Search Results

Search found 1994 results on 80 pages for 'compiling'.

Page 79/80 | < Previous Page | 75 76 77 78 79 80  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • C++: Declaration of template class member specialization (+ Doxygen bonus question!)

    - by Ziv
    When I specialize a (static) member function/constant in a template class, I'm confused as to where the declaration is meant to go. Here's an example of what I what to do - yoinked directly from IBM's reference on template specialization: template<class T> class X { public: static T v; static void f(T); }; template<class T> T X<T>::v = 0; template<class T> void X<T>::f(T arg) { v = arg; } template<> char* X<char*>::v = "Hello"; template<> void X<float>::f(float arg) { v = arg * 2; } int main() { X<char*> a, b; X<float> c; c.f(10); // X<float>::v now set to 20 } The question is, how do I divide this into header/cpp files? The generic implementation is obviously in the header, but what about the specialization? It can't go in the header file, because it's concrete, leading to multiple definition. But if it goes into the .cpp file, is code which calls X::f() aware of the specialization, or might it rely on the generic X::f()? So far I've got the specialization in the .cpp only, with no declaration in the header. I'm not having trouble compiling or even running my code (on gcc, don't remember the version at the moment), and it behaves as expected - recognizing the specialization. But A) I'm not sure this is correct, and I'd like to know what is, and B) my Doxygen documentation comes out wonky and very misleading (more on that in a moment). What seems most natural to me would be something like this, declaring the specialization in the header and defining it in the .cpp: ===XClass.hpp=== #ifndef XCLASS_HPP #define XCLASS_HPP template<class T> class X { public: static T v; static void f(T); }; template<class T> T X<T>::v = 0; template<class T> void X<T>::f(T arg) { v = arg; } /* declaration of specialized functions */ template<> char* X<char*>::v; template<> void X<float>::f(float arg); #endif ===XClass.cpp=== #include <XClass.hpp> /* concrete implementation of specialized functions */ template<> char* X<char*>::v = "Hello"; template<> void X<float>::f(float arg) { v = arg * 2; } ...but I have no idea if this is correct. The most immediate consequence of this issue, as I mentioned, is my Doxygen documentation, which doesn't seem to warm to the idea of member specialization, at least the way I'm defining it at the moment. It will always present only the first definition it finds of a function/constant, and I really need to be able to present the specializations as well. If I go so far as to re-declare the entire class, i.e. in the header: /* template declaration */ template<class T> class X { public: static T v; static void f(T); }; /* template member definition */ template<class T> T X<T>::v = 0; template<class T> void X<T>::f(T arg) { v = arg; } /* declaration of specialized CLASS (with definitions in .cpp) */ template<> class X<float> { public: static float v; static void f(float); }; then it will display the different variations of X as different classes (which is fine by me), but I don't know how to get the same effect when specializing only a few select members of the class. I don't know if this is a mistake of mine, or a limitation of Doxygen - any ideas? Thanks much, Ziv

    Read the article

  • Embedding mercurial revision information in Visual Studio c# projects automatically

    - by Mark Booth
    Original Problem In building our projects, I want the mercurial id of each repository to be embedded within the product(s) of that repository (the library, application or test application). I find it makes it so much easier to debug an application ebing run by custiomers 8 timezones away if you know precisely what went into building the particular version of the application they are using. As such, every project (application or library) in our systems implement a way of getting at the associated revision information. I also find it very useful to be able to see if an application has been compiled with clean (un-modified) changesets from the repository. 'Hg id' usefully appends a + to the changeset id when there are uncommitted changes in a repository, so this allows is to easily see if people are running a clean or a modified version of the code. My current solution is detailed below, and fulfills the basic requirements, but there are a number of problems with it. Current Solution At the moment, to each and every Visual Studio solution, I add the following "Pre-build event command line" commands: cd $(ProjectDir) HgID I also add an HgID.bat file to the Project directory: @echo off type HgId.pre > HgId.cs For /F "delims=" %%a in ('hg id') Do <nul >>HgID.cs set /p = @"%%a" echo ; >> HgId.cs echo } >> HgId.cs echo } >> HgId.cs along with an HgId.pre file, which is defined as: namespace My.Namespace { /// <summary> Auto generated Mercurial ID class. </summary> internal class HgID { /// <summary> Mercurial version ID [+ is modified] [Named branch]</summary> public const string Version = When I build my application, the pre-build event is triggered on all libraries, creating a new HgId.cs file (which is not kept under revision control) and causing the library to be re-compiled with with the new 'hg id' string in 'Version'. Problems with the current solution The main problem is that since the HgId.cs is re-created at each pre-build, every time we need to compile anything, all projects in the current solution are re-compiled. Since we want to be able to easily debug into our libraries, we usually keep many libraries referenced in our main application solution. This can result in build times which are significantly longer than I would like. Ideally I would like the libraries to compile only if the contents of the HgId.cs file has actually changed, as opposed to having been re-created with exactly the same contents. The second problem with this method is it's dependence on specific behaviour of the windows shell. I've already had to modify the batch file several times, since the original worked under XP but not Vista, the next version worked under Vista but not XP and finally I managed to make it work with both. Whether it will work with Windows 7 however is anyones guess and as time goes on, I see it more likely that contractors will expect to be able to build our apps on their Windows 7 boxen. Finally, I have an aesthetic problem with this solution, batch files and bodged together template files feel like the wrong way to do this. My actual questions How would you solve/how are you solving the problem I'm trying to solve? What better options are out there than what I'm currently doing? Rejected Solutions to these problems Before I implemented the current solution, I looked at Mercurials Keyword extension, since it seemed like the obvious solution. However the more I looked at it and read peoples opinions, the more that I came to the conclusion that it wasn't the right thing to do. I also remember the problems that keyword substitution has caused me in projects at previous companies (just the thought of ever having to use Source Safe again fills me with a feeling of dread *8'). Also, I don't particularly want to have to enable Mercurial extensions to get the build to complete. I want the solution to be self contained, so that it isn't easy for the application to be accidentally compiled without the embedded version information just because an extension isn't enabled or the right helper software hasn't been installed. I also thought of writing this in a better scripting language, one where I would only write HgId.cs file if the content had actually changed, but all of the options I could think of would require my co-workers, contractors and possibly customers to have to install software they might not otherwise want (for example cygwin). Any other options people can think of would be appreciated. Update Partial solution Having played around with it for a while, I've managed to get the HgId.bat file to only overwrite the HgId.cs file if it changes: @echo off type HgId.pre > HgId.cst For /F "delims=" %%a in ('hg id') Do <nul >>HgId.cst set /p = @"%%a" echo ; >> HgId.cst echo } >> HgId.cst echo } >> HgId.cst fc HgId.cs HgId.cst >NUL if %errorlevel%==0 goto :ok copy HgId.cst HgId.cs :ok del HgId.cst Problems with this solution Even though HgId.cs is no longer being re-created every time, Visual Studio still insists on compiling everything every time. I've tried looking for solutions and tried checking "Only build startup projects and dependencies on Run" in Tools|Options|Projects and Solutions|Build and Run but it makes no difference. The second problem also remains, and now I have no way to test if it will work with Vista, since that contractor is no longer with us. If anyone can test this batch file on a Windows 7 and/or Vista box, I would appreciate hearing how it went. Finally, my aesthetic problem with this solution, is even strnger than it was before, since the batch file is more complex and this there is now more to go wrong. If you can think of any better solution, I would love to hear about them.

    Read the article

  • Ado.Net Entity produces "namespace cannot be found"

    - by Dave
    I've seen several possible solutions to this, but none have worked for me. After adding a ADO.NET Entity Data Model to my .Net Forms C# web project, I am unable to use it. Perhaps I made a mistake adding it? The name of the file added is QcFormData.edmx. In my code, perhaps I'm instantiating it incorrectly? I tried adding the line: QcFormDataContainer db = new QcFormDataContainer(); It appears in Intellisense, but when compiling I get the error : Error 13 The type or namespace name 'QcFormDataContainer' could not be found (are you missing a using directive or an assembly reference?) I've followed the suggestions that I found online that did not help: 1) made sure there is "using System.Data.Entity" 2) made sure the dll exists. 3) made sure the reference exists. 4) one post said use using System.Web.Data.Entity; but I do not see that available. What am I missing? QcFormData.edmx <?xml version="1.0" encoding="utf-8"?> <edmx:Edmx Version="3.0" xmlns:edmx="http://schemas.microsoft.com/ado/2009/11/edmx"> <!-- EF Runtime content --> <edmx:Runtime> <!-- SSDL content --> <edmx:StorageModels> <Schema Namespace="MyCocoModel.Store" Alias="Self" Provider="System.Data.SqlClient" ProviderManifestToken="2008" xmlns:store="http://schemas.microsoft.com/ado/2007/12/edm/EntityStoreSchemaGenerator" xmlns="http://schemas.microsoft.com/ado/2009/11/edm/ssdl"> <EntityContainer Name="MyCocoModelStoreContainer"> <EntitySet Name="QcFieldValues" EntityType="MyCocoModel.Store.QcFieldValues" store:Type="Tables" Schema="dbo" /> </EntityContainer> <EntityType Name="QcFieldValues"> <Key> <PropertyRef Name="ID" /> </Key> <Property Name="ID" Type="int" Nullable="false" StoreGeneratedPattern="Identity" /> <Property Name="FieldID" Type="nvarchar" MaxLength="100" /> <Property Name="FieldValue" Type="nvarchar" MaxLength="100" /> <Property Name="DateTimeAdded" Type="datetime" /> <Property Name="OrderReserveNumber" Type="nvarchar" MaxLength="50" /> </EntityType> </Schema> </edmx:StorageModels> <!-- CSDL content --> <edmx:ConceptualModels> <Schema Namespace="MyCocoModel" Alias="Self" p1:UseStrongSpatialTypes="false" xmlns:annotation="http://schemas.microsoft.com/ado/2009/02/edm/annotation" xmlns:p1="http://schemas.microsoft.com/ado/2009/02/edm/annotation" xmlns="http://schemas.microsoft.com/ado/2009/11/edm"> <EntityContainer Name="MyCocoEntities" p1:LazyLoadingEnabled="true"> <EntitySet Name="QcFieldValues" EntityType="MyCocoModel.QcFieldValue" /> </EntityContainer> <EntityType Name="QcFieldValue"> <Key> <PropertyRef Name="ID" /> </Key> <Property Name="ID" Type="Int32" Nullable="false" p1:StoreGeneratedPattern="Identity" /> <Property Name="FieldID" Type="String" MaxLength="100" Unicode="true" FixedLength="false" /> <Property Name="FieldValue" Type="String" MaxLength="100" Unicode="true" FixedLength="false" /> <Property Name="DateTimeAdded" Type="DateTime" Precision="3" /> <Property Name="OrderReserveNumber" Type="String" MaxLength="50" Unicode="true" FixedLength="false" /> </EntityType> </Schema> </edmx:ConceptualModels> <!-- C-S mapping content --> <edmx:Mappings> <Mapping Space="C-S" xmlns="http://schemas.microsoft.com/ado/2009/11/mapping/cs"> <EntityContainerMapping StorageEntityContainer="MyCocoModelStoreContainer" CdmEntityContainer="MyCocoEntities"> <EntitySetMapping Name="QcFieldValues"> <EntityTypeMapping TypeName="MyCocoModel.QcFieldValue"> <MappingFragment StoreEntitySet="QcFieldValues"> <ScalarProperty Name="ID" ColumnName="ID" /> <ScalarProperty Name="FieldID" ColumnName="FieldID" /> <ScalarProperty Name="FieldValue" ColumnName="FieldValue" /> <ScalarProperty Name="DateTimeAdded" ColumnName="DateTimeAdded" /> <ScalarProperty Name="OrderReserveNumber" ColumnName="OrderReserveNumber" /> </MappingFragment> </EntityTypeMapping> </EntitySetMapping> </EntityContainerMapping> </Mapping> </edmx:Mappings> </edmx:Runtime> <!-- EF Designer content (DO NOT EDIT MANUALLY BELOW HERE) --> <Designer xmlns="http://schemas.microsoft.com/ado/2009/11/edmx"> <Connection> <DesignerInfoPropertySet> <DesignerProperty Name="MetadataArtifactProcessing" Value="EmbedInOutputAssembly" /> </DesignerInfoPropertySet> </Connection> <Options> <DesignerInfoPropertySet> <DesignerProperty Name="ValidateOnBuild" Value="true" /> <DesignerProperty Name="EnablePluralization" Value="True" /> <DesignerProperty Name="IncludeForeignKeysInModel" Value="True" /> <DesignerProperty Name="CodeGenerationStrategy" Value="None" /> </DesignerInfoPropertySet> </Options> <!-- Diagram content (shape and connector positions) --> <Diagrams></Diagrams> </Designer> </edmx:Edmx>

    Read the article

  • Database file is inexplicably locked during SQLite commit

    - by sweeney
    Hello, I'm performing a large number of INSERTS to a SQLite database. I'm using just one thread. I batch the writes to improve performance and have a bit of security in case of a crash. Basically I cache up a bunch of data in memory and then when I deem appropriate, I loop over all of that data and perform the INSERTS. The code for this is shown below: public void Commit() { using (SQLiteConnection conn = new SQLiteConnection(this.connString)) { conn.Open(); using (SQLiteTransaction trans = conn.BeginTransaction()) { using (SQLiteCommand command = conn.CreateCommand()) { command.CommandText = "INSERT OR IGNORE INTO [MY_TABLE] (col1, col2) VALUES (?,?)"; command.Parameters.Add(this.col1Param); command.Parameters.Add(this.col2Param); foreach (Data o in this.dataTemp) { this.col1Param.Value = o.Col1Prop; this. col2Param.Value = o.Col2Prop; command.ExecuteNonQuery(); } } this.TryHandleCommit(trans); } conn.Close(); } } I now employ the following gimmick to get the thing to eventually work: private void TryHandleCommit(SQLiteTransaction trans) { try { trans.Commit(); } catch (Exception e) { Console.WriteLine("Trying again..."); this.TryHandleCommit(trans); } } I create my DB like so: public DataBase(String path) { //build connection string SQLiteConnectionStringBuilder connString = new SQLiteConnectionStringBuilder(); connString.DataSource = path; connString.Version = 3; connString.DefaultTimeout = 5; connString.JournalMode = SQLiteJournalModeEnum.Persist; connString.UseUTF16Encoding = true; using (connection = new SQLiteConnection(connString.ToString())) { //check for existence of db FileInfo f = new FileInfo(path); if (!f.Exists) //build new blank db { SQLiteConnection.CreateFile(path); connection.Open(); using (SQLiteTransaction trans = connection.BeginTransaction()) { using (SQLiteCommand command = connection.CreateCommand()) { command.CommandText = DataBase.CREATE_MATCHES; command.ExecuteNonQuery(); command.CommandText = DataBase.CREATE_STRING_DATA; command.ExecuteNonQuery(); //TODO add logging } trans.Commit(); } connection.Close(); } } } I then export the connection string and use it to obtain new connections in different parts of the program. At seemingly random intervals, though at far too great a rate to ignore or otherwise workaround this problem, I get unhandled SQLiteException: Database file is locked. This occurs when I attempt to commit the transaction. No errors seem to occur prior to then. This does not always happen. Sometimes the whole thing runs without a hitch. No reads are being performed on these files before the commits finish. I have the very latest SQLite binary. I'm compiling for .NET 2.0. I'm using VS 2008. The db is a local file. All of this activity is encapsulated within one thread / process. Virus protection is off (though I think that was only relevant if you were connecting over a network?). As per Scotsman's post I have implemented the following changes: Journal Mode set to Persist DB files stored in C:\Docs + Settings\ApplicationData via System.Windows.Forms.Application.AppData windows call No inner exception Witnessed on two distinct machines (albeit very similar hardware and software) Have been running Process Monitor - no extraneous processes are attaching themselves to the DB files - the problem is definitely in my code... Does anyone have any idea whats going on here? I know I just dropped a whole mess of code, but I've been trying to figure this out for way too long. My thanks to anyone who makes it to the end of this question! brian UPDATES: Thanks for the suggestions so far! I've implemented many of the suggested changes. I feel that we are getting closer to the answer...however... The code above technically works however it is non-deterministic! It is not guaranteed to do anything aside from spin in neutral forever. In practice it seems to work somewhere between the 1st and 10th iteration. If i batch my commits at a reasonable interval damage will be mitigated but I really do not want to leave things in this state... More suggestions welcome!

