns=""> <getResult>send</getResult> </mx:request> and <mx:DataGrid id="dgUserRequest" dataProvider="{userRequest.lastResult.user}" x="28.5" y="36" width="525" height="250" > <mx:columns> <mx:DataGridColumn headerText="No." dataField="no" /> <mx:DataGridColumn headerText="Name" dataField="name"/> <mx:DataGridColumn headerText="Age" dataField="age"/> </mx:columns> PHP Part <?php //-------------------------------------------------------------------------- function initialize($username,$password,$database) //-------------------------------------------------------------------------- { # Connect to the database $link = mysql_connect("localhost", $username,$password); if (!$link) { die('Could not connected to the database : ' . mysql_error()); } # Select the database $db_selected = mysql_select_db($database, $link); if (!$db_selected) { die ('Could not select the DB : ' . mysql_error()); } // populateTable(); createXML(); # Close database connection } //-------------------------------------------------------------------------- populateTable() //-------------------------------------------------------------------------- { if($_POST['getResult'] == 'send') { $Result = mysql_query("SELECT * FROM session" ); $Return = "<Users>"; $no = 1; while ( $row = mysql_fetch_object( $Result ) ) { $Return .= "<user><no>".$no."</no><name>".$row->name."</name><age>".$row->age."</age><salary>". $row->salary."</salary></session>"; $no=$no+1; $Return .= "</Users>"; mysql_free_result( $Result ); print ($Return); } //-------------------------------------------------------------------------- createXML() //-------------------------------------------------------------------------- { $users=array ( "0"=>array("",0), "1"=>array("Obama",0), "2"=>array("Zardari",0), "3"=>array("Imran Khan",0), "4"=>array("Ahmadenijad",0) ); $selectedUsers=array(1,4); //this means only obama and ahmadenijad are selected and the xml file will contain info related to them only //Extracting salaries of selected users $size=count($users); for($i = 0; $i<$size; $i++) { //initialize temp which will calculate total throughput for each protocol separately $salary = 0; $result = mysql_query("SELECT salary FROM userInfo where name='$users[$selectedUsers[$i]][0]'"); $row = mysql_fetch_array($result)) $salary = $row['salary']; } $users[$selectedUsers[$i]][1]=$salary; } //creating XML string $chartContent = "<chart caption=\"Users Vs Salaries\" formatNumberScale=\"0\" pieSliceDepth=\"30\" startingAngle=\"125\">"; for($i=0;$i<$size;$i++) { $chartContent .= "<set label=\"".$users[$selectedUsers[$i]][0]."\" value=\"".$users[$selectedUsers[$i]][1]."\"/>"; } $chartContent .= "<styles>" . "<definition>" . "<style type=\"font\" name=\"CaptionFont\" size=\"16\" color=\"666666\"/>" . "<style type=\"font\" name=\"SubCaptionFont\" bold=\"0\"/>" . "</definition>" . "<application>" . "<apply toObject=\"caption\" styles=\"CaptionFont\"/>" . "<apply toObject=\"SubCaption\" styles=\"SubCaptionFont\"/>" . "</application>" . "</styles>" . "</chart>"; $file_handle = fopen('ChartData.xml','w'); fwrite($file_handle,$chartContent); fclose($file_handle); } initialize("root","","hiddenpeak"); ?>

    Read the article

  • PHP - not returning a count number for filled array...

    - by Phil Jackson
    Morning, this is eating me alive so Im hoping it's not something stupid, lol. $arrg = array(); if( str_word_count( $str ) > 1 ) { $input_arr = explode(' ', $str); die(print_r($input_arr)); $count = count($input_arr); die($count); above is part of a function. when i run i get; > Array ( > [0] => luke > [1] => snowden > [2] => create > [3] => develop > [4] => web > [5] => applications > [6] => sites > [7] => alse > [8] => dab > [9] => hand > [10] => design > [11] => love > [12] => helping > [13] => business > [14] => thrive > [15] => latest > [16] => industry > [17] => developer > [18] => act > [19] => designs > [20] => php > [21] => mysql > [22] => jquery > [23] => ajax > [24] => xhtml > [25] => css > [26] => de > [27] => montfont > [28] => award > [29] => advanced > [30] => programming > [31] => taught > [32] => development > [33] => years > [34] => experience > [35] => topic > [36] => fully > [37] => qualified > [38] => electrician > [39] => city > [40] => amp > [41] => guilds > [42] => level ) Which im expecting; run this however and nothing is returned!?!?! $arrg = array(); if( str_word_count( $str ) > 1 ) { $input_arr = explode(' ', $str); //die(print_r($input_arr)); $count = count($input_arr); die($count); can anyone see anything that my eyes cant?? regards, Phil

    Read the article

  • Saving in mongoDb with Mongoose, unexpected elements saved

    - by guiomie
    When I write in my mongoDB with mongoose the operation is treated with success, my document is saved, but there is also all kind of weird other sutff written down. It seems to be mongoose code. What could cause this? I add stuff in a specific array with: resultReference.ref[arrayLocation].allEvents.push(theEvent); {id: 11, allEvents: [] } is the structure of a ref element, and I push theEvent in the allEvents array. I then resultReference.save() I use express, mongoose and mongoHQ for database. I tried on a local mongo server, and this annoyance is still there. I've print in my console the document to write before save() and non of this weird code is there. { id 11 allEvents [ 0 { _events { maxListeners 0 } _doc { _id {"$oid": "4eb87834f54944e263000003"} title "Test" allDay false start 2011-11-10 13:00:00 UTC end 2011-11-10 15:00:00 UTC url "/test/4eb87834f54944e263000002" color "#99CCFF" ref "4eb87834f54944e263000002" } _activePaths { paths { title "modify" allDay "modify" start "modify" end "modify" url "modify" color "modify" ref "modify" } states { init { } modify { title true allDay true start true end true url true color true ref true } require { } } stateNames [ 0 "require" 1 "modify" 2 "init" ] } _saveError null _validationError null isNew true _pres { save [ 0 function (next) { // we keep the error semaphore to make sure we don't // call `save` unnecessarily (we only need 1 error) var subdocs = 0 , error = false , self = this; var arrays = this._activePaths .map('init', 'modify', function (i) { return self.getValue(i); }) .filter(function (val) { return (val && val instanceof DocumentArray && val.length); }); if (!arrays.length) return next(); arrays.forEach(function (array) { subdocs += array.length; array.forEach(function (value) { if (!error) value.save(function (err) { if (!error) { if (err) { error = true; next(err); } else --subdocs || next(); } }); }); }); } 1 "function checkForExistingErrors(next) { if (self._saveError){ next(self._saveError); self._saveError = null; } else { next(); } }" 2 "function validation(next) { return self.validate.call(self, next); }" ] } _posts { save [ ] } save function () { var self = this , hookArgs // arguments eventually passed to the hook - are mutable , lastArg = arguments[arguments.length-1] , pres = this._pres[name] , posts = this._posts[name] , _total = pres.length , _current = -1 , _asyncsLeft = proto[name].numAsyncPres , _next = function () { if (arguments[0] instanceof Error) { return handleError(arguments[0]); } var _args = Array.prototype.slice.call(arguments) , currPre , preArgs; if (_args.length && !(arguments[0] === null && typeof lastArg === 'function')) hookArgs = _args; if (++_current < _total) { currPre = pres[_current] if (currPre.isAsync && currPre.length < 2) throw new Error("Your pre must have next and done arguments -- e.g., function (next, done, ...)"); if (currPre.length < 1) throw new Error("Your pre must have a next argument -- e.g., function (next, ...)"); preArgs = (currPre.isAsync ? [once(_next), once(_asyncsDone)] : [once(_next)]).concat(hookArgs); return currPre.apply(self, preArgs); } else if (!proto[name].numAsyncPres) { return _done.apply(self, hookArgs); } } , _done = function () { var args_ = Array.prototype.slice.call(arguments) , ret, total_, current_, next_, done_, postArgs; if (_current === _total) { ret = fn.apply(self, args_); total_ = posts.length; current_ = -1; next_ = function () { if (arguments[0] instanceof Error) { return handleError(arguments[0]); } var args_ = Array.prototype.slice.call(arguments, 1) , currPost , postArgs; if (args_.length) hookArgs = args_; if (++current_ < total_) { currPost = posts[current_] if (currPost.length < 1) throw new Error("Your post must have a next argument -- e.g., function (next, ...)"); postArgs = [once(next_)].concat(hookArgs); return currPost.apply(self, postArgs); } }; if (total_) return next_(); return ret; } }; if (_asyncsLeft) { function _asyncsDone (err) { if (err && err instanceof Error) { return handleError(err); } --_asyncsLeft || _done.apply(self, hookArgs); } } function handleError (err) { if ('function' == typeof lastArg) return lastArg(err); if (errorCb) return errorCb.call(self, err); throw err; } return _next.apply(this, arguments); } errors null } ] } ]

    Read the article

  • No module named sqlalchemy when installing ckanext-viewhelpers

    - by kean23
    I'm using CKAN as my open data portal and am trying to install the ckanext-viewhelpers Extension by following the instructions at https://github.com/ckan/ckanext-viewhelpers. /usr/lib/ckan/default/src/ckanext-viewhelpers-master$ sudo python setup.py installChecking .pth file support in /usr/local/lib/python2.7/dist-packages/ /usr/bin/python -E -c pass TEST PASSED: /usr/local/lib/python2.7/dist-packages/ appears to support .pth files running bdist_egg running egg_info writing ckanext_viewhelpers.egg-info/PKG-INFO writing namespace_packages to ckanext_viewhelpers.egg-info/namespace_packages.txt writing top-level names to ckanext_viewhelpers.egg-info/top_level.txt writing dependency_links to ckanext_viewhelpers.egg-info/dependency_links.txt writing entry points to ckanext_viewhelpers.egg-info/entry_points.txt reading manifest file 'ckanext_viewhelpers.egg-info/SOURCES.txt' reading manifest template 'MANIFEST.in' writing manifest file 'ckanext_viewhelpers.egg-info/SOURCES.txt' installing library code to build/bdist.linux-x86_64/egg running install_lib running build_py creating build/bdist.linux-x86_64/egg creating build/bdist.linux-x86_64/egg/ckanext copying build/lib.linux-x86_64-2.7/ckanext/__init__.py -> build/bdist.linux-x86_64/egg/ckanext creating build/bdist.linux-x86_64/egg/ckanext/viewhelpers copying build/lib.linux-x86_64-2.7/ckanext/viewhelpers/plugin.py -> build/bdist.linux-x86_64/egg/ckanext/viewhelpers copying build/lib.linux-x86_64-2.7/ckanext/viewhelpers/__init__.py -> build/bdist.linux-x86_64/egg/ckanext/viewhelpers creating build/bdist.linux-x86_64/egg/ckanext/viewhelpers/tests copying build/lib.linux-x86_64-2.7/ckanext/viewhelpers/tests/__init__.py -> build/bdist.linux-x86_64/egg/ckanext/viewhelpers/tests copying build/lib.linux-x86_64-2.7/ckanext/viewhelpers/tests/test_view.py -> build/bdist.linux-x86_64/egg/ckanext/viewhelpers/tests creating build/bdist.linux-x86_64/egg/ckanext/viewhelpers/public creating build/bdist.linux-x86_64/egg/ckanext/viewhelpers/public/vendor copying build/lib.linux-x86_64-2.7/ckanext/viewhelpers/public/vendor/queryStringToJSON.js -> build/bdist.linux-x86_64/egg/ckanext/viewhelpers/public/vendor copying build/lib.linux-x86_64-2.7/ckanext/viewhelpers/public/resource.config -> build/bdist.linux-x86_64/egg/ckanext/viewhelpers/public copying build/lib.linux-x86_64-2.7/ckanext/viewhelpers/public/filters_form.css -> build/bdist.linux-x86_64/egg/ckanext/viewhelpers/public copying build/lib.linux-x86_64-2.7/ckanext/viewhelpers/public/filters.js -> build/bdist.linux-x86_64/egg/ckanext/viewhelpers/public copying build/lib.linux-x86_64-2.7/ckanext/viewhelpers/public/filters_form.js -> build/bdist.linux-x86_64/egg/ckanext/viewhelpers/public byte-compiling build/bdist.linux-x86_64/egg/ckanext/__init__.py to __init__.pyc byte-compiling build/bdist.linux-x86_64/egg/ckanext/viewhelpers/plugin.py to plugin.pyc byte-compiling build/bdist.linux-x86_64/egg/ckanext/viewhelpers/__init__.py to __init__.pyc byte-compiling build/bdist.linux-x86_64/egg/ckanext/viewhelpers/tests/__init__.py to __init__.pyc byte-compiling build/bdist.linux-x86_64/egg/ckanext/viewhelpers/tests/test_view.py to test_view.pyc creating build/bdist.linux-x86_64/egg/EGG-INFO copying ckanext_viewhelpers.egg-info/PKG-INFO -> build/bdist.linux-x86_64/egg/EGG-INFO copying ckanext_viewhelpers.egg-info/SOURCES.txt -> build/bdist.linux-x86_64/egg/EGG-INFO copying ckanext_viewhelpers.egg-info/dependency_links.txt -> build/bdist.linux-x86_64/egg/EGG-INFO copying ckanext_viewhelpers.egg-info/entry_points.txt -> build/bdist.linux-x86_64/egg/EGG-INFO copying ckanext_viewhelpers.egg-info/namespace_packages.txt -> build/bdist.linux-x86_64/egg/EGG-INFO copying ckanext_viewhelpers.egg-info/not-zip-safe -> build/bdist.linux-x86_64/egg/EGG-INFO copying ckanext_viewhelpers.egg-info/top_level.txt -> build/bdist.linux-x86_64/egg/EGG-INFO creating 'dist/ckanext_viewhelpers-0.1-py2.7.egg' and adding 'build/bdist.linux-x86_64/egg' to it removing 'build/bdist.linux-x86_64/egg' (and everything under it) Processing ckanext_viewhelpers-0.1-py2.7.egg removing '/usr/local/lib/python2.7/dist-packages/ckanext_viewhelpers-0.1-py2.7.egg' (and everything under it) creating /usr/local/lib/python2.7/dist-packages/ckanext_viewhelpers-0.1-py2.7.egg Extracting ckanext_viewhelpers-0.1-py2.7.egg to /usr/local/lib/python2.7/dist-packages ckanext-viewhelpers 0.1 is already the active version in easy-install.pth Installed /usr/local/lib/python2.7/dist-packages/ckanext_viewhelpers-0.1-py2.7.egg Processing dependencies for ckanext-viewhelpers==0.1 Finished processing dependencies for ckanext-viewhelpers==0.1 However I am faced with this error which I could not solve after adding viewhelpers in my CKAN config file. paster serve /etc/ckan/default/development.ini Traceback (most recent call last): File "/usr/bin/paster", line 4, in <module> command.run() File "/usr/lib/python2.7/dist-packages/paste/script/command.py", line 104, in run invoke(command, command_name, options, args[1:]) File "/usr/lib/python2.7/dist-packages/paste/script/command.py", line 143, in invoke exit_code = runner.run(args) File "/usr/lib/python2.7/dist-packages/paste/script/command.py", line 238, in run result = self.command() File "/usr/lib/python2.7/dist-packages/paste/script/serve.py", line 284, in command relative_to=base, global_conf=vars) File "/usr/lib/python2.7/dist-packages/paste/script/serve.py", line 321, in loadapp **kw) File "/usr/lib/python2.7/dist-packages/paste/deploy/loadwsgi.py", line 247, in loadapp return loadobj(APP, uri, name=name, **kw) File "/usr/lib/python2.7/dist-packages/paste/deploy/loadwsgi.py", line 271, in loadobj global_conf=global_conf) File "/usr/lib/python2.7/dist-packages/paste/deploy/loadwsgi.py", line 296, in loadcontext global_conf=global_conf) File "/usr/lib/python2.7/dist-packages/paste/deploy/loadwsgi.py", line 320, in _loadconfig return loader.get_context(object_type, name, global_conf) File "/usr/lib/python2.7/dist-packages/paste/deploy/loadwsgi.py", line 454, in get_context section) File "/usr/lib/python2.7/dist-packages/paste/deploy/loadwsgi.py", line 476, in _context_from_use object_type, name=use, global_conf=global_conf) File "/usr/lib/python2.7/dist-packages/paste/deploy/loadwsgi.py", line 406, in get_context global_conf=global_conf) File "/usr/lib/python2.7/dist-packages/paste/deploy/loadwsgi.py", line 296, in loadcontext global_conf=global_conf) File "/usr/lib/python2.7/dist-packages/paste/deploy/loadwsgi.py", line 328, in _loadegg return loader.get_context(object_type, name, global_conf) File "/usr/lib/python2.7/dist-packages/paste/deploy/loadwsgi.py", line 620, in get_context object_type, name=name) File "/usr/lib/python2.7/dist-packages/paste/deploy/loadwsgi.py", line 646, in find_egg_entry_point possible.append((entry.load(), protocol, entry.name)) File "/usr/lib/python2.7/dist-packages/pkg_resources.py", line 1989, in load entry = __import__(self.module_name, globals(),globals(), ['__name__']) File "/usr/lib/ckan/default/src/ckan/ckan/config/middleware.py", line 9, in <module> import sqlalchemy as sa ImportError: No module named sqlalchemyckanext-viewhelpers