    Read the article

  • Java Box Class: Unsolvable: aligning components to the left or right

    - by user323186
    I have been trying to left align buttons contained in a Box to the left, with no success. They align left alright, but for some reason dont shift all the way left as one would imagine. I attach the code below. Please try compiling it and see for yourself. Seems bizarre to me. Thanks, Eric import java.awt.Dimension; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.io.BufferedReader; import java.io.File; import java.io.FileNotFoundException; import java.io.FileReader; import java.io.IOException; import javax.swing.Box; import javax.swing.BoxLayout; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.JMenu; import javax.swing.JMenuBar; import javax.swing.JMenuItem; import javax.swing.JScrollPane; import javax.swing.JTextArea; public class MainGUI extends Box implements ActionListener{ //Create GUI Components Box centerGUI=new Box(BoxLayout.X_AXIS); Box bottomGUI=new Box(BoxLayout.X_AXIS); //centerGUI subcomponents JTextArea left=new JTextArea(), right=new JTextArea(); JScrollPane leftScrollPane = new JScrollPane(left), rightScrollPane = new JScrollPane(right); //bottomGUI subcomponents JButton encrypt=new JButton("Encrypt"), decrypt=new JButton("Decrypt"), close=new JButton("Close"), info=new JButton("Info"); //Create Menubar components JMenuBar menubar=new JMenuBar(); JMenu fileMenu=new JMenu("File"); JMenuItem open=new JMenuItem("Open"), save=new JMenuItem("Save"), exit=new JMenuItem("Exit"); int returnVal =0; public MainGUI(){ super(BoxLayout.Y_AXIS); initCenterGUI(); initBottomGUI(); initFileMenu(); add(centerGUI); add(bottomGUI); addActionListeners(); } private void addActionListeners() { open.addActionListener(this); save.addActionListener(this); exit.addActionListener(this); encrypt.addActionListener(this); decrypt.addActionListener(this); close.addActionListener(this); info.addActionListener(this); } private void initFileMenu() { fileMenu.add(open); fileMenu.add(save); fileMenu.add(exit); menubar.add(fileMenu); } public void initCenterGUI(){ centerGUI.add(leftScrollPane); centerGUI.add(rightScrollPane); } public void initBottomGUI(){ bottomGUI.setAlignmentX(LEFT_ALIGNMENT); //setBorder(BorderFactory.createLineBorder(Color.BLACK)); bottomGUI.add(encrypt); bottomGUI.add(decrypt); bottomGUI.add(close); bottomGUI.add(info); } @Override public void actionPerformed(ActionEvent arg0) { // find source of the action Object source=arg0.getSource(); //if action is of such a type do the corresponding action if(source==close){ kill(); } else if(source==open){ //CHOOSE FILE File file1 =chooseFile(); String input1=readToString(file1); System.out.println(input1); left.setText(input1); } else if(source==decrypt){ //decrypt everything in Right Panel and output in left panel decrypt(); } else if(source==encrypt){ //encrypt everything in left panel and output in right panel encrypt(); } else if(source==info){ //show contents of info file in right panel doInfo(); } else { System.out.println("Error"); //throw new UnimplementedActionException(); } } private void doInfo() { // TODO Auto-generated method stub } private void encrypt() { // TODO Auto-generated method stub } private void decrypt() { // TODO Auto-generated method stub } private String readToString(File file) { FileReader fr = null; try { fr = new FileReader(file); } catch (FileNotFoundException e1) { e1.printStackTrace(); } BufferedReader br=new BufferedReader(fr); String line = null; try { line = br.readLine(); } catch (IOException e) { e.printStackTrace(); } String input=""; while(line!=null){ input=input+"\n"+line; try { line=br.readLine(); } catch (IOException e) { e.printStackTrace(); } } return input; } private File chooseFile() { //Create a file chooser final JFileChooser fc = new JFileChooser(); returnVal = fc.showOpenDialog(fc); return fc.getSelectedFile(); } private void kill() { System.exit(0); } public static void main(String[] args) { // TODO Auto-generated method stub MainGUI test=new MainGUI(); JFrame f=new JFrame("Tester"); f.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); f.setJMenuBar(test.menubar); f.setPreferredSize(new Dimension(600,400)); //f.setUndecorated(true); f.add(test); f.pack(); f.setVisible(true); } }

    Read the article

  • Java programming accessing object variables

    - by Haxed
    Helo, there are 3 files, CustomerClient.java, CustomerServer.java and Customer.java PROBLEM: In the CustomerServer.java file, i get an error when I compile the CustomerServer.java at line : System.out.println(a[k].getName()); ERROR: init: deps-jar: Compiling 1 source file to C:\Documents and Settings\TLNA\My Documents\NetBeansProjects\Server\build\classes C:\Documents and Settings\TLNA\My Documents\NetBeansProjects\Server\src\CustomerServer.java:44: cannot find symbol symbol : method getName() location: class Customer System.out.println(a[k].getName()); 1 error BUILD FAILED (total time: 0 seconds) CustomerClient.java import java.io.*; import java.net.*; import java.awt.*; import java.awt.event.*; import javax.swing.*; import javax.swing.border.*; public class CustomerClient extends JApplet { private JTextField jtfName = new JTextField(32); private JTextField jtfSeatNo = new JTextField(32); // Button for sending a student to the server private JButton jbtRegister = new JButton("Register to the Server"); // Indicate if it runs as application private boolean isStandAlone = false; // Host name or ip String host = "localhost"; public void init() { JPanel p1 = new JPanel(); p1.setLayout(new GridLayout(2, 1)); p1.add(new JLabel("Name")); p1.add(jtfName); p1.add(new JLabel("Seat No.")); p1.add(jtfSeatNo); add(p1, BorderLayout.CENTER); add(jbtRegister, BorderLayout.SOUTH); // Register listener jbtRegister.addActionListener(new ButtonListener()); // Find the IP address of the Web server if (!isStandAlone) { host = getCodeBase().getHost(); } } /** Handle button action */ private class ButtonListener implements ActionListener { public void actionPerformed(ActionEvent e) { try { // Establish connection with the server Socket socket = new Socket(host, 8000); // Create an output stream to the server ObjectOutputStream toServer = new ObjectOutputStream(socket.getOutputStream()); // Get text field String name = jtfName.getText().trim(); String seatNo = jtfSeatNo.getText().trim(); // Create a Student object and send to the server Customer s = new Customer(name, seatNo); toServer.writeObject(s); } catch (IOException ex) { System.err.println(ex); } } } /** Run the applet as an application */ public static void main(String[] args) { // Create a frame JFrame frame = new JFrame("Register Student Client"); // Create an instance of the applet CustomerClient applet = new CustomerClient(); applet.isStandAlone = true; // Get host if (args.length == 1) { applet.host = args[0]; // Add the applet instance to the frame } frame.add(applet, BorderLayout.CENTER); // Invoke init() and start() applet.init(); applet.start(); // Display the frame frame.pack(); frame.setVisible(true); } } CustomerServer.java import java.io.*; import java.net.*; public class CustomerServer { private String name; private int i; private ObjectOutputStream outputToFile; private ObjectInputStream inputFromClient; public static void main(String[] args) { new CustomerServer(); } public CustomerServer() { Customer[] a = new Customer[30]; try { // Create a server socket ServerSocket serverSocket = new ServerSocket(8000); System.out.println("Server started "); // Create an object ouput stream outputToFile = new ObjectOutputStream( new FileOutputStream("student.dat", true)); while (true) { // Listen for a new connection request Socket socket = serverSocket.accept(); // Create an input stream from the socket inputFromClient = new ObjectInputStream(socket.getInputStream()); // Read from input //Object object = inputFromClient.readObject(); for (int k = 0; k <= 2; k++) { if (a[k] == null) { a[k] = (Customer) inputFromClient.readObject(); // Write to the file outputToFile.writeObject(a[k]); //System.out.println("A new student object is stored"); System.out.println(a[k].getName()); break; } if (k == 2) { //fully booked outputToFile.writeObject("All seats are booked"); break; } } } } catch (ClassNotFoundException ex) { ex.printStackTrace(); } catch (IOException ex) { ex.printStackTrace(); } finally { try { inputFromClient.close(); outputToFile.close(); } catch (Exception ex) { ex.printStackTrace(); } } } } Customer.java public class Customer implements java.io.Serializable { private String name; private String seatno; public Customer(String name, String seatno) { this.name = name; this.seatno = seatno; } public String getName() { return name; } public String getSeatNo() { return seatno; } }

    Read the article

  • Maven : Is it possible to override the configuration of a plugin already defined for a profile in a parent POM

    - by Guillaume Cernier
    In a POM parent file of my project, I have such a profile defining some configurations useful for this project (so that I can't get rid of this parent POM) : <profile> <id>wls7</id> ... <build> <plugins> <!-- use java 1.4 --> <plugin> <groupId>org.apache.maven.plugins</groupId> <artifactId>maven-compiler-plugin</artifactId> <configuration> <fork>true</fork> <source>1.4</source> <target>1.4</target> <meminitial>128m</meminitial> <maxmem>1024m</maxmem> <executable>%${jdk14.executable}</executable> </configuration> </plugin> </plugins> </build> ... </profile> But in my project I just would like to override the configuration of the maven-compiler-plugin in order to use jdk5 instead of jdk4 for compiling test-classes. That's why I did this section in the POM of my project : <profiles> <profile> <id>wls7</id> <activation> <property> <name>jdk</name> <value>4</value> </property> </activation> <build> <directory>target-1.4</directory> <plugins> <plugin> <groupId>org.apache.maven.plugins</groupId> <artifactId>maven-compiler-plugin</artifactId> <executions> <execution> <id>my-testCompile</id> <phase>test-compile</phase> <goals> <goal>testCompile</goal> </goals> <configuration> <fork>true</fork> <executable>${jdk15.executable}</executable> <compilerVersion>1.5</compilerVersion> <source>1.5</source> <target>1.5</target> <verbose>true</verbose> </configuration> </execution> </executions> </plugin> </plugins> </build> </profile> ... </profiles> and it's not working ... I even tried to override the configuration in regular plugin sections of my POM (I mean, not for a specific profile but for my whole POM). What could be the problem ? To clarify some of my requirements : I don't want to get rid of the parent POM and the profile (wls7) defined inside it (since I need many and many properties, configurations, ...) and that is not the process in my company. A solution based on duplicating the parent POM and/or the profile defined inside it is not a good one. Since if the responsible of the parent POM change something, I would have to report it in mine. It's just an inheritance matter (extend or override a profile, a configuration from an upper-level POM) so I think it should be possible with maven2.

    Read the article

  • Loop crashing program having to do with 2D arrays

    - by user450062
    I am creating an encoding program and when I instruct the program to create a 5X5 grid based on the alphabet while skipping over letters that match up to certain pre-defined variables(which are given values by user input during runtime). I have a loop that instructs the loop to keep running until the values that access the array are out of bounds, the loop seems to cause the problem. This code is standardized so there shouldn't be much trouble compiling it in another compiler. Also would it be better to seperate my program into functions? here is the code: #include<iostream> #include<fstream> #include<cstdlib> #include<string> #include<limits> using namespace std; int main(){ while (!cin.fail()) { char type[81]; char filename[20]; char key [5]; char f[2] = "q"; char g[2] = "q"; char h[2] = "q"; char i[2] = "q"; char j[2] = "q"; char k[2] = "q"; char l[2] = "q"; int a = 1; int b = 1; int c = 1; int d = 1; int e = 1; string cipherarraytemplate[5][5]= { {"a","b","c","d","e"}, {"f","g","h","i","j"}, {"k","l","m","n","o"}, {"p","r","s","t","u"}, {"v","w","x","y","z"} }; string cipherarray[5][5]= { {"a","b","c","d","e"}, {"f","g","h","i","j"}, {"k","l","m","n","o"}, {"p","r","s","t","u"}, {"v","w","x","y","z"} }; cout<<"Enter the name of a file you want to create.\n"; cin>>filename; ofstream outFile; outFile.open(filename); outFile<<fixed; outFile.precision(2); outFile.setf(ios_base::showpoint); cin.ignore(std::numeric_limits<int>::max(),'\n'); cout<<"enter your codeword(codeword can have no repeating letters)\n"; cin>>key; while (key[a] != '\0' ){ while(b < 6){ cipherarray[b][c] = key[a]; if ( f == "q" ) { cipherarray[b][c] = f; } if ( f != "q" && g == "q" ) { cipherarray[b][c] = g; } if ( g != "q" && h == "q" ) { cipherarray[b][c] = h; } if ( h != "q" && i == "q" ) { cipherarray[b][c] = i; } if ( i != "q" && j == "q" ) { cipherarray[b][c] = j; } if ( j != "q" && k == "q" ) { cipherarray[b][c] = k; } if ( k != "q" && l == "q" ) { cipherarray[b][c] = l; } a++; b++; } c++; b = 1; } while (c < 6 || b < 6){ if (cipherarraytemplate[d][e] == f || cipherarraytemplate[d][e] == g || cipherarraytemplate[d][e] == h || cipherarraytemplate[d][e] == i || cipherarraytemplate[d][e] == j || cipherarraytemplate[d][e] == k || cipherarraytemplate[d][e] == l){ d++; } else { cipherarray[b][c] = cipherarraytemplate[d][e]; d++; b++; } if (d == 6){ d = 1; e++; } if (b == 6){ c++; b = 1; } } cout<<"now enter some text."<<endl<<"To end this program press Crtl-Z\n"; while(!cin.fail()){ cin.getline(type,81); outFile<<type<<endl; } outFile.close(); } } I know there is going to be some mid-forties guy out there who is going to stumble on to this post, he's have been programming for 20-some years and he's going to look at my code and say: "what is this guy doing".