    Read the article

  • no Jquery only Javascrip fadein function with cleartype fot text

    - by Chetan
    Sorry guys.. I am not familiar with JavaScrip anymore but I need to add clear type of some thing which can make text anti-aliased in IE7 browser. My script as follow // JavaScript Document var CurrentDivIndex=0; var TimeOutValue; var btn; var TimeToFade = 1000.0; function ShowDivSlideShow() { try { if(CurrentDivIndex == 5) CurrentDivIndex=0; CurrentDivIndex++; //alert("Banner" + CurrentDivIndex); //alert(CurrentDivIndex); var Indexer=1; while(Indexer<6) { var DivToShow=document.getElementById("Banner" + Indexer); DivToShow.style.display = "none"; btn=document.getElementById("btnb" + Indexer); btn.setAttribute("class","none"); Indexer++; } var DivToShow=document.getElementById("Banner" + CurrentDivIndex); DivToShow.style.display = "block"; btn=document.getElementById("btnb" + CurrentDivIndex); btn.setAttribute("class","activeSlide"); // btn.className="activeSlide"; fadeIn(); TimeOutValue=setTimeout("ShowDivSlideShow()",6000); } catch(err) { alert(err) } } function ShowCustomDiv(CurrentDivIndexRec) { clearTimeout(TimeOutValue) CurrentDivIndex=CurrentDivIndexRec var Indexer=1; while(Indexer<6) { if(CurrentDivIndex==Indexer) { Indexer++; continue; } var DivToShow=document.getElementById("Banner" + Indexer); DivToShow.style.display = "none"; btn=document.getElementById("btnb" + Indexer); btn.setAttribute("class","none"); Indexer++; } var DivToShow=document.getElementById("Banner" + CurrentDivIndex); DivToShow.style.display = "block"; btn=document.getElementById("btnb" + CurrentDivIndex); btn.setAttribute("class","activeSlide"); btn.className="activeSlide" fadeIn(); } function ShowDivSlideShowWithTimeOut(CurrentDivIndexRec) { clearTimeout(TimeOutValue) CurrentDivIndex=CurrentDivIndexRec; var Indexer=1; while(Indexer<6) { if(CurrentDivIndex==Indexer) { Indexer++; continue; } var DivToShow=document.getElementById("Banner" + Indexer); DivToShow.style.display = "none"; btn=document.getElementById("btnb" + Indexer); btn.setAttribute("class","none"); Indexer++; } var DivToShow=document.getElementById("Banner" + CurrentDivIndexRec); DivToShow.style.display = "block"; btn=document.getElementById("btnb" + CurrentDivIndexRec); btn.setAttribute("class","activeSlide"); TimeOutValue=setTimeout("ShowDivSlideShow()",6000); } function ShowCustomDivOnClick(CurrentDivIndexRec) { clearTimeout(TimeOutValue) CurrentDivIndex=CurrentDivIndexRec; var Indexer=1; while(Indexer<6) { if(CurrentDivIndex==Indexer) { Indexer++; continue; } var DivToShow=document.getElementById("Banner" + Indexer); DivToShow.style.display = "none"; btn=document.getElementById("btnb" + Indexer); btn.setAttribute("class","none"); Indexer++; } var DivToShow=document.getElementById("Banner" + CurrentDivIndexRec); DivToShow.style.display = "block"; btn=document.getElementById("btnb" + CurrentDivIndexRec); btn.setAttribute("class","activeSlide"); fadeIn(); TimeOutValue=setTimeout("ShowDivSlideShow()",6000); } function setOpacity(level) { element=document.getElementById("Banner" + CurrentDivIndex); element.style.opacity = level; element.style.MozOpacity = level; element.style.KhtmlOpacity = level; element.style.filter = "alpha(opacity=" + (level * 100) + ");"; } var duration = 300; /* 1000 millisecond fade = 1 sec */ var steps = 10; /* number of opacity intervals */ var delay = 6000; /* 5 sec delay before fading out */ function fadeIn(){ for (i = 0; i <= 1; i += (1 / steps)) { setTimeout("setOpacity(" + i + ")", i * duration); } // setTimeout("fadeOut()", delay); } function fadeOut() { for (i = 0; i <= 1; i += (1 / steps)) { setTimeout("setOpacity(" + (1 - i) + ")", i * duration); } setTimeout("fadeIn()", duration); } //end of script Now I am very confused where to add : $('#slideshow').cycle({ cleartype: 1 // enable cleartype corrections }); or $('#fadingElement').fadeIn(2000, function(){ $(this).css('filter',''); }); so it will work... Please Help me...