    Read the article

  • Rendering ASP.NET MVC Views to String

    - by Rick Strahl
    It's not uncommon in my applications that I require longish text output that does not have to be rendered into the HTTP output stream. The most common scenario I have for 'template driven' non-Web text is for emails of all sorts. Logon confirmations and verifications, email confirmations for things like orders, status updates or scheduler notifications - all of which require merged text output both within and sometimes outside of Web applications. On other occasions I also need to capture the output from certain views for logging purposes. Rather than creating text output in code, it's much nicer to use the rendering mechanism that ASP.NET MVC already provides by way of it's ViewEngines - using Razor or WebForms views - to render output to a string. This is nice because it uses the same familiar rendering mechanism that I already use for my HTTP output and it also solves the problem of where to store the templates for rendering this content in nothing more than perhaps a separate view folder. The good news is that ASP.NET MVC's rendering engine is much more modular than the full ASP.NET runtime engine which was a real pain in the butt to coerce into rendering output to string. With MVC the rendering engine has been separated out from core ASP.NET runtime, so it's actually a lot easier to get View output into a string. Getting View Output from within an MVC Application If you need to generate string output from an MVC and pass some model data to it, the process to capture this output is fairly straight forward and involves only a handful of lines of code. The catch is that this particular approach requires that you have an active ControllerContext that can be passed to the view. This means that the following approach is limited to access from within Controller methods. Here's a class that wraps the process and provides both instance and static methods to handle the rendering:/// <summary> /// Class that renders MVC views to a string using the /// standard MVC View Engine to render the view. /// /// Note: This class can only be used within MVC /// applications that have an active ControllerContext. /// </summary> public class ViewRenderer { /// <summary> /// Required Controller Context /// </summary> protected ControllerContext Context { get; set; } public ViewRenderer(ControllerContext controllerContext) { Context = controllerContext; } /// <summary> /// Renders a full MVC view to a string. Will render with the full MVC /// View engine including running _ViewStart and merging into _Layout /// </summary> /// <param name="viewPath"> /// The path to the view to render. Either in same controller, shared by /// name or as fully qualified ~/ path including extension /// </param> /// <param name="model">The model to render the view with</param> /// <returns>String of the rendered view or null on error</returns> public string RenderView(string viewPath, object model) { return RenderViewToStringInternal(viewPath, model, false); } /// <summary> /// Renders a partial MVC view to string. Use this method to render /// a partial view that doesn't merge with _Layout and doesn't fire /// _ViewStart. /// </summary> /// <param name="viewPath"> /// The path to the view to render. Either in same controller, shared by /// name or as fully qualified ~/ path including extension /// </param> /// <param name="model">The model to pass to the viewRenderer</param> /// <returns>String of the rendered view or null on error</returns> public string RenderPartialView(string viewPath, object model) { return RenderViewToStringInternal(viewPath, model, true); } public static string RenderView(string viewPath, object model, ControllerContext controllerContext) { ViewRenderer renderer = new ViewRenderer(controllerContext); return renderer.RenderView(viewPath, model); } public static string RenderPartialView(string viewPath, object model, ControllerContext controllerContext) { ViewRenderer renderer = new ViewRenderer(controllerContext); return renderer.RenderPartialView(viewPath, model); } protected string RenderViewToStringInternal(string viewPath, object model, bool partial = false) { // first find the ViewEngine for this view ViewEngineResult viewEngineResult = null; if (partial) viewEngineResult = ViewEngines.Engines.FindPartialView(Context, viewPath); else viewEngineResult = ViewEngines.Engines.FindView(Context, viewPath, null); if (viewEngineResult == null) throw new FileNotFoundException(Properties.Resources.ViewCouldNotBeFound); // get the view and attach the model to view data var view = viewEngineResult.View; Context.Controller.ViewData.Model = model; string result = null; using (var sw = new StringWriter()) { var ctx = new ViewContext(Context, view, Context.Controller.ViewData, Context.Controller.TempData, sw); view.Render(ctx, sw); result = sw.ToString(); } return result; } } The key is the RenderViewToStringInternal method. The method first tries to find the view to render based on its path which can either be in the current controller's view path or the shared view path using its simple name (PasswordRecovery) or alternately by its full virtual path (~/Views/Templates/PasswordRecovery.cshtml). This code should work both for Razor and WebForms views although I've only tried it with Razor Views. Note that WebForms Views might actually be better for plain text as Razor adds all sorts of white space into its output when there are code blocks in the template. The Web Forms engine provides more accurate rendering for raw text scenarios. Once a view engine is found the view to render can be retrieved. Views in MVC render based on data that comes off the controller like the ViewData which contains the model along with the actual ViewData and ViewBag. From the View and some of the Context data a ViewContext is created which is then used to render the view with. The View picks up the Model and other data from the ViewContext internally and processes the View the same it would be processed if it were to send its output into the HTTP output stream. The difference is that we can override the ViewContext's output stream which we provide and capture into a StringWriter(). After rendering completes the result holds the output string. If an error occurs the error behavior is similar what you see with regular MVC errors - you get a full yellow screen of death including the view error information with the line of error highlighted. It's your responsibility to handle the error - or let it bubble up to your regular Controller Error filter if you have one. To use the simple class you only need a single line of code if you call the static methods. Here's an example of some Controller code that is used to send a user notification to a customer via email in one of my applications:[HttpPost] public ActionResult ContactSeller(ContactSellerViewModel model) { InitializeViewModel(model); var entryBus = new busEntry(); var entry = entryBus.LoadByDisplayId(model.EntryId); if ( string.IsNullOrEmpty(model.Email) ) entryBus.ValidationErrors.Add("Email address can't be empty.","Email"); if ( string.IsNullOrEmpty(model.Message)) entryBus.ValidationErrors.Add("Message can't be empty.","Message"); model.EntryId = entry.DisplayId; model.EntryTitle = entry.Title; if (entryBus.ValidationErrors.Count > 0) { ErrorDisplay.AddMessages(entryBus.ValidationErrors); ErrorDisplay.ShowError("Please correct the following:"); } else { string message = ViewRenderer.RenderView("~/views/template/ContactSellerEmail.cshtml",model, ControllerContext); string title = entry.Title + " (" + entry.DisplayId + ") - " + App.Configuration.ApplicationName; AppUtils.SendEmail(title, message, model.Email, entry.User.Email, false, false)) } return View(model); } Simple! The view in this case is just a plain MVC view and in this case it's a very simple plain text email message (edited for brevity here) that is created and sent off:@model ContactSellerViewModel @{ Layout = null; }re: @Model.EntryTitle @Model.ListingUrl @Model.Message ** SECURITY ADVISORY - AVOID SCAMS ** Avoid: wiring money, cross-border deals, work-at-home ** Beware: cashier checks, money orders, escrow, shipping ** More Info: @(App.Configuration.ApplicationBaseUrl)scams.html Obviously this is a very simple view (I edited out more from this page to keep it brief) -  but other template views are much more complex HTML documents or long messages that are occasionally updated and they are a perfect fit for Razor rendering. It even works with nested partial views and _layout pages. Partial Rendering Notice that I'm rendering a full View here. In the view I explicitly set the Layout=null to avoid pulling in _layout.cshtml for this view. This can also be controlled externally by calling the RenderPartial method instead: string message = ViewRenderer.RenderPartialView("~/views/template/ContactSellerEmail.cshtml",model, ControllerContext); with this line of code no layout page (or _viewstart) will be loaded, so the output generated is just what's in the view. I find myself using Partials most of the time when rendering templates, since the target of templates usually tend to be emails or other HTML fragment like output, so the RenderPartialView() method is definitely useful to me. Rendering without a ControllerContext The preceding class is great when you're need template rendering from within MVC controller actions or anywhere where you have access to the request Controller. But if you don't have a controller context handy - maybe inside a utility function that is static, a non-Web application, or an operation that runs asynchronously in ASP.NET - which makes using the above code impossible. I haven't found a way to manually create a Controller context to provide the ViewContext() what it needs from outside of the MVC infrastructure. However, there are ways to accomplish this,  but they are a bit more complex. It's possible to host the RazorEngine on your own, which side steps all of the MVC framework and HTTP and just deals with the raw rendering engine. I wrote about this process in Hosting the Razor Engine in Non-Web Applications a long while back. It's quite a process to create a custom Razor engine and runtime, but it allows for all sorts of flexibility. There's also a RazorEngine CodePlex project that does something similar. I've been meaning to check out the latter but haven't gotten around to it since I have my own code to do this. The trick to hosting the RazorEngine to have it behave properly inside of an ASP.NET application and properly cache content so templates aren't constantly rebuild and reparsed. Anyway, in the same app as above I have one scenario where no ControllerContext is available: I have a background scheduler running inside of the app that fires on timed intervals. This process could be external but because it's lightweight we decided to fire it right inside of the ASP.NET app on a separate thread. In my app the code that renders these templates does something like this:var model = new SearchNotificationViewModel() { Entries = entries, Notification = notification, User = user }; // TODO: Need logging for errors sending string razorError = null; var result = AppUtils.RenderRazorTemplate("~/views/template/SearchNotificationTemplate.cshtml", model, razorError); which references a couple of helper functions that set up my RazorFolderHostContainer class:public static string RenderRazorTemplate(string virtualPath, object model,string errorMessage = null) { var razor = AppUtils.CreateRazorHost(); var path = virtualPath.Replace("~/", "").Replace("~", "").Replace("/", "\\"); var merged = razor.RenderTemplateToString(path, model); if (merged == null) errorMessage = razor.ErrorMessage; return merged; } /// <summary> /// Creates a RazorStringHostContainer and starts it /// Call .Stop() when you're done with it. /// /// This is a static instance /// </summary> /// <param name="virtualPath"></param> /// <param name="binBasePath"></param> /// <param name="forceLoad"></param> /// <returns></returns> public static RazorFolderHostContainer CreateRazorHost(string binBasePath = null, bool forceLoad = false) { if (binBasePath == null) { if (HttpContext.Current != null) binBasePath = HttpContext.Current.Server.MapPath("~/"); else binBasePath = AppDomain.CurrentDomain.BaseDirectory; } if (_RazorHost == null || forceLoad) { if (!binBasePath.EndsWith("\\")) binBasePath += "\\"; //var razor = new RazorStringHostContainer(); var razor = new RazorFolderHostContainer(); razor.TemplatePath = binBasePath; binBasePath += "bin\\"; razor.BaseBinaryFolder = binBasePath; razor.UseAppDomain = false; razor.ReferencedAssemblies.Add(binBasePath + "ClassifiedsBusiness.dll"); razor.ReferencedAssemblies.Add(binBasePath + "ClassifiedsWeb.dll"); razor.ReferencedAssemblies.Add(binBasePath + "Westwind.Utilities.dll"); razor.ReferencedAssemblies.Add(binBasePath + "Westwind.Web.dll"); razor.ReferencedAssemblies.Add(binBasePath + "Westwind.Web.Mvc.dll"); razor.ReferencedAssemblies.Add("System.Web.dll"); razor.ReferencedNamespaces.Add("System.Web"); razor.ReferencedNamespaces.Add("ClassifiedsBusiness"); razor.ReferencedNamespaces.Add("ClassifiedsWeb"); razor.ReferencedNamespaces.Add("Westwind.Web"); razor.ReferencedNamespaces.Add("Westwind.Utilities"); _RazorHost = razor; _RazorHost.Start(); //_RazorHost.Engine.Configuration.CompileToMemory = false; } return _RazorHost; } The RazorFolderHostContainer essentially is a full runtime that mimics a folder structure like a typical Web app does including caching semantics and compiling code only if code changes on disk. It maps a folder hierarchy to views using the ~/ path syntax. The host is then configured to add assemblies and namespaces. Unfortunately the engine is not exactly like MVC's Razor - the expression expansion and code execution are the same, but some of the support methods like sections, helpers etc. are not all there so templates have to be a bit simpler. There are other folder hosts provided as well to directly execute templates from strings (using RazorStringHostContainer). The following is an example of an HTML email template @inherits RazorHosting.RazorTemplateFolderHost <ClassifiedsWeb.SearchNotificationViewModel> <html> <head> <title>Search Notifications</title> <style> body { margin: 5px;font-family: Verdana, Arial; font-size: 10pt;} h3 { color: SteelBlue; } .entry-item { border-bottom: 1px solid grey; padding: 8px; margin-bottom: 5px; } </style> </head> <body> Hello @Model.User.Name,<br /> <p>Below are your Search Results for the search phrase:</p> <h3>@Model.Notification.SearchPhrase</h3> <small>since @TimeUtils.ShortDateString(Model.Notification.LastSearch)</small> <hr /> You can see that the syntax is a little different. Instead of the familiar @model header the raw Razor  @inherits tag is used to specify the template base class (which you can extend). I took a quick look through the feature set of RazorEngine on CodePlex (now Github I guess) and the template implementation they use is closer to MVC's razor but there are other differences. In the end don't expect exact behavior like MVC templates if you use an external Razor rendering engine. This is not what I would consider an ideal solution, but it works well enough for this project. My biggest concern is the overhead of hosting a second razor engine in a Web app and the fact that here the differences in template rendering between 'real' MVC Razor views and another RazorEngine really are noticeable. You win some, you lose some It's extremely nice to see that if you have a ControllerContext handy (which probably addresses 99% of Web app scenarios) rendering a view to string using the native MVC Razor engine is pretty simple. Kudos on making that happen - as it solves a problem I see in just about every Web application I work on. But it is a bummer that a ControllerContext is required to make this simple code work. It'd be really sweet if there was a way to render views without being so closely coupled to the ASP.NET or MVC infrastructure that requires a ControllerContext. Alternately it'd be nice to have a way for an MVC based application to create a minimal ControllerContext from scratch - maybe somebody's been down that path. I tried for a few hours to come up with a way to make that work but gave up in the soup of nested contexts (MVC/Controller/View/Http). I suspect going down this path would be similar to hosting the ASP.NET runtime requiring a WorkerRequest. Brrr…. The sad part is that it seems to me that a View should really not require much 'context' of any kind to render output to string. Yes there are a few things that clearly are required like paths to the virtual and possibly the disk paths to the root of the app, but beyond that view rendering should not require much. But, no such luck. For now custom RazorHosting seems to be the only way to make Razor rendering go outside of the MVC context… Resources Full ViewRenderer.cs source code from Westwind.Web.Mvc library Hosting the Razor Engine for Non-Web Applications RazorEngine on GitHub© Rick Strahl, West Wind Technologies, 2005-2012Posted in ASP.NET   ASP.NET  MVC   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • Creating STA COM compatible ASP.NET Applications

    - by Rick Strahl
    When building ASP.NET applications that interface with old school COM objects like those created with VB6 or Visual FoxPro (MTDLL), it's extremely important that the threads that are serving requests use Single Threaded Apartment Threading. STA is a COM built-in technology that allows essentially single threaded components to operate reliably in a multi-threaded environment. STA's guarantee that COM objects instantiated on a specific thread stay on that specific thread and any access to a COM object from another thread automatically marshals that thread to the STA thread. The end effect is that you can have multiple threads, but a COM object instance lives on a fixed never changing thread. ASP.NET by default uses MTA (multi-threaded apartment) threads which are truly free spinning threads that pay no heed to COM object marshaling. This is vastly more efficient than STA threading which has a bit of overhead in determining whether it's OK to run code on a given thread or whether some sort of thread/COM marshaling needs to occur. MTA COM components can be very efficient, but STA COM components in a multi-threaded environment always tend to have a fair amount of overhead. It's amazing how much COM Interop I still see today so while it seems really old school to be talking about this topic, it's actually quite apropos for me as I have many customers using legacy COM systems that need to interface with other .NET applications. In this post I'm consolidating some of the hacks I've used to integrate with various ASP.NET technologies when using STA COM Components. STA in ASP.NET Support for STA threading in the ASP.NET framework is fairly limited. Specifically only the original ASP.NET WebForms technology supports STA threading directly via its STA Page Handler implementation or what you might know as ASPCOMPAT mode. For WebForms running STA components is as easy as specifying the ASPCOMPAT attribute in the @Page tag:<%@ Page Language="C#" AspCompat="true" %> which runs the page in STA mode. Removing it runs in MTA mode. Simple. Unfortunately all other ASP.NET technologies built on top of the core ASP.NET engine do not support STA natively. So if you want to use STA COM components in MVC or with class ASMX Web Services, there's no automatic way like the ASPCOMPAT keyword available. So what happens when you run an STA COM component in an MTA application? In low volume environments - nothing much will happen. The COM objects will appear to work just fine as there are no simultaneous thread interactions and the COM component will happily run on a single thread or multiple single threads one at a time. So for testing running components in MTA environments may appear to work just fine. However as load increases and threads get re-used by ASP.NET COM objects will end up getting created on multiple different threads. This can result in crashes or hangs, or data corruption in the STA components which store their state in thread local storage on the STA thread. If threads overlap this global store can easily get corrupted which in turn causes problems. STA ensures that any COM object instance loaded always stays on the same thread it was instantiated on. What about COM+? COM+ is supposed to address the problem of STA in MTA applications by providing an abstraction with it's own thread pool manager for COM objects. It steps in to the COM instantiation pipeline and hands out COM instances from its own internally maintained STA Thread pool. This guarantees that the COM instantiation threads are STA threads if using STA components. COM+ works, but in my experience the technology is very, very slow for STA components. It adds a ton of overhead and reduces COM performance noticably in load tests in IIS. COM+ can make sense in some situations but for Web apps with STA components it falls short. In addition there's also the need to ensure that COM+ is set up and configured on the target machine and the fact that components have to be registered in COM+. COM+ also keeps components up at all times, so if a component needs to be replaced the COM+ package needs to be unloaded (same is true for IIS hosted components but it's more common to manage that). COM+ is an option for well established components, but native STA support tends to provide better performance and more consistent usability, IMHO. STA for non supporting ASP.NET Technologies As mentioned above only WebForms supports STA natively. However, by utilizing the WebForms ASP.NET Page handler internally it's actually possible to trick various other ASP.NET technologies and let them work with STA components. This is ugly but I've used each of these in various applications and I've had minimal problems making them work with FoxPro STA COM components which is about as dififcult as it gets for COM Interop in .NET. In this post I summarize several STA workarounds that enable you to use STA threading with these ASP.NET Technologies: ASMX Web Services ASP.NET MVC WCF Web Services ASP.NET Web API ASMX Web Services I start with classic ASP.NET ASMX Web Services because it's the easiest mechanism that allows for STA modification. It also clearly demonstrates how the WebForms STA Page Handler is the key technology to enable the various other solutions to create STA components. Essentially the way this works is to override the WebForms Page class and hijack it's init functionality for processing requests. Here's what this looks like for Web Services:namespace FoxProAspNet { public class WebServiceStaHandler : System.Web.UI.Page, IHttpAsyncHandler { protected override void OnInit(EventArgs e) { IHttpHandler handler = new WebServiceHandlerFactory().GetHandler( this.Context, this.Context.Request.HttpMethod, this.Context.Request.FilePath, this.Context.Request.PhysicalPath); handler.ProcessRequest(this.Context); this.Context.ApplicationInstance.CompleteRequest(); } public IAsyncResult BeginProcessRequest( HttpContext context, AsyncCallback cb, object extraData) { return this.AspCompatBeginProcessRequest(context, cb, extraData); } public void EndProcessRequest(IAsyncResult result) { this.AspCompatEndProcessRequest(result); } } public class AspCompatWebServiceStaHandlerWithSessionState : WebServiceStaHandler, IRequiresSessionState { } } This class overrides the ASP.NET WebForms Page class which has a little known AspCompatBeginProcessRequest() and AspCompatEndProcessRequest() method that is responsible for providing the WebForms ASPCOMPAT functionality. These methods handle routing requests to STA threads. Note there are two classes - one that includes session state and one that does not. If you plan on using ASP.NET Session state use the latter class, otherwise stick to the former. This maps to the EnableSessionState page setting in WebForms. This class simply hooks into this functionality by overriding the BeginProcessRequest and EndProcessRequest methods and always forcing it into the AspCompat methods. The way this works is that BeginProcessRequest() fires first to set up the threads and starts intializing the handler. As part of that process the OnInit() method is fired which is now already running on an STA thread. The code then creates an instance of the actual WebService handler factory and calls its ProcessRequest method to start executing which generates the Web Service result. Immediately after ProcessRequest the request is stopped with Application.CompletRequest() which ensures that the rest of the Page handler logic doesn't fire. This means that even though the fairly heavy Page class is overridden here, it doesn't end up executing any of its internal processing which makes this code fairly efficient. In a nutshell, we're highjacking the Page HttpHandler and forcing it to process the WebService process handler in the context of the AspCompat handler behavior. Hooking up the Handler Because the above is an HttpHandler implementation you need to hook up the custom handler and replace the standard ASMX handler. To do this you need to modify the web.config file (here for IIS 7 and IIS Express): <configuration> <system.webServer> <handlers> <remove name="WebServiceHandlerFactory-Integrated-4.0" /> <add name="Asmx STA Web Service Handler" path="*.asmx" verb="*" type="FoxProAspNet.WebServiceStaHandler" precondition="integrated"/> </handlers> </system.webServer> </configuration> (Note: The name for the WebServiceHandlerFactory-Integrated-4.0 might be slightly different depending on your server version. Check the IIS Handler configuration in the IIS Management Console for the exact name or simply remove the handler from the list there which will propagate to your web.config). For IIS 5 & 6 (Windows XP/2003) or the Visual Studio Web Server use:<configuration> <system.web> <httpHandlers> <remove path="*.asmx" verb="*" /> <add path="*.asmx" verb="*" type="FoxProAspNet.WebServiceStaHandler" /> </httpHandlers> </system.web></configuration> To test, create a new ASMX Web Service and create a method like this: [WebService(Namespace = "http://foxaspnet.org/")] [WebServiceBinding(ConformsTo = WsiProfiles.BasicProfile1_1)] public class FoxWebService : System.Web.Services.WebService { [WebMethod] public string HelloWorld() { return "Hello World. Threading mode is: " + System.Threading.Thread.CurrentThread.GetApartmentState(); } } Run this before you put in the web.config configuration changes and you should get: Hello World. Threading mode is: MTA Then put the handler mapping into Web.config and you should see: Hello World. Threading mode is: STA And you're on your way to using STA COM components. It's a hack but it works well! I've used this with several high volume Web Service installations with various customers and it's been fast and reliable. ASP.NET MVC ASP.NET MVC has quickly become the most popular ASP.NET technology, replacing WebForms for creating HTML output. MVC is more complex to get started with, but once you understand the basic structure of how requests flow through the MVC pipeline it's easy to use and amazingly flexible in manipulating HTML requests. In addition, MVC has great support for non-HTML output sources like JSON and XML, making it an excellent choice for AJAX requests without any additional tools. Unlike WebForms ASP.NET MVC doesn't support STA threads natively and so some trickery is needed to make it work with STA threads as well. MVC gets its handler implementation through custom route handlers using ASP.NET's built in routing semantics. To work in an STA handler requires working in the Page Handler as part of the Route Handler implementation. As with the Web Service handler the first step is to create a custom HttpHandler that can instantiate an MVC request pipeline properly:public class MvcStaThreadHttpAsyncHandler : Page, IHttpAsyncHandler, IRequiresSessionState { private RequestContext _requestContext; public MvcStaThreadHttpAsyncHandler(RequestContext requestContext) { if (requestContext == null) throw new ArgumentNullException("requestContext"); _requestContext = requestContext; } public IAsyncResult BeginProcessRequest(HttpContext context, AsyncCallback cb, object extraData) { return this.AspCompatBeginProcessRequest(context, cb, extraData); } protected override void OnInit(EventArgs e) { var controllerName = _requestContext.RouteData.GetRequiredString("controller"); var controllerFactory = ControllerBuilder.Current.GetControllerFactory(); var controller = controllerFactory.CreateController(_requestContext, controllerName); if (controller == null) throw new InvalidOperationException("Could not find controller: " + controllerName); try { controller.Execute(_requestContext); } finally { controllerFactory.ReleaseController(controller); } this.Context.ApplicationInstance.CompleteRequest(); } public void EndProcessRequest(IAsyncResult result) { this.AspCompatEndProcessRequest(result); } public override void ProcessRequest(HttpContext httpContext) { throw new NotSupportedException("STAThreadRouteHandler does not support ProcessRequest called (only BeginProcessRequest)"); } } This handler code figures out which controller to load and then executes the controller. MVC internally provides the information needed to route to the appropriate method and pass the right parameters. Like the Web Service handler the logic occurs in the OnInit() and performs all the processing in that part of the request. Next, we need a RouteHandler that can actually pick up this handler. Unlike the Web Service handler where we simply registered the handler, MVC requires a RouteHandler to pick up the handler. RouteHandlers look at the URL's path and based on that decide on what handler to invoke. The route handler is pretty simple - all it does is load our custom handler: public class MvcStaThreadRouteHandler : IRouteHandler { public IHttpHandler GetHttpHandler(RequestContext requestContext) { if (requestContext == null) throw new ArgumentNullException("requestContext"); return new MvcStaThreadHttpAsyncHandler(requestContext); } } At this point you can instantiate this route handler and force STA requests to MVC by specifying a route. The following sets up the ASP.NET Default Route:Route mvcRoute = new Route("{controller}/{action}/{id}", new RouteValueDictionary( new { controller = "Home", action = "Index", id = UrlParameter.Optional }), new MvcStaThreadRouteHandler()); RouteTable.Routes.Add(mvcRoute);   To make this code a little easier to work with and mimic the behavior of the routes.MapRoute() functionality extension method that MVC provides, here is an extension method for MapMvcStaRoute(): public static class RouteCollectionExtensions { public static void MapMvcStaRoute(this RouteCollection routeTable, string name, string url, object defaults = null) { Route mvcRoute = new Route(url, new RouteValueDictionary(defaults), new MvcStaThreadRouteHandler()); RouteTable.Routes.Add(mvcRoute); } } With this the syntax to add  route becomes a little easier and matches the MapRoute() method:RouteTable.Routes.MapMvcStaRoute( name: "Default", url: "{controller}/{action}/{id}", defaults: new { controller = "Home", action = "Index", id = UrlParameter.Optional } ); The nice thing about this route handler, STA Handler and extension method is that it's fully self contained. You can put all three into a single class file and stick it into your Web app, and then simply call MapMvcStaRoute() and it just works. Easy! To see whether this works create an MVC controller like this: public class ThreadTestController : Controller { public string ThreadingMode() { return Thread.CurrentThread.GetApartmentState().ToString(); } } Try this test both with only the MapRoute() hookup in the RouteConfiguration in which case you should get MTA as the value. Then change the MapRoute() call to MapMvcStaRoute() leaving all the parameters the same and re-run the request. You now should see STA as the result. You're on your way using STA COM components reliably in ASP.NET MVC. WCF Web Services running through IIS WCF Web Services provide a more robust and wider range of services for Web Services. You can use WCF over HTTP, TCP, and Pipes, and WCF services support WS* secure services. There are many features in WCF that go way beyond what ASMX can do. But it's also a bit more complex than ASMX. As a basic rule if you need to serve straight SOAP Services over HTTP I 'd recommend sticking with the simpler ASMX services especially if COM is involved. If you need WS* support or want to serve data over non-HTTP protocols then WCF makes more sense. WCF is not my forte but I found a solution from Scott Seely on his blog that describes the progress and that seems to work well. I'm copying his code below so this STA information is all in one place and quickly explain. Scott's code basically works by creating a custom OperationBehavior which can be specified via an [STAOperation] attribute on every method. Using his attribute you end up with a class (or Interface if you separate the contract and class) that looks like this: [ServiceContract] public class WcfService { [OperationContract] public string HelloWorldMta() { return Thread.CurrentThread.GetApartmentState().ToString(); } // Make sure you use this custom STAOperationBehavior // attribute to force STA operation of service methods [STAOperationBehavior] [OperationContract] public string HelloWorldSta() { return Thread.CurrentThread.GetApartmentState().ToString(); } } Pretty straight forward. The latter method returns STA while the former returns MTA. To make STA work every method needs to be marked up. The implementation consists of the attribute and OperationInvoker implementation. Here are the two classes required to make this work from Scott's post:public class STAOperationBehaviorAttribute : Attribute, IOperationBehavior { public void AddBindingParameters(OperationDescription operationDescription, System.ServiceModel.Channels.BindingParameterCollection bindingParameters) { } public void ApplyClientBehavior(OperationDescription operationDescription, System.ServiceModel.Dispatcher.ClientOperation clientOperation) { // If this is applied on the client, well, it just doesn’t make sense. // Don’t throw in case this attribute was applied on the contract // instead of the implementation. } public void ApplyDispatchBehavior(OperationDescription operationDescription, System.ServiceModel.Dispatcher.DispatchOperation dispatchOperation) { // Change the IOperationInvoker for this operation. dispatchOperation.Invoker = new STAOperationInvoker(dispatchOperation.Invoker); } public void Validate(OperationDescription operationDescription) { if (operationDescription.SyncMethod == null) { throw new InvalidOperationException("The STAOperationBehaviorAttribute " + "only works for synchronous method invocations."); } } } public class STAOperationInvoker : IOperationInvoker { IOperationInvoker _innerInvoker; public STAOperationInvoker(IOperationInvoker invoker) { _innerInvoker = invoker; } public object[] AllocateInputs() { return _innerInvoker.AllocateInputs(); } public object Invoke(object instance, object[] inputs, out object[] outputs) { // Create a new, STA thread object[] staOutputs = null; object retval = null; Thread thread = new Thread( delegate() { retval = _innerInvoker.Invoke(instance, inputs, out staOutputs); }); thread.SetApartmentState(ApartmentState.STA); thread.Start(); thread.Join(); outputs = staOutputs; return retval; } public IAsyncResult InvokeBegin(object instance, object[] inputs, AsyncCallback callback, object state) { // We don’t handle async… throw new NotImplementedException(); } public object InvokeEnd(object instance, out object[] outputs, IAsyncResult result) { // We don’t handle async… throw new NotImplementedException(); } public bool IsSynchronous { get { return true; } } } The key in this setup is the Invoker and the Invoke method which creates a new thread and then fires the request on this new thread. Because this approach creates a new thread for every request it's not super efficient. There's a bunch of overhead involved in creating the thread and throwing it away after each thread, but it'll work for low volume requests and insure each thread runs in STA mode. If better performance is required it would be useful to create a custom thread manager that can pool a number of STA threads and hand off threads as needed rather than creating new threads on every request. If your Web Service needs are simple and you need only to serve standard SOAP 1.x requests, I would recommend sticking with ASMX services. It's easier to set up and work with and for STA component use it'll be significantly better performing since ASP.NET manages the STA thread pool for you rather than firing new threads for each request. One nice thing about Scotts code is though that it works in any WCF environment including self hosting. It has no dependency on ASP.NET or WebForms for that matter. STA - If you must STA components are a  pain in the ass and thankfully there isn't too much stuff out there anymore that requires it. But when you need it and you need to access STA functionality from .NET at least there are a few options available to make it happen. Each of these solutions is a bit hacky, but they work - I've used all of them in production with good results with FoxPro components. I hope compiling all of these in one place here makes it STA consumption a little bit easier. I feel your pain :-) Resources Download STA Handler Code Examples Scott Seely's original STA WCF OperationBehavior Article© Rick Strahl, West Wind Technologies, 2005-2012Posted in FoxPro   ASP.NET  .NET  COM   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • ANTS CLR and Memory Profiler In Depth Review (Part 1 of 2 &ndash; CLR Profiler)