    Read the article

  • How to replace a div container with javascript

    - by Kovu
    Hi, I must have a little design in javascript. I have a menu with 5 entrys and only 1 HTML-page. So I will have a content-div and enabled and disabled different static content in it, each menu-entry is another content. I tried with 5 divs and disable 4 of them and enable 1, but the element under each other means every div is like a - enabled or not, so the "content" is moving then. Hope its understandable. Here is the code so far: <html><head><title>Des Einsame-Katerchen's kleine Homepage</title> <style type="text/css"> a:link { font-weight:bold; color:blue; text-decoration:none; } a:visited { font-weight:bold; color:blue; text-decoration:none; } a:focus { font-weight:bold; color:blue; text-decoration:none; } a:hover { font-weight:bold; color:blue; text-decoration:line-through; } a:active { font-weight:bold; color:blue; text-decoration:none; } h1:focus { background-color:red; } h1:hover { background-color:silver; } h1:active { background-color:green; } </style> <script> function an(id) { document.getElementById('start').style.visibility = 'hidden'; document.getElementById('start').style.height = '0px'; document.getElementById('me').style.visibility = 'hidden'; document.getElementById('me').style.height = '0px'; document.getElementById('rpg').style.visibility = 'hidden'; document.getElementById('rpg').style.height = '0px'; document.getElementById('musik').style.visibility = 'hidden'; document.getElementById('musik').style.height = '0px'; document.getElementById('screens').style.visibility = 'hidden'; document.getElementById('screens').style.height = '0px'; document.getElementById(id).style.visibility = 'visible'; document.getElementById(id).style.height = '500px'; } </script> </head> <body style=" " > <div style="width=100%; text-align:center; border: 1px red solid; height:40px;"> <div style="float:left; width:100px;"><a href="#" OnClick="an('start')" >Startseite</a></div> <div style="float:left; width:100px;"><a href="#" OnClick="an('me')" >Über mich</a></div> <div style="float:left; width:100px;"><a href="#" OnClick="an('rpg')" >RPG-Chars</a></div> <div style="float:left; width:100px;"><a href="#" OnClick="an('musik')" >Musik</a></div> <div style="float:left; width:150px;"><a href="#" OnClick="an('screens')" >Knuddels-Screens</a></div> </div> <br> <div id="start" style="border:1px red solid; width:500px; height:500px; overflow: visible; " > a </div> <div id="me" style="border:1px red solid; width:500px; height:0px; overflow: visible; visibility: hidden; " > b </div> <div id="rpg" style="border:1px red solid; width:500px; height:0px; overflow: visible; visibility: hidden; " > c </div> <div id="musik" style="border:1px red solid; width:500px; height:0px; overflow: visible; visibility: hidden; " > d </div> <div id="screens" style="border:1px red solid; width:500px; height:0px; overflow: visible; visibility: hidden; " > e </div> </body>

    Read the article

  • .NET interview, code structure and the design

    - by j_lewis
    I have been given the below .NET question in an interview. I don’t know why I got low marks. Unfortunately I did not get a feedback. Question: The file hockey.csv contains the results from the Hockey Premier League. The columns ‘For’ and ‘Against’ contain the total number of goals scored for and against each team in that season (so Alabama scored 79 goals against opponents, and had 36 goals scored against them). Write a program to print the name of the team with the smallest difference in ‘for’ and ‘against’ goals. the structure of the hockey.csv looks like this (it is a valid csv file, but I just copied the values here to get an idea) Team - For - Against Alabama 79 36 Washinton 67 30 Indiana 87 45 Newcastle 74 52 Florida 53 37 New York 46 47 Sunderland 29 51 Lova 41 64 Nevada 33 63 Boston 30 64 Nevada 33 63 Boston 30 64 Solution: class Program { static void Main(string[] args) { string path = @"C:\Users\<valid csv path>"; var resultEvaluator = new ResultEvaluator(string.Format(@"{0}\{1}",path, "hockey.csv")); var team = resultEvaluator.GetTeamSmallestDifferenceForAgainst(); Console.WriteLine( string.Format("Smallest difference in ‘For’ and ‘Against’ goals > TEAM: {0}, GOALS DIF: {1}", team.Name, team.Difference )); Console.ReadLine(); } } public interface IResultEvaluator { Team GetTeamSmallestDifferenceForAgainst(); } public class ResultEvaluator : IResultEvaluator { private static DataTable leagueDataTable; private readonly string filePath; private readonly ICsvExtractor csvExtractor; public ResultEvaluator(string filePath){ this.filePath = filePath; csvExtractor = new CsvExtractor(); } private DataTable LeagueDataTable{ get { if (leagueDataTable == null) { leagueDataTable = csvExtractor.GetDataTable(filePath); } return leagueDataTable; } } public Team GetTeamSmallestDifferenceForAgainst() { var teams = GetTeams(); var lowestTeam = teams.OrderBy(p => p.Difference).First(); return lowestTeam; } private IEnumerable<Team> GetTeams() { IList<Team> list = new List<Team>(); foreach (DataRow row in LeagueDataTable.Rows) { var name = row["Team"].ToString(); var @for = int.Parse(row["For"].ToString()); var against = int.Parse(row["Against"].ToString()); var team = new Team(name, against, @for); list.Add(team); } return list; } } public interface ICsvExtractor { DataTable GetDataTable(string csvFilePath); } public class CsvExtractor : ICsvExtractor { public DataTable GetDataTable(string csvFilePath) { var lines = File.ReadAllLines(csvFilePath); string[] fields; fields = lines[0].Split(new[] { ',' }); int columns = fields.GetLength(0); var dt = new DataTable(); //always assume 1st row is the column name. for (int i = 0; i < columns; i++) { dt.Columns.Add(fields[i].ToLower(), typeof(string)); } DataRow row; for (int i = 1; i < lines.GetLength(0); i++) { fields = lines[i].Split(new char[] { ',' }); row = dt.NewRow(); for (int f = 0; f < columns; f++) row[f] = fields[f]; dt.Rows.Add(row); } return dt; } } public class Team { public Team(string name, int against, int @for) { Name = name; Against = against; For = @for; } public string Name { get; private set; } public int Against { get; private set; } public int For { get; private set; } public int Difference { get { return (For - Against); } } } Output: Smallest difference in for' andagainst' goals TEAM: Boston, GOALS DIF: -34 Can someone please review my code and see anything obviously wrong here? They were only interested in the structure/design of the code and whether the program produces the correct result (i.e lowest difference). Much appreciated. "P.S - Please correct me if the ".net-interview" tag is not the right tag to use"