    - by ToStringTheory
    One of the things that people might not know about me, is my obsession to make my code as efficient as possible.  Many people might not realize how much of a task or undertaking that this might be, but it is surely a task as monumental as climbing Mount Everest, except this time it is a challenge for the mind…  In trying to make code efficient, there are many different factors that play a part – size of project or solution, tiers, language used, experience and training of the programmer, technologies used, maintainability of the code – the list can go on for quite some time. I spend quite a bit of time when developing trying to determine what is the best way to implement a feature to accomplish the efficiency that I look to achieve.  One program that I have recently come to learn about – Red Gate ANTS Performance (CLR) and Memory profiler gives me tools to accomplish that job more efficiently as well.  In this review, I am going to cover some of the features of the ANTS profiler set by compiling some hideous example code to test against. Notice As a member of the Geeks With Blogs Influencers program, one of the perks is the ability to review products, in exchange for a free license to the program.  I have not let this affect my opinions of the product in any way, and Red Gate nor Geeks With Blogs has tried to influence my opinion regarding this product in any way. Introduction The ANTS Profiler pack provided by Red Gate was something that I had not heard of before receiving an email regarding an offer to review it for a license.  Since I look to make my code efficient, it was a no brainer for me to try it out!  One thing that I have to say took me by surprise is that upon downloading the program and installing it you fill out a form for your usual contact information.  Sure enough within 2 hours, I received an email from a sales representative at Red Gate asking if she could help me to achieve the most out of my trial time so it wouldn’t go to waste.  After replying to her and explaining that I was looking to review its feature set, she put me in contact with someone that setup a demo session to give me a quick rundown of its features via an online meeting.  After having dealt with a massive ordeal with one of my utility companies and their complete lack of customer service, Red Gates friendly and helpful representatives were a breath of fresh air, and something I was thankful for. ANTS CLR Profiler The ANTS CLR profiler is the thing I want to focus on the most in this post, so I am going to dive right in now. Install was simple and took no time at all.  It installed both the profiler for the CLR and Memory, but also visual studio extensions to facilitate the usage of the profilers (click any images for full size images): The Visual Studio menu options (under ANTS menu) Starting the CLR Performance Profiler from the start menu yields this window If you follow the instructions after launching the program from the start menu (Click File > New Profiling Session to start a new project), you are given a dialog with plenty of options for profiling: The New Session dialog.  Lots of options.  One thing I noticed is that the buttons in the lower right were half-covered by the panel of the application.  If I had to guess, I would imagine that this is caused by my DPI settings being set to 125%.  This is a problem I have seen in other applications as well that don’t scale well to different dpi scales. The profiler options give you the ability to profile: .NET Executable ASP.NET web application (hosted in IIS) ASP.NET web application (hosted in IIS express) ASP.NET web application (hosted in Cassini Web Development Server) SharePoint web application (hosted in IIS) Silverlight 4+ application Windows Service COM+ server XBAP (local XAML browser application) Attach to an already running .NET 4 process Choosing each option provides a varying set of other variables/options that one can set including options such as application arguments, operating path, record I/O performance performance counters to record (43 counters in all!), etc…  All in all, they give you the ability to profile many different .Net project types, and make it simple to do so.  In most cases of my using this application, I would be using the built in Visual Studio extensions, as they automatically start a new profiling project in ANTS with the options setup, and start your program, however RedGate has made it easy enough to profile outside of Visual Studio as well. On the flip side of this, as someone who lives most of their work life in Visual Studio, one thing I do wish is that instead of opening an entirely separate application/gui to perform profiling after launching, that instead they would provide a Visual Studio panel with the information, and integrate more of the profiling project information into Visual Studio.  So, now that we have an idea of what options that the profiler gives us, its time to test its abilities and features. Horrendous Example Code – Prime Number Generator One of my interests besides development, is Physics and Math – what I went to college for.  I have especially always been interested in prime numbers, as they are something of a mystery…  So, I decided that I would go ahead and to test the abilities of the profiler, I would write a small program, website, and library to generate prime numbers in the quantity that you ask for.  I am going to start off with some terrible code, and show how I would see the profiler being used as a development tool. First off, the IPrimes interface (all code is downloadable at the end of the post): interface IPrimes { IEnumerable<int> GetPrimes(int retrieve); } Simple enough, right?  Anything that implements the interface will (hopefully) provide an IEnumerable of int, with the quantity specified in the parameter argument.  Next, I am going to implement this interface in the most basic way: public class DumbPrimes : IPrimes { public IEnumerable<int> GetPrimes(int retrieve) { //store a list of primes already found var _foundPrimes = new List<int>() { 2, 3 }; //if i ask for 1 or two primes, return what asked for if (retrieve <= _foundPrimes.Count()) return _foundPrimes.Take(retrieve); //the next number to look at int _analyzing = 4; //since I already determined I don't have enough //execute at least once, and until quantity is sufficed do { //assume prime until otherwise determined bool isPrime = true; //start dividing at 2 //divide until number is reached, or determined not prime for (int i = 2; i < _analyzing && isPrime; i++) { //if (i) goes into _analyzing without a remainder, //_analyzing is NOT prime if (_analyzing % i == 0) isPrime = false; } //if it is prime, add to found list if (isPrime) _foundPrimes.Add(_analyzing); //increment number to analyze next _analyzing++; } while (_foundPrimes.Count() < retrieve); return _foundPrimes; } } This is the simplest way to get primes in my opinion.  Checking each number by the straight definition of a prime – is it divisible by anything besides 1 and itself. I have included this code in a base class library for my solution, as I am going to use it to demonstrate a couple of features of ANTS.  This class library is consumed by a simple non-MVVM WPF application, and a simple MVC4 website.  I will not post the WPF code here inline, as it is simply an ObservableCollection<int>, a label, two textbox’s, and a button. Starting a new Profiling Session So, in Visual Studio, I have just completed my first stint developing the GUI and DumbPrimes IPrimes class, so now I want to check my codes efficiency by profiling it.  All I have to do is build the solution (surprised initiating a profiling session doesn’t do this, but I suppose I can understand it), and then click the ANTS menu, followed by Profile Performance.  I am then greeted by the profiler starting up and already monitoring my program live: You are provided with a realtime graph at the top, and a pane at the bottom giving you information on how to proceed.  I am going to start by asking my program to show me the first 15000 primes: After the program finally began responding again (I did all the work on the main UI thread – how bad!), I stopped the profiler, which did kill the process of my program too.  One important thing to note, is that the profiler by default wants to give you a lot of detail about the operation – line hit counts, time per line, percent time per line, etc…  The important thing to remember is that this itself takes a lot of time.  When running my program without the profiler attached, it can generate the 15000 primes in 5.18 seconds, compared to 74.5 seconds – almost a 1500 percent increase.  While this may seem like a lot, remember that there is a trade off.  It may be WAY more inefficient, however, I am able to drill down and make improvements to specific problem areas, and then decrease execution time all around. Analyzing the Profiling Session After clicking ‘Stop Profiling’, the process running my application stopped, and the entire execution time was automatically selected by ANTS, and the results shown below: Now there are a number of interesting things going on here, I am going to cover each in a section of its own: Real Time Performance Counter Bar (top of screen) At the top of the screen, is the real time performance bar.  As your application is running, this will constantly update with the currently selected performance counters status.  A couple of cool things to note are the fact that you can drag a selection around specific time periods to drill down the detail views in the lower 2 panels to information pertaining to only that period. After selecting a time period, you can bookmark a section and name it, so that it is easy to find later, or after reloaded at a later time.  You can also zoom in, out, or fit the graph to the space provided – useful for drilling down. It may be hard to see, but at the top of the processor time graph below the time ticks, but above the red usage graph, there is a green bar. This bar shows at what times a method that is selected in the ‘Call tree’ panel is called. Very cool to be able to click on a method and see at what times it made an impact. As I said before, ANTS provides 43 different performance counters you can hook into.  Click the arrow next to the Performance tab at the top will allow you to change between different counters if you have them selected: Method Call Tree, ADO.Net Database Calls, File IO – Detail Panel Red Gate really hit the mark here I think. When you select a section of the run with the graph, the call tree populates to fill a hierarchical tree of method calls, with information regarding each of the methods.   By default, methods are hidden where the source is not provided (framework type code), however, Red Gate has integrated Reflector into ANTS, so even if you don’t have source for something, you can select a method and get the source if you want.  Methods are also hidden where the impact is seen as insignificant – methods that are only executed for 1% of the time of the overall calling methods time; in other words, working on making them better is not where your efforts should be focused. – Smart! Source Panel – Detail Panel The source panel is where you can see line level information on your code, showing the code for the currently selected method from the Method Call Tree.  If the code is not available, Reflector takes care of it and shows the code anyways! As you can notice, there does seem to be a problem with how ANTS determines what line is the actual line that a call is completed on.  I have suspicions that this may be due to some of the inline code optimizations that the CLR applies upon compilation of the assembly.  In a method with comments, the problem is much more severe: As you can see here, apparently the most offending code in my base library was a comment – *gasp*!  Removing the comments does help quite a bit, however I hope that Red Gate works on their counter algorithm soon to improve the logic on positioning for statistics: I did a small test just to demonstrate the lines are correct without comments. For me, it isn’t a deal breaker, as I can usually determine the correct placements by looking at the application code in the region and determining what makes sense, but it is something that would probably build up some irritation with time. Feature – Suggest Method for Optimization A neat feature to really help those in need of a pointer, is the menu option under tools to automatically suggest methods to optimize/improve: Nice feature – clicking it filters the call tree and stars methods that it thinks are good candidates for optimization.  I do wish that they would have made it more visible for those of use who aren’t great on sight: Process Integration I do think that this could have a place in my process.  After experimenting with the profiler, I do think it would be a great benefit to do some development, testing, and then after all the bugs are worked out, use the profiler to check on things to make sure nothing seems like it is hogging more than its fair share.  For example, with this program, I would have developed it, ran it, tested it – it works, but slowly. After looking at the profiler, and seeing the massive amount of time spent in 1 method, I might go ahead and try to re-implement IPrimes (I actually would probably rewrite the offending code, but so that I can distribute both sets of code easily, I’m just going to make another implementation of IPrimes).  Using two pieces of knowledge about prime numbers can make this method MUCH more efficient – prime numbers fall into two buckets 6k+/-1 , and a number is prime if it is not divisible by any other primes before it: public class SmartPrimes : IPrimes { public IEnumerable<int> GetPrimes(int retrieve) { //store a list of primes already found var _foundPrimes = new List<int>() { 2, 3 }; //if i ask for 1 or two primes, return what asked for if (retrieve <= _foundPrimes.Count()) return _foundPrimes.Take(retrieve); //the next number to look at int _k = 1; //since I already determined I don't have enough //execute at least once, and until quantity is sufficed do { //assume prime until otherwise determined bool isPrime = true; int potentialPrime; //analyze 6k-1 //assign the value to potential potentialPrime = 6 * _k - 1; //if there are any primes that divise this, it is NOT a prime number //using PLINQ for quick boost isPrime = !_foundPrimes.AsParallel() .Any(prime => potentialPrime % prime == 0); //if it is prime, add to found list if (isPrime) _foundPrimes.Add(potentialPrime); if (_foundPrimes.Count() == retrieve) break; //analyze 6k+1 //assign the value to potential potentialPrime = 6 * _k + 1; //if there are any primes that divise this, it is NOT a prime number //using PLINQ for quick boost isPrime = !_foundPrimes.AsParallel() .Any(prime => potentialPrime % prime == 0); //if it is prime, add to found list if (isPrime) _foundPrimes.Add(potentialPrime); //increment k to analyze next _k++; } while (_foundPrimes.Count() < retrieve); return _foundPrimes; } } Now there are definitely more things I can do to help make this more efficient, but for the scope of this example, I think this is fine (but still hideous)! Profiling this now yields a happy surprise 27 seconds to generate the 15000 primes with the profiler attached, and only 1.43 seconds without.  One important thing I wanted to call out though was the performance graph now: Notice anything odd?  The %Processor time is above 100%.  This is because there is now more than 1 core in the operation.  A better label for the chart in my mind would have been %Core time, but to each their own. Another odd thing I noticed was that the profiler seemed to be spot on this time in my DumbPrimes class with line details in source, even with comments..  Odd. Profiling Web Applications The last thing that I wanted to cover, that means a lot to me as a web developer, is the great amount of work that Red Gate put into the profiler when profiling web applications.  In my solution, I have a simple MVC4 application setup with 1 page, a single input form, that will output prime values as my WPF app did.  Launching the profiler from Visual Studio as before, nothing is really different in the profiler window, however I did receive a UAC prompt for a Red Gate helper app to integrate with the web server without notification. After requesting 500, 1000, 2000, and 5000 primes, and looking at the profiler session, things are slightly different from before: As you can see, there are 4 spikes of activity in the processor time graph, but there is also something new in the call tree: That’s right – ANTS will actually group method calls by get/post operations, so it is easier to find out what action/page is giving the largest problems…  Pretty cool in my mind! Overview Overall, I think that Red Gate ANTS CLR Profiler has a lot to offer, however I think it also has a long ways to go.  3 Biggest Pros: Ability to easily drill down from time graph, to method calls, to source code Wide variety of counters to choose from when profiling your application Excellent integration/grouping of methods being called from web applications by request – BRILLIANT! 3 Biggest Cons: Issue regarding line details in source view Nit pick – Processor time vs. Core time Nit pick – Lack of full integration with Visual Studio Ratings Ease of Use (7/10) – I marked down here because of the problems with the line level details and the extra work that that entails, and the lack of better integration with Visual Studio. Effectiveness (10/10) – I believe that the profiler does EXACTLY what it purports to do.  Especially with its large variety of performance counters, a definite plus! Features (9/10) – Besides the real time performance monitoring, and the drill downs that I’ve shown here, ANTS also has great integration with ADO.Net, with the ability to show database queries run by your application in the profiler.  This, with the line level details, the web request grouping, reflector integration, and various options to customize your profiling session I think create a great set of features! Customer Service (10/10) – My entire experience with Red Gate personnel has been nothing but good.  their people are friendly, helpful, and happy! UI / UX (8/10) – The interface is very easy to get around, and all of the options are easy to find.  With a little bit of poking around, you’ll be optimizing Hello World in no time flat! Overall (8/10) – Overall, I am happy with the Performance Profiler and its features, as well as with the service I received when working with the Red Gate personnel.  I WOULD recommend you trying the application and seeing if it would fit into your process, BUT, remember there are still some kinks in it to hopefully be worked out. My next post will definitely be shorter (hopefully), but thank you for reading up to here, or skipping ahead!  Please, if you do try the product, drop me a message and let me know what you think!  I would love to hear any opinions you may have on the product. Code Feel free to download the code I used above – download via DropBox

    Read the article

  • Using Stub Objects

    - by user9154181
    Having told the long and winding tale of where stub objects came from and how we use them to build Solaris, I'd like to focus now on the the nuts and bolts of building and using them. The following new features were added to the Solaris link-editor (ld) to support the production and use of stub objects: -z stub This new command line option informs ld that it is to build a stub object rather than a normal object. In this mode, it accepts the same command line arguments as usual, but will quietly ignore any objects and sharable object dependencies. STUB_OBJECT Mapfile Directive In order to build a stub version of an object, its mapfile must specify the STUB_OBJECT directive. When producing a non-stub object, the presence of STUB_OBJECT causes the link-editor to perform extra validation to ensure that the stub and non-stub objects will be compatible. ASSERT Mapfile Directive All data symbols exported from the object must have an ASSERT symbol directive in the mapfile that declares them as data and supplies the size, binding, bss attributes, and symbol aliasing details. When building the stub objects, the information in these ASSERT directives is used to create the data symbols. When building the real object, these ASSERT directives will ensure that the real object matches the linking interface presented by the stub. Although ASSERT was added to the link-editor in order to support stub objects, they are a general purpose feature that can be used independently of stub objects. For instance you might choose to use an ASSERT directive if you have a symbol that must have a specific address in order for the object to operate properly and you want to automatically ensure that this will always be the case. The material presented here is derived from a document I originally wrote during the development effort, which had the dual goals of providing supplemental materials for the stub object PSARC case, and as a set of edits that were eventually applied to the Oracle Solaris Linker and Libraries Manual (LLM). The Solaris 11 LLM contains this information in a more polished form. Stub Objects A stub object is a shared object, built entirely from mapfiles, that supplies the same linking interface as the real object, while containing no code or data. Stub objects cannot be used at runtime. However, an application can be built against a stub object, where the stub object provides the real object name to be used at runtime, and then use the real object at runtime. When building a stub object, the link-editor ignores any object or library files specified on the command line, and these files need not exist in order to build a stub. Since the compilation step can be omitted, and because the link-editor has relatively little work to do, stub objects can be built very quickly. Stub objects can be used to solve a variety of build problems: Speed Modern machines, using a version of make with the ability to parallelize operations, are capable of compiling and linking many objects simultaneously, and doing so offers significant speedups. However, it is typical that a given object will depend on other objects, and that there will be a core set of objects that nearly everything else depends on. It is necessary to impose an ordering that builds each object before any other object that requires it. This ordering creates bottlenecks that reduce the amount of parallelization that is possible and limits the overall speed at which the code can be built. Complexity/Correctness In a large body of code, there can be a large number of dependencies between the various objects. The makefiles or other build descriptions for these objects can become very complex and difficult to understand or maintain. The dependencies can change as the system evolves. This can cause a given set of makefiles to become slightly incorrect over time, leading to race conditions and mysterious rare build failures. Dependency Cycles It might be desirable to organize code as cooperating shared objects, each of which draw on the resources provided by the other. Such cycles cannot be supported in an environment where objects must be built before the objects that use them, even though the runtime linker is fully capable of loading and using such objects if they could be built. Stub shared objects offer an alternative method for building code that sidesteps the above issues. Stub objects can be quickly built for all the shared objects produced by the build. Then, all the real shared objects and executables can be built in parallel, in any order, using the stub objects to stand in for the real objects at link-time. Afterwards, the executables and real shared objects are kept, and the stub shared objects are discarded. Stub objects are built from a mapfile, which must satisfy the following requirements. The mapfile must specify the STUB_OBJECT directive. This directive informs the link-editor that the object can be built as a stub object, and as such causes the link-editor to perform validation and sanity checking intended to guarantee that an object and its stub will always provide identical linking interfaces. All function and data symbols that make up the external interface to the object must be explicitly listed in the mapfile. The mapfile must use symbol scope reduction ('*'), to remove any symbols not explicitly listed from the external interface. All global data exported from the object must have an ASSERT symbol attribute in the mapfile to specify the symbol type, size, and bss attributes. In the case where there are multiple symbols that reference the same data, the ASSERT for one of these symbols must specify the TYPE and SIZE attributes, while the others must use the ALIAS attribute to reference this primary symbol. Given such a mapfile, the stub and real versions of the shared object can be built using the same command line for each, adding the '-z stub' option to the link for the stub object, and omiting the option from the link for the real object. To demonstrate these ideas, the following code implements a shared object named idx5, which exports data from a 5 element array of integers, with each element initialized to contain its zero-based array index. This data is available as a global array, via an alternative alias data symbol with weak binding, and via a functional interface. % cat idx5.c int _idx5[5] = { 0, 1, 2, 3, 4 }; #pragma weak idx5 = _idx5 int idx5_func(int index) { if ((index 4)) return (-1); return (_idx5[index]); } A mapfile is required to describe the interface provided by this shared object. % cat mapfile $mapfile_version 2 STUB_OBJECT; SYMBOL_SCOPE { _idx5 { ASSERT { TYPE=data; SIZE=4[5] }; }; idx5 { ASSERT { BINDING=weak; ALIAS=_idx5 }; }; idx5_func; local: *; }; The following main program is used to print all the index values available from the idx5 shared object. % cat main.c #include <stdio.h> extern int _idx5[5], idx5[5], idx5_func(int); int main(int argc, char **argv) { int i; for (i = 0; i The following commands create a stub version of this shared object in a subdirectory named stublib. elfdump is used to verify that the resulting object is a stub. The command used to build the stub differs from that of the real object only in the addition of the -z stub option, and the use of a different output file name. This demonstrates the ease with which stub generation can be added to an existing makefile. % cc -Kpic -G -M mapfile -h libidx5.so.1 idx5.c -o stublib/libidx5.so.1 -zstub % ln -s libidx5.so.1 stublib/libidx5.so % elfdump -d stublib/libidx5.so | grep STUB [11] FLAGS_1 0x4000000 [ STUB ] The main program can now be built, using the stub object to stand in for the real shared object, and setting a runpath that will find the real object at runtime. However, as we have not yet built the real object, this program cannot yet be run. Attempts to cause the system to load the stub object are rejected, as the runtime linker knows that stub objects lack the actual code and data found in the real object, and cannot execute. % cc main.c -L stublib -R '$ORIGIN/lib' -lidx5 -lc % ./a.out ld.so.1: a.out: fatal: libidx5.so.1: open failed: No such file or directory Killed % LD_PRELOAD=stublib/libidx5.so.1 ./a.out ld.so.1: a.out: fatal: stublib/libidx5.so.1: stub shared object cannot be used at runtime Killed We build the real object using the same command as we used to build the stub, omitting the -z stub option, and writing the results to a different file. % cc -Kpic -G -M mapfile -h libidx5.so.1 idx5.c -o lib/libidx5.so.1 Once the real object has been built in the lib subdirectory, the program can be run. % ./a.out [0] 0 0 0 [1] 1 1 1 [2] 2 2 2 [3] 3 3 3 [4] 4 4 4 Mapfile Changes The version 2 mapfile syntax was extended in a number of places to accommodate stub objects. Conditional Input The version 2 mapfile syntax has the ability conditionalize mapfile input using the $if control directive. As you might imagine, these directives are used frequently with ASSERT directives for data, because a given data symbol will frequently have a different size in 32 or 64-bit code, or on differing hardware such as x86 versus sparc. The link-editor maintains an internal table of names that can be used in the logical expressions evaluated by $if and $elif. At startup, this table is initialized with items that describe the class of object (_ELF32 or _ELF64) and the type of the target machine (_sparc or _x86). We found that there were a small number of cases in the Solaris code base in which we needed to know what kind of object we were producing, so we added the following new predefined items in order to address that need: NameMeaning ...... _ET_DYNshared object _ET_EXECexecutable object _ET_RELrelocatable object ...... STUB_OBJECT Directive The new STUB_OBJECT directive informs the link-editor that the object described by the mapfile can be built as a stub object. STUB_OBJECT; A stub shared object is built entirely from the information in the mapfiles supplied on the command line. When the -z stub option is specified to build a stub object, the presence of the STUB_OBJECT directive in a mapfile is required, and the link-editor uses the information in symbol ASSERT attributes to create global symbols that match those of the real object. When the real object is built, the presence of STUB_OBJECT causes the link-editor to verify that the mapfiles accurately describe the real object interface, and that a stub object built from them will provide the same linking interface as the real object it represents. All function and data symbols that make up the external interface to the object must be explicitly listed in the mapfile. The mapfile must use symbol scope reduction ('*'), to remove any symbols not explicitly listed from the external interface. All global data in the object is required to have an ASSERT attribute that specifies the symbol type and size. If the ASSERT BIND attribute is not present, the link-editor provides a default assertion that the symbol must be GLOBAL. If the ASSERT SH_ATTR attribute is not present, or does not specify that the section is one of BITS or NOBITS, the link-editor provides a default assertion that the associated section is BITS. All data symbols that describe the same address and size are required to have ASSERT ALIAS attributes specified in the mapfile. If aliased symbols are discovered that do not have an ASSERT ALIAS specified, the link fails and no object is produced. These rules ensure that the mapfiles contain a description of the real shared object's linking interface that is sufficient to produce a stub object with a completely compatible linking interface. SYMBOL_SCOPE/SYMBOL_VERSION ASSERT Attribute The SYMBOL_SCOPE and SYMBOL_VERSION mapfile directives were extended with a symbol attribute named ASSERT. The syntax for the ASSERT attribute is as follows: ASSERT { ALIAS = symbol_name; BINDING = symbol_binding; TYPE = symbol_type; SH_ATTR = section_attributes; SIZE = size_value; SIZE = size_value[count]; }; The ASSERT attribute is used to specify the expected characteristics of the symbol. The link-editor compares the symbol characteristics that result from the link to those given by ASSERT attributes. If the real and asserted attributes do not agree, a fatal error is issued and the output object is not created. In normal use, the link editor evaluates the ASSERT attribute when present, but does not require them, or provide default values for them. The presence of the STUB_OBJECT directive in a mapfile alters the interpretation of ASSERT to require them under some circumstances, and to supply default assertions if explicit ones are not present. See the definition of the STUB_OBJECT Directive for the details. When the -z stub command line option is specified to build a stub object, the information provided by ASSERT attributes is used to define the attributes of the global symbols provided by the object. ASSERT accepts the following: ALIAS Name of a previously defined symbol that this symbol is an alias for. An alias symbol has the same type, value, and size as the main symbol. The ALIAS attribute is mutually exclusive to the TYPE, SIZE, and SH_ATTR attributes, and cannot be used with them. When ALIAS is specified, the type, size, and section attributes are obtained from the alias symbol. BIND Specifies an ELF symbol binding, which can be any of the STB_ constants defined in <sys/elf.h>, with the STB_ prefix removed (e.g. GLOBAL, WEAK). TYPE Specifies an ELF symbol type, which can be any of the STT_ constants defined in <sys/elf.h>, with the STT_ prefix removed (e.g. OBJECT, COMMON, FUNC). In addition, for compatibility with other mapfile usage, FUNCTION and DATA can be specified, for STT_FUNC and STT_OBJECT, respectively. TYPE is mutually exclusive to ALIAS, and cannot be used in conjunction with it. SH_ATTR Specifies attributes of the section associated with the symbol. The section_attributes that can be specified are given in the following table: Section AttributeMeaning BITSSection is not of type SHT_NOBITS NOBITSSection is of type SHT_NOBITS SH_ATTR is mutually exclusive to ALIAS, and cannot be used in conjunction with it. SIZE Specifies the expected symbol size. SIZE is mutually exclusive to ALIAS, and cannot be used in conjunction with it. The syntax for the size_value argument is as described in the discussion of the SIZE attribute below. SIZE The SIZE symbol attribute existed before support for stub objects was introduced. It is used to set the size attribute of a given symbol. This attribute results in the creation of a symbol definition. Prior to the introduction of the ASSERT SIZE attribute, the value of a SIZE attribute was always numeric. While attempting to apply ASSERT SIZE to the objects in the Solaris ON consolidation, I found that many data symbols have a size based on the natural machine wordsize for the class of object being produced. Variables declared as long, or as a pointer, will be 4 bytes in size in a 32-bit object, and 8 bytes in a 64-bit object. Initially, I employed the conditional $if directive to handle these cases as follows: $if _ELF32 foo { ASSERT { TYPE=data; SIZE=4 } }; bar { ASSERT { TYPE=data; SIZE=20 } }; $elif _ELF64 foo { ASSERT { TYPE=data; SIZE=8 } }; bar { ASSERT { TYPE=data; SIZE=40 } }; $else $error UNKNOWN ELFCLASS $endif I found that the situation occurs frequently enough that this is cumbersome. To simplify this case, I introduced the idea of the addrsize symbolic name, and of a repeat count, which together make it simple to specify machine word scalar or array symbols. Both the SIZE, and ASSERT SIZE attributes support this syntax: The size_value argument can be a numeric value, or it can be the symbolic name addrsize. addrsize represents the size of a machine word capable of holding a memory address. The link-editor substitutes the value 4 for addrsize when building 32-bit objects, and the value 8 when building 64-bit objects. addrsize is useful for representing the size of pointer variables and C variables of type long, as it automatically adjusts for 32 and 64-bit objects without requiring the use of conditional input. The size_value argument can be optionally suffixed with a count value, enclosed in square brackets. If count is present, size_value and count are multiplied together to obtain the final size value. Using this feature, the example above can be written more naturally as: foo { ASSERT { TYPE=data; SIZE=addrsize } }; bar { ASSERT { TYPE=data; SIZE=addrsize[5] } }; Exported Global Data Is Still A Bad Idea As you can see, the additional plumbing added to the Solaris link-editor to support stub objects is minimal. Furthermore, about 90% of that plumbing is dedicated to handling global data. We have long advised against global data exported from shared objects. There are many ways in which global data does not fit well with dynamic linking. Stub objects simply provide one more reason to avoid this practice. It is always better to export all data via a functional interface. You should always hide your data, and make it available to your users via a function that they can call to acquire the address of the data item. However, If you do have to support global data for a stub, perhaps because you are working with an already existing object, it is still easilily done, as shown above. Oracle does not like us to discuss hypothetical new features that don't exist in shipping product, so I'll end this section with a speculation. It might be possible to do more in this area to ease the difficulty of dealing with objects that have global data that the users of the library don't need. Perhaps someday... Conclusions It is easy to create stub objects for most objects. If your library only exports function symbols, all you have to do to build a faithful stub object is to add STUB_OBJECT; and then to use the same link command you're currently using, with the addition of the -z stub option. Happy Stubbing!