    Read the article

  • jQuery Cycle Plugin - Content not cycling

    - by fmz
    I am setting up a page with jQuery's Cycle plugin and have four divs set to fade. I have the code in place, the images set, but it doesn't cycle properly. Firefox says there is a problem with the following code: <script type="text/javascript"> $(document).ready(function() { $('.slideshow').cycle({ fx: 'fade' }); }); </script> Here is the html: <div class="slideshow"> <div id="mainImg-1" class="slide"> <div class="quote"> <h2>Building Big Relationships with Small Business.</h2> <p>&ldquo;This is quote Number One.<br /> They are there when I need them the most.&rdquo;</p> <p><span class="author">Jane Doe &ndash; Charlotte Flower Shop</span></p> <div class="help"><a href="cb_services.html">Let Us Help You</a></div> </div> </div> <div id="mainImg-2" class="slide"> <div class="quote"> <h2>Building Big Relationships with Small Business.</h2> <p>&ldquo;This is quote Number Two.<br /> They are there when I need them the most.&rdquo;</p> <p><span class="author">Jane Doe &ndash; Charlotte Flower Shop</span></p> <div class="help"><a href="cb_services.html">Let Us Help You</a></div> </div> </div> <div id="mainImg-3" class="slide"> <div class="quote"> <h2>Building Big Relationships with Small Business.</h2> <p>&ldquo;This is quote Number three.<br /> They are there when I need them the most.&rdquo;</p> <p><span class="author">Jane Doe &ndash; Charlotte Flower Shop</span></p> <div class="help"><a href="cb_services.html">Let Us Help You</a></div> </div> </div> <div id="mainImg-4" class="slide"> <div class="quote"> <h2>Building Big Relationships with Small Business.</h2> <p>&ldquo;This is quote Number Fout.<br /> They are there when I need them the most.&rdquo;</p> <p><span class="author">Jane Doe &ndash; Charlotte Flower Shop</span></p> <div class="help"><a href="cb_services.html">Let Us Help You</a></div> </div> </div> Here is the CSS: .slideshow { width: 946px; height: 283px; border: 1px solid #c29c5d; margin: 8px; overflow: hidden; z-index: 1; } #mainImg-1 { width: 946px; height: 283px; background: url(../_images/main.jpg) no-repeat 9px 9px; } #mainImg-2 { width: 946px; height: 283px; background: url(../_images/main.jpg) no-repeat 9px 9px; } #mainImg-3 { width: 946px; height: 283px; background: url(../_images/main.jpg) no-repeat 9px 9px; } #mainImg-4 { width: 946px; height: 283px; background: url(../_images/main.jpg) no-repeat 9px 9px; } #mainImg-1 .quote, #mainImg-2 .quote, #mainImg-3 .quote, #mainImg-4 .quote { width: 608px; height: 168px; float: right; margin: 80px 11px 0 0; background: url(../_images/bg_quoteBox.png) repeat-x; } Before you go off and say, "hey, those images are all the same". You are right, the images are all the same right now, but the text should be rotating as well and there is a slight difference there. In addition, the fade should still show up. Anyway, you can see the dev page here: http://173.201.163.213/projectpath/first_trust/index.html I would appreciate some help to get this cycling through as it should. Thanks!

    Read the article

  • Returning Json object from controller action to jQuery

    - by PsychoCoder
    I'm attempting to get this working properly (2 days now). I'm working on a log in where I'm calling the controller action from jQuery, passing it a JSON object (utilizing json2.js) and returning a Json object from the controller. I'm able to call the action fine, but instead of being able to put the response where I want it it just opens a new window with this printed on the screen: {"Message":"Invalid username/password combination"} And the URL looks like http://localhost:13719/Account/LogOn so instead of calling the action and not reloading the page it's taking the user to the controller, which isn't good. So now for some code, first the controller code [HttpPost] public ActionResult LogOn(LogOnModel model, string returnUrl = "") { if (ModelState.IsValid) { var login = ObjectFactory.GetInstance<IRepository<PhotographerLogin>>(); var user = login.FindOne(x => x.Login == model.Username && x.Pwd == model.Password); if (user == null) return Json(new FailedLoginViewModel { Message = "Invalid username/password combination" }); else { if (!string.IsNullOrEmpty(returnUrl)) return Redirect(returnUrl); else return RedirectToAction("Index", "Home"); } } return RedirectToAction("Index", "Home"); } And the jQuery code $("#signin_submit").click(function () { var login = getLogin(); $.ajax({ type: "POST", url: "../Account/LogOn", data: JSON.stringify(login), dataType: 'json', contentType: 'application/json; charset=utf-8', error: function (xhr) { $("#message").text(xhr.statusText); }, success: function (result) { } }); }); function getLogin() { var un = $("#username").val(); var pwd = $("#password").val(); var rememberMe = $("#rememberme").val(); return (un == "") ? null : { Username: un, Password: pwd, RememberMe: rememberMe }; } In case you need to see the actual login form here that is as well <fieldset id="signin_menu"> <div> <span id="message"></span> </div> <% Html.EnableClientValidation(); %> <% using (Html.BeginForm("LogOn", "Account", FormMethod.Post, new { @id = "signin" })) {%> <% ViewContext.FormContext.ValidationSummaryId = "valLogOnContainer"; %> <%= Html.LabelFor(m => m.Username) %> <%= Html.TextBoxFor(m => m.Username, new { @class = "inputbox", @tabindex = "4", @id = "username" })%><%= Html.ValidationMessageFor(m => m.Username, "*")%> <p> <%= Html.LabelFor(m=>m.Password) %> <%= Html.PasswordFor(m => m.Password, new { @class = "inputbox", @tabindex = "5", @id = "password" })%><%= Html.ValidationMessageFor(m => m.Password, "*")%> </p> <p class="remember"> <input id="signin_submit" value="Sign in" tabindex="6" type="submit"/> <%= Html.CheckBoxFor(m => m.RememberMe, new { @class = "inputbox", @tabindex = "7", @id = "rememberme" })%> <%= Html.LabelFor(m => m.RememberMe) %> <p class="forgot"> <a href="#" id="forgot_password_link" title="Click here to reset your password.">Forgot your password?</a> </p> <p class="forgot-username"> <a href="#" id="forgot_username_link" title="Fogot your login name? We can help with that">Forgot your username?</a> </p> </p> <%= Html.ValidationSummaryJQuery("Please fix the following errors.", new Dictionary<string, object> { { "id", "valLogOnContainer" } })%> <% } %> </fieldset> The login form is loaded on the main page with <% Html.RenderPartial("LogonControl");%> Not sure if that has any bearing on this or not but thought I'd mention it. EDIT: The login form is loaded similar to the Twitter login, click a link and the form loads with the help of jQuery & CSS

    Read the article

  • a program similar to ls with some modifications

    - by Bond
    Hi, here is a simple puzzle I wanted to discuss. A C program to take directory name as command line argument and print last 3 directories and 3 files in all subdirectories without using api 'system' inside it. suppose directory bond0 contains bond1, di2, bond3, bond4, bond5 and my_file1, my_file2, my_file3, my_file4, my_file5, my_file6 and bond1 contains bond6 my_file7 my_file8 my_file9 my_file10 program should output - bond3, bond4, bond5, my_file4, my_file5, my_file6, bond6, my_file8, my_file9, my_file10 My code for the above problem is here #include<dirent.h> #include<unistd.h> #include<string.h> #include<sys/stat.h> #include<stdlib.h> #include<stdio.h> char *directs[20], *files[20]; int i = 0; int j = 0; int count = 0; void printdir(char *); int count_dirs(char *); int count_files(char *); int main() { char startdir[20]; printf("Scanning user directories\n"); scanf("%s", startdir); printdir(startdir); } void printdir(char *dir) { printf("printdir called %d directory is %s\n", ++count, dir); DIR *dp = opendir(dir); int nDirs, nFiles, nD, nF; nDirs = 0; nFiles = 0; nD = 0; nF = 0; if (dp) { struct dirent *entry = 0; struct stat statBuf; nDirs = count_dirs(dir); nFiles = count_files(dir); printf("The no of subdirectories in %s is %d \n", dir, nDirs); printf("The no of files in %s is %d \n", dir, nFiles); while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { } if (S_ISDIR(statBuf.st_mode)) { nD++; if ((nDirs - nD) < 3) { printf("The directory is %s\n",entry->d_name); } } else { nF++; if ((nFiles - nF) < 3) { printf("The files are %s\n", entry->d_name); } //if } //else free(filepath); } //if(filepath) } //while while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } printf("In second while loop *entry=%s\n",entry->d_name); char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { } if (S_ISDIR(statBuf.st_mode)) { printdir(entry->d_name); } } //else free(filepath); } //2nd while closedir(dp); } else { fprintf(stderr, "Error, cannot open directory %s\n", dir); } } //printdir int count_dirs(char *dir) { DIR *dp = opendir(dir); int nD; nD = 0; if (dp) { struct dirent *entry = 0; struct stat statBuf; while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { fprintf(stderr, "File Not found? %s\n", filepath); } if (S_ISDIR(statBuf.st_mode)) { nD++; } else { continue; } free(filepath); } } closedir(dp); } else { fprintf(stderr, "Error, cannot open directory %s\n", dir); } return nD; } int count_files(char *dir) { DIR *dp = opendir(dir); int nF; nF = 0; if (dp) { struct dirent *entry = 0; struct stat statBuf; while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { fprintf(stderr, "File Not found? %s\n", filepath); } if (S_ISDIR(statBuf.st_mode)) { continue; } else { nF++; } free(filepath); } } closedir(dp); } else { fprintf(stderr, "Error, cannot open file %s\n", dir); } return nF; } The above code I wrote is a bit not functioning correctly can some one help me to understand the error which is coming.So that I improve it further.There seems to be some small glitch which is not clear to me right now.