    Read the article

  • Microsoft Introduces WebMatrix

    - by Rick Strahl
    originally published in CoDe Magazine Editorial Microsoft recently released the first CTP of a new development environment called WebMatrix, which along with some of its supporting technologies are squarely aimed at making the Microsoft Web Platform more approachable for first-time developers and hobbyists. But in the process, it also provides some updated technologies that can make life easier for existing .NET developers. Let’s face it: ASP.NET development isn’t exactly trivial unless you already have a fair bit of familiarity with sophisticated development practices. Stick a non-developer in front of Visual Studio .NET or even the Visual Web Developer Express edition and it’s not likely that the person in front of the screen will be very productive or feel inspired. Yet other technologies like PHP and even classic ASP did provide the ability for non-developers and hobbyists to become reasonably proficient in creating basic web content quickly and efficiently. WebMatrix appears to be Microsoft’s attempt to bring back some of that simplicity with a number of technologies and tools. The key is to provide a friendly and fully self-contained development environment that provides all the tools needed to build an application in one place, as well as tools that allow publishing of content and databases easily to the web server. WebMatrix is made up of several components and technologies: IIS Developer Express IIS Developer Express is a new, self-contained development web server that is fully compatible with IIS 7.5 and based on the same codebase that IIS 7.5 uses. This new development server replaces the much less compatible Cassini web server that’s been used in Visual Studio and the Express editions. IIS Express addresses a few shortcomings of the Cassini server such as the inability to serve custom ISAPI extensions (i.e., things like PHP or ASP classic for example), as well as not supporting advanced authentication. IIS Developer Express provides most of the IIS 7.5 feature set providing much better compatibility between development and live deployment scenarios. SQL Server Compact 4.0 Database access is a key component for most web-driven applications, but on the Microsoft stack this has mostly meant you have to use SQL Server or SQL Server Express. SQL Server Compact is not new-it’s been around for a few years, but it’s been severely hobbled in the past by terrible tool support and the inability to support more than a single connection in Microsoft’s attempt to avoid losing SQL Server licensing. The new release of SQL Server Compact 4.0 supports multiple connections and you can run it in ASP.NET web applications simply by installing an assembly into the bin folder of the web application. In effect, you don’t have to install a special system configuration to run SQL Compact as it is a drop-in database engine: Copy the small assembly into your BIN folder (or from the GAC if installed fully), create a connection string against a local file-based database file, and then start firing SQL requests. Additionally WebMatrix includes nice tools to edit the database tables and files, along with tools to easily upsize (and hopefully downsize in the future) to full SQL Server. This is a big win, pending compatibility and performance limits. In my simple testing the data engine performed well enough for small data sets. This is not only useful for web applications, but also for desktop applications for which a fully installed SQL engine like SQL Server would be overkill. Having a local data store in those applications that can potentially be accessed by multiple users is a welcome feature. ASP.NET Razor View Engine What? Yet another native ASP.NET view engine? We already have Web Forms and various different flavors of using that view engine with Web Forms and MVC. Do we really need another? Microsoft thinks so, and Razor is an implementation of a lightweight, script-only view engine. Unlike the Web Forms view engine, Razor works only with inline code, snippets, and markup; therefore, it is more in line with current thinking of what a view engine should represent. There’s no support for a “page model” or any of the other Web Forms features of the full-page framework, but just a lightweight scripting engine that works with plain markup plus embedded expressions and code. The markup syntax for Razor is geared for minimal typing, plus some progressive detection of where a script block/expression starts and ends. This results in a much leaner syntax than the typical ASP.NET Web Forms alligator (<% %>) tags. Razor uses the @ sign plus standard C# (or Visual Basic) block syntax to delineate code snippets and expressions. Here’s a very simple example of what Razor markup looks like along with some comment annotations: <!DOCTYPE html> <html>     <head>         <title></title>     </head>     <body>     <h1>Razor Test</h1>          <!-- simple expressions -->     @DateTime.Now     <hr />     <!-- method expressions -->     @DateTime.Now.ToString("T")          <!-- code blocks -->     @{         List<string> names = new List<string>();         names.Add("Rick");         names.Add("Markus");         names.Add("Claudio");         names.Add("Kevin");     }          <!-- structured block statements -->     <ul>     @foreach(string name in names){             <li>@name</li>     }     </ul>           <!-- Conditional code -->        @if(true) {                        <!-- Literal Text embedding in code -->        <text>         true        </text>;    }    else    {        <!-- Literal Text embedding in code -->       <text>       false       </text>;    }    </body> </html> Like the Web Forms view engine, Razor parses pages into code, and then executes that run-time compiled code. Effectively a “page” becomes a code file with markup becoming literal text written into the Response stream, code snippets becoming raw code, and expressions being written out with Response.Write(). The code generated from Razor doesn’t look much different from similar Web Forms code that only uses script tags; so although the syntax may look different, the operational model is fairly similar to the Web Forms engine minus the overhead of the large Page object model. However, there are differences: -Razor pages are based on a new base class, Microsoft.WebPages.WebPage, which is hosted in the Microsoft.WebPages assembly that houses all the Razor engine parsing and processing logic. Browsing through the assembly (in the generated ASP.NET Temporary Files folder or GAC) will give you a good idea of the functionality that Razor provides. If you look closely, a lot of the feature set matches ASP.NET MVC’s view implementation as well as many of the helper classes found in MVC. It’s not hard to guess the motivation for this sort of view engine: For beginning developers the simple markup syntax is easier to work with, although you obviously still need to have some understanding of the .NET Framework in order to create dynamic content. The syntax is easier to read and grok and much shorter to type than ASP.NET alligator tags (<% %>) and also easier to understand aesthetically what’s happening in the markup code. Razor also is a better fit for Microsoft’s vision of ASP.NET MVC: It’s a new view engine without the baggage of Web Forms attached to it. The engine is more lightweight since it doesn’t carry all the features and object model of Web Forms with it and it can be instantiated directly outside of the HTTP environment, which has been rather tricky to do for the Web Forms view engine. Having a standalone script parser is a huge win for other applications as well – it makes it much easier to create script or meta driven output generators for many types of applications from code/screen generators, to simple form letters to data merging applications with user customizability. For me personally this is very useful side effect and who knows maybe Microsoft will actually standardize they’re scripting engines (die T4 die!) on this engine. Razor also better fits the “view-based” approach where the view is supposed to be mostly a visual representation that doesn’t hold much, if any, code. While you can still use code, the code you do write has to be self-contained. Overall I wouldn’t be surprised if Razor will become the new standard view engine for MVC in the future – and in fact there have been announcements recently that Razor will become the default script engine in ASP.NET MVC 3.0. Razor can also be used in existing Web Forms and MVC applications, although that’s not working currently unless you manually configure the script mappings and add the appropriate assemblies. It’s possible to do it, but it’s probably better to wait until Microsoft releases official support for Razor scripts in Visual Studio. Once that happens, you can simply drop .cshtml and .vbhtml pages into an existing ASP.NET project and they will work side by side with classic ASP.NET pages. WebMatrix Development Environment To tie all of these three technologies together, Microsoft is shipping WebMatrix with an integrated development environment. An integrated gallery manager makes it easy to download and load existing projects, and then extend them with custom functionality. It seems to be a prominent goal to provide community-oriented content that can act as a starting point, be it via a custom templates or a complete standard application. The IDE includes a project manager that works with a single project and provides an integrated IDE/editor for editing the .cshtml and .vbhtml pages. A run button allows you to quickly run pages in the project manager in a variety of browsers. There’s no debugging support for code at this time. Note that Razor pages don’t require explicit compilation, so making a change, saving, and then refreshing your page in the browser is all that’s needed to see changes while testing an application locally. It’s essentially using the auto-compiling Web Project that was introduced with .NET 2.0. All code is compiled during run time into dynamically created assemblies in the ASP.NET temp folder. WebMatrix also has PHP Editing support with syntax highlighting. You can load various PHP-based applications from the WebMatrix Web Gallery directly into the IDE. Most of the Web Gallery applications are ready to install and run without further configuration, with Wizards taking you through installation of tools, dependencies, and configuration of the database as needed. WebMatrix leverages the Web Platform installer to pull the pieces down from websites in a tight integration of tools that worked nicely for the four or five applications I tried this out on. Click a couple of check boxes and fill in a few simple configuration options and you end up with a running application that’s ready to be customized. Nice! You can easily deploy completed applications via WebDeploy (to an IIS server) or FTP directly from within the development environment. The deploy tool also can handle automatically uploading and installing the database and all related assemblies required, making deployment a simple one-click install step. Simplified Database Access The IDE contains a database editor that can edit SQL Compact and SQL Server databases. There is also a Database helper class that facilitates database access by providing easy-to-use, high-level query execution and iteration methods: @{       var db = Database.OpenFile("FirstApp.sdf");     string sql = "select * from customers where Id > @0"; } <ul> @foreach(var row in db.Query(sql,1)){         <li>@row.FirstName @row.LastName</li> } </ul> The query function takes a SQL statement plus any number of positional (@0,@1 etc.) SQL parameters by simple values. The result is returned as a collection of rows which in turn have a row object with dynamic properties for each of the columns giving easy (though untyped) access to each of the fields. Likewise Execute and ExecuteNonQuery allow execution of more complex queries using similar parameter passing schemes. Note these queries use string-based queries rather than LINQ or Entity Framework’s strongly typed LINQ queries. While this may seem like a step back, it’s also in line with the expectations of non .NET script developers who are quite used to writing and using SQL strings in code rather than using OR/M frameworks. The only question is why was something not included from the beginning in .NET and Microsoft made developers build custom implementations of these basic building blocks. The implementation looks a lot like a DataTable-style data access mechanism, but to be fair, this is a common approach in scripting languages. This type of syntax that uses simple, static, data object methods to perform simple data tasks with one line of code are common in scripting languages and are a good match for folks working in PHP/Python, etc. Seems like Microsoft has taken great advantage of .NET 4.0’s dynamic typing to provide this sort of interface for row iteration where each row has properties for each field. FWIW, all the examples demonstrate using local SQL Compact files - I was unable to get a SQL Server connection string to work with the Database class (the connection string wasn’t accepted). However, since the code in the page is still plain old .NET, you can easily use standard ADO.NET code or even LINQ or Entity Framework models that are created outside of WebMatrix in separate assemblies as required. The good the bad the obnoxious - It’s still .NET The beauty (or curse depending on how you look at it :)) of Razor and the compilation model is that, behind it all, it’s still .NET. Although the syntax may look foreign, it’s still all .NET behind the scenes. You can easily access existing tools, helpers, and utilities simply by adding them to the project as references or to the bin folder. Razor automatically recognizes any assembly reference from assemblies in the bin folder. In the default configuration, Microsoft provides a host of helper functions in a Microsoft.WebPages assembly (check it out in the ASP.NET temp folder for your application), which includes a host of HTML Helpers. If you’ve used ASP.NET MVC before, a lot of the helpers should look familiar. Documentation at the moment is sketchy-there’s a very rough API reference you can check out here: http://www.asp.net/webmatrix/tutorials/asp-net-web-pages-api-reference Who needs WebMatrix? Uhm… good Question Clearly Microsoft is trying hard to create an environment with WebMatrix that is easy to use for newbie developers. The goal seems to be simplicity in providing a minimal development environment and an easy-to-use script engine/language that makes it easy to get started with. There’s also some focus on community features that can be used as starting points, such as Web Gallery applications and templates. The community features in particular are very nice and something that would be nice to eventually see in Visual Studio as well. The question is whether this is too little too late. Developers who have been clamoring for a simpler development environment on the .NET stack have mostly left for other simpler platforms like PHP or Python which are catering to the down and dirty developer. Microsoft will be hard pressed to win those folks-and other hardcore PHP developers-back. Regardless of how much you dress up a script engine fronted by the .NET Framework, it’s still the .NET Framework and all the complexity that drives it. While .NET is a fine solution in its breadth and features once you get a basic handle on the core features, the bar of entry to being productive with the .NET Framework is still pretty high. The MVC style helpers Microsoft provides are a good step in the right direction, but I suspect it’s not enough to shield new developers from having to delve much deeper into the Framework to get even basic applications built. Razor and its helpers is trying to make .NET more accessible but the reality is that in order to do useful stuff that goes beyond the handful of simple helpers you still are going to have to write some C# or VB or other .NET code. If the target is a hobby/amateur/non-programmer the learning curve isn’t made any easier by WebMatrix it’s just been shifted a tad bit further along in your development endeavor when you run out of canned components that are supplied either by Microsoft or the community. The database helpers are interesting and actually I’ve heard a lot of discussion from various developers who’ve been resisting .NET for a really long time perking up at the prospect of easier data access in .NET than the ridiculous amount of code it takes to do even simple data access with raw ADO.NET. It seems sad that such a simple concept and implementation should trigger this sort of response (especially since it’s practically trivial to create helpers like these or pick them up from countless libraries available), but there it is. It also shows that there are plenty of developers out there who are more interested in ‘getting stuff done’ easily than necessarily following the latest and greatest practices which are overkill for many development scenarios. Sometimes it seems that all of .NET is focused on the big life changing issues of development, rather than the bread and butter scenarios that many developers are interested in to get their work accomplished. And that in the end may be WebMatrix’s main raison d'être: To bring some focus back at Microsoft that simpler and more high level solutions are actually needed to appeal to the non-high end developers as well as providing the necessary tools for the high end developers who want to follow the latest and greatest trends. The current version of WebMatrix hits many sweet spots, but it also feels like it has a long way to go before it really can be a tool that a beginning developer or an accomplished developer can feel comfortable with. Although there are some really good ideas in the environment (like the gallery for downloading apps and components) which would be a great addition for Visual Studio as well, the rest of the development environment just feels like crippleware with required functionality missing especially debugging and Intellisense, but also general editor support. It’s not clear whether these are because the product is still in an early alpha release or whether it’s simply designed that way to be a really limited development environment. While simple can be good, nobody wants to feel left out when it comes to necessary tool support and WebMatrix just has that left out feeling to it. If anything WebMatrix’s technology pieces (which are really independent of the WebMatrix product) are what are interesting to developers in general. The compact IIS implementation is a nice improvement for development scenarios and SQL Compact 4.0 seems to address a lot of concerns that people have had and have complained about for some time with previous SQL Compact implementations. By far the most interesting and useful technology though seems to be the Razor view engine for its light weight implementation and it’s decoupling from the ASP.NET/HTTP pipeline to provide a standalone scripting/view engine that is pluggable. The first winner of this is going to be ASP.NET MVC which can now have a cleaner view model that isn’t inconsistent due to the baggage of non-implemented WebForms features that don’t work in MVC. But I expect that Razor will end up in many other applications as a scripting and code generation engine eventually. Visual Studio integration for Razor is currently missing, but is promised for a later release. The ASP.NET MVC team has already mentioned that Razor will eventually become the default MVC view engine, which will guarantee continued growth and development of this tool along those lines. And the Razor engine and support tools actually inherit many of the features that MVC pioneered, so there’s some synergy flowing both ways between Razor and MVC. As an existing ASP.NET developer who’s already familiar with Visual Studio and ASP.NET development, the WebMatrix IDE doesn’t give you anything that you want. The tools provided are minimal and provide nothing that you can’t get in Visual Studio today, except the minimal Razor syntax highlighting, so there’s little need to take a step back. With Visual Studio integration coming later there’s little reason to look at WebMatrix for tooling. It’s good to see that Microsoft is giving some thought about the ease of use of .NET as a platform For so many years, we’ve been piling on more and more new features without trying to take a step back and see how complicated the development/configuration/deployment process has become. Sometimes it’s good to take a step - or several steps - back and take another look and realize just how far we’ve come. WebMatrix is one of those reminders and one that likely will result in some positive changes on the platform as a whole. © Rick Strahl, West Wind Technologies, 2005-2010Posted in ASP.NET   IIS7  