    Read the article

  • how do I use html block snippets with dynamic content inside a django template that extends another

    - by stackoverflowusername
    Hi. Can someone please help me figure out a way to achieve the following (see snippets below) in Django templates? I know that you cannot use more than one extends, but I am new to django and I do not know the proper syntax for something like this. I want to be able to do this so that I can use my nested div layout for css reasons without having to type it like that each time and risking a typo. In words, I want to be able to have a page template extend my base.html file and then use html snippets of dynamic template content (i.e. template for loops or other template logic devices, not just a context variable I set from my view controller). ------------------------------------------------------------ base.html ------------------------------------------------------------ <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en"> <head> <meta http-equiv="Content-Type" content="text/html;charset=utf-8" /> <title>{% block title %}Title{% endblock %}</title> </head> <body> <div class="wrapper"> <div class="header"> This is the common header </div> <div class="nav"> This is the common nav </div> {% if messages %} <div class="messages"> <ul> {% for message in messages %} <li{% if message.tags %} class="{{ message.tags }}"{% endif %}>{{ message }}</li> {% endfor %} </ul> </div> {% endif %} <div class="content"> {% block content %}Page Content{% endblock %} </div> <div class="footer"> This is the common footer </div> </div> </body> </html> ------------------------------------------------------------ columnlayout2.html ------------------------------------------------------------ <div class="twocol container2"> <div class="container1"> <div class="col1"> {% block twocol_col1 %}{% endblock %} </div> <div class="col2"> {% block twocol_col2 %}{% endblock %} </div> </div> </div> ------------------------------------------------------------ columnlayout3.html ------------------------------------------------------------ <div class="threecol container3"> <div class="container2"> <div class="container1"> <div class="col1"> {% block threecol_col1 %}{% endblock %} </div> <div class="col2"> {% block threecol_col2 %}{% endblock %} </div> <div class="col3"> {% block threecol_col3 %}{% endblock %} </div> </div> </div> </div> ------------------------------------------------------------ page.html ------------------------------------------------------------ {% extends "base.html" %} {% block content %} {% extends "columnlayout2.html" %} {% block twocol_col1 %}twocolumn column 1{% endblock %} {% block twocol_col2 %}twocolumn column 2{% endblock %} {% extends "columnlayout3.html" %} {% block threecol_col1 %}threecol column 1{% endblock %} {% block threecol_col2 %}threecol column 2{% endblock %} {% block threecol_col3 %}threecol column 3{% endblock %} {% endblock %} ------------------------------------------------------------ page.html output ------------------------------------------------------------ <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en"> <head> <meta http-equiv="Content-Type" content="text/html;charset=utf-8" /> <title>Title</title> </head> <body> <div class="wrapper"> <div class="header"> This is the common header </div> <div class="nav"> This is the common nav </div> <div class="content"> <div class="twocol container2"> <div class="container1"> <div class="col1"> twocolumn column 1 </div> <div class="col2"> twocolumn column 2 </div> </div> </div> <div class="threecol container3"> <div class="container2"> <div class="container1"> <div class="col1"> threecol column 1 </div> <div class="col2"> threecol column 2 </div> <div class="col3"> threecol column 3 </div> </div> </div> </div> </div> <div class="footer"> This is the common footer </div> </div> </body> </html>

    Read the article

  • New hire expectations... (Am I being unreasonable?)

    - by user295841
    I work for a very small custom software shop. We currently consist me and my boss. My boss is an old FoxPro DOS developer and OOP makes him uncomfortable. He is planning on taking a back seat in the next few years to hopefully enjoy a “partial retirement”. I will be taking over the day to day operations and we are now desperately looking for more help. We tried Monster.com, Dice.com, and others a few years ago when we started our search. We had no success. We have tried outsourcing overseas (total disaster), hiring kids right out of college (mostly a disaster but that’s where I came from), interns (good for them, not so good for us) and hiring laid off “experienced” developers (there was a reason they were laid off). I have heard hiring practices discussed on podcasts, blogs, etc... and have tried a few. The “Fizz Buzz” test was a good one. One kid looked physically ill before he finally gave up. I think my problem is that I have grown so much as a developer since I started here that I now have a high standard. I hear/read very intelligent people podcasts and blogs and I know that there are lots of people out there that can do the job. I don’t want to settle for less than a “good” developer. Perhaps my expectations are unreasonable. I expect any good developer (entry level or experienced) to be billable (at least paying their own wage) in under one month. I expect any good developer to be able to be productive (at least dangerous) in any language or technology with only a few days of research/training. I expect any good developer to be able to take a project from initial customer request to completion with little or no help from others. Am I being unreasonable? What constitutes a valuable developer? What should be expected of an entry level developer? What should be expected of an experienced developer? I realize that everyone is different but there has to be some sort of expectations standard, right? I have been giving the test project below to potential canidates to weed them out. Good idea? Too much? Too little? Please let me know what you think. Thanks. Project ID: T00001 Description: Order Entry System Deadline: 1 Week Scope The scope of this project is to develop a fully function order entry system. Screen/Form design must be user friendly and promote efficient data entry and modification. User experience (Navigation, Screen/Form layouts, Look and Feel…) is at the developer’s discretion. System may be developed using any technologies that conform to the technical and system requirements. Deliverables Complete source code Database setup instructions (Scripts or restorable backup) Application installation instructions (Installer or installation procedure) Any necessary documentation Technical Requirements Server Platform – Windows XP / Windows Server 2003 / SBS Client Platform – Windows XP Web Browser (If applicable) – IE 8 Database – At developer’s discretion (Must be a relational SQL database.) Language – At developer’s discretion All data must be normalized. (+) All data must maintain referential integrity. (++) All data must be indexed for optimal performance. System must handle concurrency. System Requirements Customer Maintenance Customer records must have unique ID. Customer data will include Name, Address, Phone, etc. User must be able to perform all CRUD (Create, Read, Update, and Delete) operations on the Customer table. User must be able to enter a specific Customer ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a customer to edit. Validation must be performed prior to database commit. Customer record cannot be deleted if the customer has an order in the system. (++) Inventory Maintenance Part records must have unique ID. Part data will include Description, Price, UOM (Unit of Measure), etc. User must be able to perform all CRUD operations on the part table. User must be able to enter a specific Part ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a part to edit. Validation must be performed prior to database commit. Part record cannot be deleted if the part has been used in an order. (++) Order Entry Order records must have a unique auto-incrementing key (Order Number). Order data must be split into a header/detail structure. (+) Order can contain an infinite number of detail records. Order header data will include Order Number, Customer ID (++), Order Date, Order Status (Open/Closed), etc. Order detail data will include Part Number (++), Quantity, Price, etc. User must be able to perform all CRUD operations on the order tables. User must be able to enter a specific Order Number to edit. User must be able to pull up a sortable/queryable search grid/utility to find an order to edit. User must be able to print an order form from within the order entry form. Validation must be performed prior to database commit. Reports Customer Listing – All Customers in the system. Inventory Listing – All parts in the system. Open Order Listing – All open orders in system. Customer Order Listing – All orders for specific customer. All reports must include sorts and filter functions where applicable. Ex. Customer Listing by range of Customer IDs. Open Order Listing by date range.

    Read the article

  • on click checkbox set input attr

    - by Tommy Arnold
    html form with 4 columns the first 2 columns are the sizes inside input boxes with disabled ='disabled', when they click radio button to select a size a checkbox appears, when they click that checkbox I would like to change the class and disabled attr of the inputs on that table row to allow them to edit the input box <table width="388" border="1" id="product1"> <tr> <td width="100">Width</td> <td width="100">Height</td> <td width="48">Price</td> <td width="65">Select</td> </tr> <tr> <td><input type="text" disabled='disabled'value="200"/><span> CMS</span></td> <td><input disabled='disabled'type="text" value="500"/><span> CMS</span></td> <td>£50.00</td> <td><input type="radio" name="product1" value="size1" /> Customise<input type="checkbox" name="custom[size1]" class="custombox" value="1"/></td> </tr> <tr> <td>200</td> <td>1000</td> <td>£100.00</td> <td><input type="radio" name="product1" value="size2" /> Customise<input disabled='disabled' type="checkbox" name="custom[size2]" class="custombox" value="1"/></td> </tr> <tr> <td>200</td> <td>1500</td> <td>£150</td> <td><input type="radio" name="product1" value="size3" /> Customise<input type="checkbox" name="custom[size3]" class="custombox" value="1"/></td> </tr> </table> <table width="288" border="1" id="product2"> <tr> <td width="72">Width</td> <td width="75">Height</td> <td width="48">Price</td> <td width="65">&nbsp;</td> </tr> <tr> <td>200</td> <td>500</td> <td>£50.00</td> <td><input type="radio" name="product2" value="size1" /> Customise<input type="checkbox" name="custom[size1]" class="custombox" value="1"/></td> </tr> <tr> <td>200</td> <td>1000</td> <td>£100.00</td> <td><input type="radio" name="product2" value="size2" /> Customise<input type="checkbox" name="custom[size2]" class="custombox" value="1"/></td> </tr> <tr> <td>200</td> <td>1500</td> <td>£150</td> <td><input type="radio" name="product2" value="size3" /> Customise<input type="checkbox" name="custom[size3]" class="custombox" value="1"/></td> </tr> <table> CSS input[type=checkbox] { display: none; } input[type=checkbox].shown { display: inline; } input .edit{ border:1px solid red; } input[disabled='disabled'] { border:0px; width:60px; padding:5px; float:left; background:#fff; } span{float:left; width:30px; padding:5px;} Jquery $("body :checkbox").hide(); // The most obvious way is to set radio-button click handlers for each table separatly: $("#product1 :radio").click(function() { $("#product1 :checkbox").hide(); $("#product1 .cbox").hide(); $(this).parent().children(":checkbox").show(); $(this).parent().children(".cbox").show(); }); $("#product2 :radio").click(function() { $("#product2 :checkbox").hide(); $("#product2 .cbox").hide(); $(this).parent().children(":checkbox").show(); $(this).parent().children(".cbox").show(); }); This is what I thought but its not working $("#product1 :checkbox").click(function(){ $(this).parent("tr").children("td :input").attr('disabled',''); $(this).parent("tr").children("td :input").toggleClass(edit); }); $("#product2 :checkbox").click(function(){ $(this).parent("tr").children("td :input").attr('disabled',''); $(this).parent("tr").children("td :input").toggleClass(edit); }); Thanks in advance for any help.

    Read the article

  • Undefined reference to ...

    - by Patrick LaChance
    I keep getting this error message every time I try to compile, and I cannot find out what the problem is. any help would be greatly appreciated: C:\DOCUME~1\Patrick\LOCALS~1\Temp/ccL92mj9.o:main.cpp:(.txt+0x184): undefined reference to 'List::List()' C:\DOCUME~1\Patrick\LOCALS~1\Temp/ccL92mj9.o:main.cpp:(.txt+0x184): undefined reference to 'List::add(int)' collect2: ld returned 1 exit status code: //List.h #ifndef LIST_H #define LIST_H #include <exception> //brief Definition of linked list class class List { public: /** \brief Exception for operating on empty list */ class Empty : public std::exception { public: virtual const char* what() const throw(); }; /** \brief Exception for invalid operations other than operating on an empty list */ class InvalidOperation : public std::exception { public: virtual const char* what() const throw(); }; /** \brief Node within List */ class Node { public: /** data element stored in this node */ int element; /** next node in list */ Node* next; /** previous node in list */ Node* previous; Node (int element); ~Node(); void print() const; void printDebug() const; }; List(); ~List(); void add(int element); void remove(int element); int first()const; int last()const; int removeFirst(); int removeLast(); bool isEmpty()const; int size()const; void printForward() const; void printReverse() const; void printDebug() const; /** enables extra output for debugging purposes */ static bool traceOn; private: /** head of list */ Node* head; /** tail of list */ Node* tail; /** count of number of nodes */ int count; }; #endif //List.cpp I only included the parts of List.cpp that might be the issue #include "List.h" #include <iostream> #include <iomanip> using namespace std; List::List() { //List::size = NULL; head = NULL; tail = NULL; } List::~List() { Node* current; while(head != NULL) { current = head-> next; delete current->previous; if (current->next!=NULL) { head = current; } else { delete current; } } } void List::add(int element) { Node* newNode; Node* current; newNode->element = element; if(newNode->element > head->element) { current = head->next; } else { head->previous = newNode; newNode->next = head; newNode->previous = NULL; return; } while(newNode->element > current->element) { current = current->next; } if(newNode->element <= current->element) { newNode->previous = current->previous; newNode->next = current; } } //main.cpp #include "List.h" #include <iostream> #include <string> using namespace std; //void add(int element); int main (char** argv, int argc) { List* MyList = new List(); bool quit = false; string value; int element; while(quit==false) { cin>>value; if(value == "add") { cin>>element; MyList->add(element); } if(value=="quit") { quit = true; } } return 0; } I'm doing everything I think I'm suppose to be doing. main.cpp isn't complete yet, just trying to get the add function to work first. Any help will be greatly appreciated.

    Read the article

  • How I can get output from 1st frame textfield input text to 2nd frame textArea

    - by soulgreen
    Here is my 1st frame - I want went I input text in textfield example name then click button report will display output to 2nd frame using textArea... please help me import java.awt.; import java.awt.event.; import javax.swing.; import javax.swing.border.; public class Order extends JFrame implements ActionListener { private JPanel pInfo,pN, pIC, pDate,Blank,pBlank, button, pTotal; private JLabel nameL,icL,DateL; private JTextField nameTF, icTF; private JFormattedTextField DateTF; private JButton calB,clearB,exitB,reportB; public Order() { Container contentPane = getContentPane(); contentPane.setLayout(new BorderLayout()); contentPane.setBackground(Color.gray); pInfo = new JPanel(); pN = new JPanel(); pIC = new JPanel(); pDate = new JPanel(); nameTF = new JTextField(30); icTF = new JTextField(30); DateTF = new JFormattedTextField(java.util.Calendar.getInstance().getTime()); DateTF.setEditable (false); DateTF.addActionListener(this); nameL = new JLabel(" NAME : ",SwingConstants.RIGHT); icL = new JLabel(" IC : ",SwingConstants.RIGHT); DateL = new JLabel(" DATE :",SwingConstants.RIGHT); pInfo.setLayout(new GridLayout(10,2,5,5)); pInfo.setBorder(BorderFactory.createTitledBorder (BorderFactory.createEtchedBorder(),"ORDER")); pN.add(nameL); pN.add(nameTF); pIC.add(icL); pIC.add(icTF); pDate.add(DateL); pDate.add(DateTF); pInfo.add(pN); pInfo.add(pIC); pInfo.add(pDate); pInfo.setBackground(Color.GRAY); pN.setBackground(Color.gray); pIC.setBackground(Color.gray); pDate.setBackground(Color.gray); nameL.setForeground(Color.black); icL.setForeground(Color.black); DateL.setForeground(Color.black); nameTF.setBackground(Color.pink); icTF.setBackground(Color.pink); DateTF.setBackground(Color.pink); contentPane.add(pInfo,BorderLayout.CENTER); Blank = new JPanel(); pBlank = new JPanel(); button = new JPanel(); calB = new JButton("CALCULATE"); calB.setToolTipText("Click to calculate"); clearB = new JButton("RESET"); clearB.setToolTipText("Click to clear"); reportB = new JButton ("REPORT"); reportB.setToolTipText ("Click to print"); exitB = new JButton("EXIT"); exitB.setToolTipText("Click to exit"); Blank.setLayout(new GridLayout(2,2)); Blank.setBorder(BorderFactory.createTitledBorder (BorderFactory.createEtchedBorder(),"")); button.setLayout(new GridLayout(1,4)); button.add(calB,BorderLayout.WEST); button.add(clearB,BorderLayout.CENTER); button.add(reportB,BorderLayout.CENTER); button.add(exitB,BorderLayout.EAST); Blank.add(pBlank); Blank.add(button); contentPane.add(Blank,BorderLayout.SOUTH); Blank.setBackground(Color.gray); pBlank.setBackground(Color.gray); calB.setForeground(Color.black); clearB.setForeground(Color.black); reportB.setForeground(Color.black); exitB.setForeground(Color.black); calB.setBackground(Color.pink); clearB.setBackground(Color.pink); reportB.setBackground(Color.pink); exitB.setBackground(Color.pink); calB.addActionListener(this); clearB.addActionListener(this); reportB.addActionListener(this); exitB.addActionListener(this); } public void actionPerformed(ActionEvent p) { if (p.getSource() == calB) { } else if (p.getSource() == clearB) { } else if (p.getSource () == reportB) { } else if (p.getSource() == exitB) { } } public static void main (String [] args) { Order frame = new Order(); frame.setTitle("Order"); frame.setSize(500,500); frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); frame.setResizable(false); frame.setVisible(true); frame.setLocationRelativeTo(null);//center the frame } }

    Read the article

  • Fetch a specific tag from Rally in order to compute a value in another field

    - by 4jas
    I'm extremely new to Rally development so my question may sound dumb (but couldn't find how to do it from rally's help or from previous posts here) :) I've started from the rally freeform grid example - my purpose is to implement a Business Value calculator: I fill the score field with a 5-digit figure where each number is a score in the 1-5 range. Then I compute a business value as the result of a calculation, where each number is weighted by a preset weight. I can sort my stories by Business Value to help me prioritize my backlog: that's the first step, and it works. Now what I want to do is to make my freeform grid editable: I am extracting each of my digits as a separate column, but those columns are display-only. How can I turn them into something editable? What I want to do of course is update back the score field based on the values input in each custom column. Here's an example: I have a record with score "15254", which means Business Value criteria 1 scores 1 out of 5, Business Value criteria 2 scores 5 out of 5, and so on... In the end my Business Value is computed as "1*1 + 5*2 + 2*3 + 5*4 + 4*5 = 57". So far this is the part that works. Now let's say I found that the third criteria should not score 2 but 3, I want to be able to edit the value in the corresponding column and have my score field updated to "15354", and my Business Value to display 60 instead of 57. Here is my current code, I'll be really grateful if you can help me with turning that grid into something editable :) <!--Include SDK--> <script type="text/javascript" src="https://rally1.rallydev.com/apps/2.0p2/sdk-debug.js"></script> <!--App code--> <script type="text/javascript"> Rally.onReady(function() { Ext.define('BVApp', { extend: 'Rally.app.App', componentCls: 'app', launch: function() { Ext.create('Rally.data.WsapiDataStore', { model: 'UserStory', autoLoad: true, listeners: { load: this._onDataLoaded, scope: this } }); }, _onDataLoaded: function(store, data) { var records = []; var li_score; var li_bv1, li_bv2, li_bv3, li_bv4, li_bv5, li_bvtotal; var weights = new Array(1, 2, 3, 4, 5); Ext.Array.each(data, function(record) { //Let's fetch score and compute the business values... li_score = record.get('Score'); if (li_score) { li_bv1 = li_score.toString().substring(0,1); li_bv2 = li_score.toString().substring(1,2); li_bv3 = li_score.toString().substring(2,3); li_bv4 = li_score.toString().substring(3,4); li_bv5 = li_score.toString().substring(4,5); li_bvtotal = li_bv1*weights[0] + li_bv2*weights[1] + li_bv3*weights[2] + li_bv4*weights[3] + li_bv5*weights[4]; } records.push({ FormattedID: record.get('FormattedID'), ref: record.get('_ref'), Name: record.get('Name'), Score: record.get('Score'), Bv1: li_bv1, Bv2: li_bv2, Bv3: li_bv3, Bv4: li_bv4, Bv5: li_bv5, BvTotal: li_bvtotal }); }); this.add({ xtype: 'rallygrid', store: Ext.create('Rally.data.custom.Store', { data: records, pageSize: 5 }), columnCfgs: [ { text: 'FormattedID', dataIndex: 'FormattedID' }, { text: 'ref', dataIndex: 'ref' }, { text: 'Name', dataIndex: 'Name', flex: 1 }, { text: 'Score', dataIndex: 'Score' }, { text: 'BusVal 1', dataIndex: 'Bv1' }, { text: 'BusVal 2', dataIndex: 'Bv2' }, { text: 'BusVal 3', dataIndex: 'Bv3' }, { text: 'BusVal 4', dataIndex: 'Bv4' }, { text: 'BusVal 5', dataIndex: 'Bv5' }, { text: 'BusVal Total', dataIndex: 'BvTotal' } ] }); } }); Rally.launchApp('BVApp', { name: 'Business Values App' }); var exampleHtml = '<div id="example-intro"><h1>Business Values App</h1>' + '<div>Own sample app for Business Values</div>' + '</div>'; // Default app viewport uses layout: 'fit', // so we need to insert a container into the viewport var viewport = Ext.ComponentQuery.query('viewport')[0]; var appComponent = viewport.items.getAt(0); var viewportContainerItems = [{ html: exampleHtml, border: 0 }]; //hide advanced cardboard live previews in examples for now viewportContainerItems.push({ xtype: 'container', items: [appComponent] }); viewport.remove(appComponent, false); viewport.add({ xtype: 'container', layout: 'vbox', items: viewportContainerItems }); }); </script> <!--App styles--> <style type="text/css"> .app { /* Add app styles here */ } </style>

    Read the article

< Previous Page | 782 783 784 785 786 787 788 789 790 791 792 793  | Next Page >