    Read the article

  • Nagging As A Strategy For Better Linking: -z guidance

    - by user9154181
    The link-editor (ld) in Solaris 11 has a new feature that we call guidance that is intended to help you build better objects. The basic idea behind guidance is that if (and only if) you request it, the link-editor will issue messages suggesting better options and other changes you might make to your ld command to get better results. You can choose to take the advice, or you can disable specific types of guidance while acting on others. In some ways, this works like an experienced friend leaning over your shoulder and giving you advice — you're free to take it or leave it as you see fit, but you get nudged to do a better job than you might have otherwise. We use guidance to build the core Solaris OS, and it has proven to be useful, both in improving our objects, and in making sure that regressions don't creep back in later. In this article, I'm going to describe the evolution in thinking and design that led to the implementation of the -z guidance option, as well as give a brief description of how it works. The guidance feature issues non-fatal warnings. However, experience shows that once developers get used to ignoring warnings, it is inevitable that real problems will be lost in the noise and ignored or missed. This is why we have a zero tolerance policy against build noise in the core Solaris OS. In order to get maximum benefit from -z guidance while maintaining this policy, I added the -z fatal-warnings option at the same time. Much of the material presented here is adapted from the arc case: PSARC 2010/312 Link-editor guidance The History Of Unfortunate Link-Editor Defaults The Solaris link-editor is one of the oldest Unix commands. It stands to reason that this would be true — in order to write an operating system, you need the ability to compile and link code. The original link-editor (ld) had defaults that made sense at the time. As new features were needed, command line option switches were added to let the user use them, while maintaining backward compatibility for those who didn't. Backward compatibility is always a concern in system design, but is particularly important in the case of the tool chain (compilers, linker, and related tools), since it is a basic building block for the entire system. Over the years, applications have grown in size and complexity. Important concepts like dynamic linking that didn't exist in the original Unix system were invented. Object file formats changed. In the case of System V Release 4 Unix derivatives like Solaris, the ELF (Extensible Linking Format) was adopted. Since then, the ELF system has evolved to provide tools needed to manage today's larger and more complex environments. Features such as lazy loading, and direct bindings have been added. In an ideal world, many of these options would be defaults, with rarely used options that allow the user to turn them off. However, the reality is exactly the reverse: For backward compatibility, these features are all options that must be explicitly turned on by the user. This has led to a situation in which most applications do not take advantage of the many improvements that have been made in linking over the last 20 years. If their code seems to link and run without issue, what motivation does a developer have to read a complex manpage, absorb the information provided, choose the features that matter for their application, and apply them? Experience shows that only the most motivated and diligent programmers will make that effort. We know that most programs would be improved if we could just get you to use the various whizzy features that we provide, but the defaults conspire against us. We have long wanted to do something to make it easier for our users to use the linkers more effectively. There have been many conversations over the years regarding this issue, and how to address it. They always break down along the following lines: Change ld Defaults Since the world would be a better place the newer ld features were the defaults, why not change things to make it so? This idea is simple, elegant, and impossible. Doing so would break a large number of existing applications, including those of ISVs, big customers, and a plethora of existing open source packages. In each case, the owner of that code may choose to follow our lead and fix their code, or they may view it as an invitation to reconsider their commitment to our platform. Backward compatibility, and our installed base of working software, is one of our greatest assets, and not something to be lightly put at risk. Breaking backward compatibility at this level of the system is likely to do more harm than good. But, it sure is tempting. New Link-Editor One might create a new linker command, not called 'ld', leaving the old command as it is. The new one could use the same code as ld, but would offer only modern options, with the proper defaults for features such as direct binding. The resulting link-editor would be a pleasure to use. However, the approach is doomed to niche status. There is a vast pile of exiting code in the world built around the existing ld command, that reaches back to the 1970's. ld use is embedded in large and unknown numbers of makefiles, and is used by name by compilers that execute it. A Unix link-editor that is not named ld will not find a majority audience no matter how good it might be. Finally, a new linker command will eventually cease to be new, and will accumulate its own burden of backward compatibility issues. An Option To Make ld Do The Right Things Automatically This line of reasoning is best summarized by a CR filed in 2005, entitled 6239804 make it easier for ld(1) to do what's best The idea is to have a '-z best' option that unchains ld from its backward compatibility commitment, and allows it to turn on the "best" set of features, as determined by the authors of ld. The specific set of features enabled by -z best would be subject to change over time, as requirements change. This idea is more realistic than the other two, but was never implemented because it has some important issues that we could never answer to our satisfaction: The -z best proposal assumes that the user can turn it on, and trust it to select good options without the user needing to be aware of the options being applied. This is a fallacy. Features such as direct bindings require the user to do some analysis to ensure that the resulting program will still operate properly. A user who is willing to do the work to verify that what -z best does will be OK for their application is capable of turning on those features directly, and therefore gains little added benefit from -z best. The intent is that when a user opts into -z best, that they understand that z best is subject to sometimes incompatible evolution. Experience teaches us that this won't work. People will use this feature, the meaning of -z best will change, code that used to build will fail, and then there will be complaints and demands to retract the change. When (not if) this occurs, we will of course defend our actions, and point at the disclaimer. We'll win some of those debates, and lose others. Ultimately, we'll end up with -z best2 (-z better), or other compromises, and our goal of simplifying the world will have failed. The -z best idea rolls up a set of features that may or may not be related to each other into a unit that must be taken wholesale, or not at all. It could be that only a subset of what it does is compatible with a given application, in which case the user is expected to abandon -z best and instead set the options that apply to their application directly. In doing so, they lose one of the benefits of -z best, that if you use it, future versions of ld may choose a different set of options, and automatically improve the object through the act of rebuilding it. I drew two conclusions from the above history: For a link-editor, backward compatibility is vital. If a given command line linked your application 10 years ago, you have every reason to expect that it will link today, assuming that the libraries you're linking against are still available and compatible with their previous interfaces. For an application of any size or complexity, there is no substitute for the work involved in examining the code and determining which linker options apply and which do not. These options are largely orthogonal to each other, and it can be reasonable not to use any or all of them, depending on the situation, even in modern applications. It is a mistake to tie them together. The idea for -z guidance came from consideration of these points. By decoupling the advice from the act of taking the advice, we can retain the good aspects of -z best while avoiding its pitfalls: -z guidance gives advice, but the decision to take that advice remains with the user who must evaluate its merit and make a decision to take it or not. As such, we are free to change the specific guidance given in future releases of ld, without breaking existing applications. The only fallout from this will be some new warnings in the build output, which can be ignored or dealt with at the user's convenience. It does not couple the various features given into a single "take it or leave it" option, meaning that there will never be a need to offer "-zguidance2", or other such variants as things change over time. Guidance has the potential to be our final word on this subject. The user is given the flexibility to disable specific categories of guidance without losing the benefit of others, including those that might be added to future versions of the system. Although -z fatal-warnings stands on its own as a useful feature, it is of particular interest in combination with -z guidance. Used together, the guidance turns from advice to hard requirement: The user must either make the suggested change, or explicitly reject the advice by specifying a guidance exception token, in order to get a build. This is valuable in environments with high coding standards. ld Command Line Options The guidance effort resulted in new link-editor options for guidance and for turning warnings into fatal errors. Before I reproduce that text here, I'd like to highlight the strategic decisions embedded in the guidance feature: In order to get guidance, you have to opt in. We hope you will opt in, and believe you'll get better objects if you do, but our default mode of operation will continue as it always has, with full backward compatibility, and without judgement. Guidance suggestions always offers specific advice, and not vague generalizations. You can disable some guidance without turning off the entire feature. When you get guidance warnings, you can choose to take the advice, or you can specify a keyword to disable guidance for just that category. This allows you to get guidance for things that are useful to you, without being bothered about things that you've already considered and dismissed. As the world changes, we will add new guidance to steer you in the right direction. All such new guidance will come with a keyword that let's you turn it off. In order to facilitate building your code on different versions of Solaris, we quietly ignore any guidance keywords we don't recognize, assuming that they are intended for newer versions of the link-editor. If you want to see what guidance tokens ld does and does not recognize on your system, you can use the ld debugging feature as follows: % ld -Dargs -z guidance=foo,nodefs debug: debug: Solaris Linkers: 5.11-1.2275 debug: debug: arg[1] option=-D: option-argument: args debug: arg[2] option=-z: option-argument: guidance=foo,nodefs debug: warning: unrecognized -z guidance item: foo The -z fatal-warning option is straightforward, and generally useful in environments with strict coding standards. Note that the GNU ld already had this feature, and we accept their option names as synonyms: -z fatal-warnings | nofatal-warnings --fatal-warnings | --no-fatal-warnings The -z fatal-warnings and the --fatal-warnings option cause the link-editor to treat warnings as fatal errors. The -z nofatal-warnings and the --no-fatal-warnings option cause the link-editor to treat warnings as non-fatal. This is the default behavior. The -z guidance option is defined as follows: -z guidance[=item1,item2,...] Provide guidance messages to suggest ld options that can improve the quality of the resulting object, or which are otherwise considered to be beneficial. The specific guidance offered is subject to change over time as the system evolves. Obsolete guidance offered by older versions of ld may be dropped in new versions. Similarly, new guidance may be added to new versions of ld. Guidance therefore always represents current best practices. It is possible to enable guidance, while preventing specific guidance messages, by providing a list of item tokens, representing the class of guidance to be suppressed. In this way, unwanted advice can be suppressed without losing the benefit of other guidance. Unrecognized item tokens are quietly ignored by ld, allowing a given ld command line to be executed on a variety of older or newer versions of Solaris. The guidance offered by the current version of ld, and the item tokens used to disable these messages, are as follows. Specify Required Dependencies Dynamic executables and shared objects should explicitly define all of the dependencies they require. Guidance recommends the use of the -z defs option, should any symbol references remain unsatisfied when building dynamic objects. This guidance can be disabled with -z guidance=nodefs. Do Not Specify Non-Required Dependencies Dynamic executables and shared objects should not define any dependencies that do not satisfy the symbol references made by the dynamic object. Guidance recommends that unused dependencies be removed. This guidance can be disabled with -z guidance=nounused. Lazy Loading Dependencies should be identified for lazy loading. Guidance recommends the use of the -z lazyload option should any dependency be processed before either a -z lazyload or -z nolazyload option is encountered. This guidance can be disabled with -z guidance=nolazyload. Direct Bindings Dependencies should be referenced with direct bindings. Guidance recommends the use of the -B direct, or -z direct options should any dependency be processed before either of these options, or the -z nodirect option is encountered. This guidance can be disabled with -z guidance=nodirect. Pure Text Segment Dynamic objects should not contain relocations to non-writable, allocable sections. Guidance recommends compiling objects with Position Independent Code (PIC) should any relocations against the text segment remain, and neither the -z textwarn or -z textoff options are encountered. This guidance can be disabled with -z guidance=notext. Mapfile Syntax All mapfiles should use the version 2 mapfile syntax. Guidance recommends the use of the version 2 syntax should any mapfiles be encountered that use the version 1 syntax. This guidance can be disabled with -z guidance=nomapfile. Library Search Path Inappropriate dependencies that are encountered by ld are quietly ignored. For example, a 32-bit dependency that is encountered when generating a 64-bit object is ignored. These dependencies can result from incorrect search path settings, such as supplying an incorrect -L option. Although benign, this dependency processing is wasteful, and might hide a build problem that should be solved. Guidance recommends the removal of any inappropriate dependencies. This guidance can be disabled with -z guidance=nolibpath. In addition, -z guidance=noall can be used to entirely disable the guidance feature. See Chapter 7, Link-Editor Quick Reference, in the Linker and Libraries Guide for more information on guidance and advice for building better objects. Example The following example demonstrates how the guidance feature is intended to work. We will build a shared object that has a variety of shortcomings: Does not specify all it's dependencies Specifies dependencies it does not use Does not use direct bindings Uses a version 1 mapfile Contains relocations to the readonly allocable text (not PIC) This scenario is sadly very common — many shared objects have one or more of these issues. % cat hello.c #include <stdio.h> #include <unistd.h> void hello(void) { printf("hello user %d\n", getpid()); } % cat mapfile.v1 # This version 1 mapfile will trigger a guidance message % cc hello.c -o hello.so -G -M mapfile.v1 -lelf As you can see, the operation completes without error, resulting in a usable object. However, turning on guidance reveals a number of things that could be better: % cc hello.c -o hello.so -G -M mapfile.v1 -lelf -zguidance ld: guidance: version 2 mapfile syntax recommended: mapfile.v1 ld: guidance: -z lazyload option recommended before first dependency ld: guidance: -B direct or -z direct option recommended before first dependency Undefined first referenced symbol in file getpid hello.o (symbol belongs to implicit dependency /lib/libc.so.1) printf hello.o (symbol belongs to implicit dependency /lib/libc.so.1) ld: warning: symbol referencing errors ld: guidance: -z defs option recommended for shared objects ld: guidance: removal of unused dependency recommended: libelf.so.1 warning: Text relocation remains referenced against symbol offset in file .rodata1 (section) 0xa hello.o getpid 0x4 hello.o printf 0xf hello.o ld: guidance: position independent (PIC) code recommended for shared objects ld: guidance: see ld(1) -z guidance for more information Given the explicit advice in the above guidance messages, it is relatively easy to modify the example to do the right things: % cat mapfile.v2 # This version 2 mapfile will not trigger a guidance message $mapfile_version 2 % cc hello.c -o hello.so -Kpic -G -Bdirect -M mapfile.v2 -lc -zguidance There are situations in which the guidance does not fit the object being built. For instance, you want to build an object without direct bindings: % cc -Kpic hello.c -o hello.so -G -M mapfile.v2 -lc -zguidance ld: guidance: -B direct or -z direct option recommended before first dependency ld: guidance: see ld(1) -z guidance for more information It is easy to disable that specific guidance warning without losing the overall benefit from allowing the remainder of the guidance feature to operate: % cc -Kpic hello.c -o hello.so -G -M mapfile.v2 -lc -zguidance=nodirect Conclusions The linking guidelines enforced by the ld guidance feature correspond rather directly to our standards for building the core Solaris OS. I'm sure that comes as no surprise. It only makes sense that we would want to build our own product as well as we know how. Solaris is usually the first significant test for any new linker feature. We now enable guidance by default for all builds, and the effect has been very positive. Guidance helps us find suboptimal objects more quickly. Programmers get concrete advice for what to change instead of vague generalities. Even in the cases where we override the guidance, the makefile rules to do so serve as documentation of the fact. Deciding to use guidance is likely to cause some up front work for most code, as it forces you to consider using new features such as direct bindings. Such investigation is worthwhile, but does not come for free. However, the guidance suggestions offer a structured and straightforward way to tackle modernizing your objects, and once that work is done, for keeping them that way. The investment is often worth it, and will replay you in terms of better performance and fewer problems. I hope that you find guidance to be as useful as we have.

    Read the article

  • Why do I get "unsupported architecture" errors trying to install a Python library in OSX?

    - by Emma518
    I am trying to install a Python library in the Presto package, source http://www.cv.nrao.edu/~sransom/presto/ Using 'gmake fftfit' I get the following error: cd fftfit_src ; f2py-2.7 -c fftfit.pyf *.f running build running config_cc unifing config_cc, config, build_clib, build_ext, build commands --compiler options running config_fc unifing config_fc, config, build_clib, build_ext, build commands --fcompiler options running build_src build_src building extension "fftfit" sources creating /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx-10.9-x86_64-2.7 f2py options: [] f2py: fftfit.pyf Reading fortran codes... Reading file 'fftfit.pyf' (format:free) Post-processing... Block: fftfit Block: cprof Block: fftfit Post-processing (stage 2)... Building modules... Building module "fftfit"... Constructing wrapper function "cprof"... c,amp,pha = cprof(y,[nmax,nh]) Constructing wrapper function "fftfit"... shift,eshift,snr,esnr,b,errb,ngood = fftfit(prof,s,phi,[nmax]) Wrote C/API module "fftfit" to file "/var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx-10.9-x86_64- 2.7/fftfitmodule.c" adding '/var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx-10.9-x86_64-2.7/fortranobject.c' to sources. adding '/var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx-10.9-x86_64-2.7' to include_dirs. copying /Library/Python/2.7/site-packages/numpy-1.8.2-py2.7-macosx-10.9- intel.egg/numpy/f2py/src/fortranobject.c -> /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx-10.9-x86_64-2.7 copying /Library/Python/2.7/site-packages/numpy-1.8.2-py2.7-macosx-10.9-intel.egg/numpy/f2py/src/fortranobject.h -> /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx-10.9-x86_64-2.7 build_src: building npy-pkg config files running build_ext customize UnixCCompiler customize UnixCCompiler using build_ext customize Gnu95FCompiler Found executable /usr/local/bin/gfortran customize Gnu95FCompiler customize Gnu95FCompiler using build_ext building 'fftfit' extension compiling C sources C compiler: /usr/bin/clang -DNDEBUG -g -fwrapv -O3 -Wall -Wstrict-prototypes -arch ppc -arch i386 -arch x86_64 -g -O2 creating /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/var creating /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/var/folders creating /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/var/folders/sx creating /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp creating /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/var/folders/sx/j_l_qvys4bv00_38pfvy3m8h00 00gp/T creating /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/var/folders/sx/j_l_qvys4bv00_38pfvy3m8h00 00gp/T/tmp9MmLz8 creating /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/var/folders/sx/j_l_qvys4bv00_38pfvy3m8h00 00gp/T/tmp9MmLz8/src.macosx-10.9-x86_64-2.7 compile options: '-I/var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx-10.9- x86_64-2.7 -I/Library/Python/2.7/site-packages/numpy-1.8.2-py2.7-macosx-10.9- intel.egg/numpy/core/include - I/opt/local/Library/Frameworks/Python.framework/Versions/2.7/include/python2.7 -c' clang: /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx-10.9-x86_64- 2.7/fftfitmodule.c In file included from /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx- 10.9-x86_64-2.7/fftfitmodule.c:16: In file included from /opt/local/Library/Frameworks/Python.framework/Versions/2.7/include/python2.7/Python.h:19: In file included from /Applications/Xcode.app/Contents/Developer/Toolchains/XcodeDefault.xctoolchain/usr/bin/../lib/clang/ 5.1/include/limits.h:38: In file included from /usr/include/limits.h:63: /usr/include/sys/cdefs.h:658:2: error: Unsupported architecture #error Unsupported architecture ^ In file included from /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx- 10.9-x86_64-2.7/fftfitmodule.c:16: In file included from /opt/local/Library/Frameworks/Python.framework/Versions/2.7/include/python2.7/Python.h:19: In file included from /Applications/Xcode.app/Contents/Developer/Toolchains/XcodeDefault.xctoolchain/usr/bin/../lib/clang/ 5.1/include/limits.h:38: In file included from /usr/include/limits.h:64: /usr/include/machine/limits.h:8:2: error: architecture not supported #error architecture not supported ^ In file included from /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx- 10.9-x86_64-2.7/fftfitmodule.c:16: In file included from /opt/local/Library/Frameworks/Python.framework/Versions/2.7/include/python2.7/Python.h:33: In file included from /usr/include/stdio.h:67: In file included from /usr/include/_types.h:27: In file included from /usr/include/sys/_types.h:33: /usr/include/machine/_types.h:34:2: error: architecture not supported #error architecture not supported ^ In file included from /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx- 10.9-x86_64-2.7/fftfitmodule.c:16: In file included from /opt/local/Library/Frameworks/Python.framework/Versions/2.7/include/python2.7/Python.h:33: In file included from /usr/include/stdio.h:67: In file included from /usr/include/_types.h:27: /usr/include/sys/_types.h:94:9: error: unknown type name '__int64_t' typedef __int64_t __darwin_blkcnt_t; /* total blocks */ ^ /usr/include/sys/_types.h:95:9: error: unknown type name '__int32_t' typedef __int32_t __darwin_blksize_t; /* preferred block size */ ^ /usr/include/sys/_types.h:96:9: error: unknown type name '__int32_t' typedef __int32_t __darwin_dev_t; /* dev_t */ ^ /usr/include/sys/_types.h:99:9: error: unknown type name '__uint32_t' typedef __uint32_t __darwin_gid_t; /* [???] process and group IDs */ ^ /usr/include/sys/_types.h:100:9: error: unknown type name '__uint32_t' typedef __uint32_t __darwin_id_t; /* [XSI] pid_t, uid_t, or gid_t*/ ^ /usr/include/sys/_types.h:101:9: error: unknown type name '__uint64_t' typedef __uint64_t __darwin_ino64_t; /* [???] Used for 64 bit inodes */ ^ /usr/include/sys/_types.h:107:9: error: unknown type name '__darwin_natural_t' typedef __darwin_natural_t __darwin_mach_port_name_t; /* Used by mach */ ^ /usr/include/sys/_types.h:109:9: error: unknown type name '__uint16_t' typedef __uint16_t __darwin_mode_t; /* [???] Some file attributes */ ^ /usr/include/sys/_types.h:110:9: error: unknown type name '__int64_t' typedef __int64_t __darwin_off_t; /* [???] Used for file sizes */ ^ /usr/include/sys/_types.h:111:9: error: unknown type name '__int32_t' typedef __int32_t __darwin_pid_t; /* [???] process and group IDs */ ^ /usr/include/sys/_types.h:131:9: error: unknown type name '__uint32_t' typedef __uint32_t __darwin_sigset_t; /* [???] signal set */ ^ /usr/include/sys/_types.h:132:9: error: unknown type name '__int32_t' typedef __int32_t __darwin_suseconds_t; /* [???] microseconds */ ^ /usr/include/sys/_types.h:133:9: error: unknown type name '__uint32_t' typedef __uint32_t __darwin_uid_t; /* [???] user IDs */ ^ /usr/include/sys/_types.h:134:9: error: unknown type name '__uint32_t' typedef __uint32_t __darwin_useconds_t; /* [???] microseconds */ ^ In file included from /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx- 10.9-x86_64-2.7/fftfitmodule.c:16: In file included from /opt/local/Library/Frameworks/Python.framework/Versions/2.7/include/python2.7/Python.h:33: In file included from /usr/include/stdio.h:71: /usr/include/sys/_types/_va_list.h:31:9: error: unknown type name '__darwin_va_list'; did you mean '__builtin_va_list'? typedef __darwin_va_list va_list; ^ note: '__builtin_va_list' declared here In file included from /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx- 10.9-x86_64-2.7/fftfitmodule.c:16: In file included from /opt/local/Library/Frameworks/Python.framework/Versions/2.7/include/python2.7/Python.h:33: In file included from /usr/include/stdio.h:72: /usr/include/sys/_types/_size_t.h:30:9: error: unknown type name '__darwin_size_t'; did you mean '__darwin_ino_t'? typedef __darwin_size_t size_t; ^ /usr/include/sys/_types.h:103:26: note: '__darwin_ino_t' declared here typedef __darwin_ino64_t __darwin_ino_t; /* [???] Used for inodes */ ^ fatal error: too many errors emitted, stopping now [-ferror-limit=] 20 errors generated. In file included from /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx- 10.9-x86_64-2.7/fftfitmodule.c:16: In file included from /opt/local/Library/Frameworks/Python.framework/Versions/2.7/include/python2.7/Python.h:19: In file included from /Applications/Xcode.app/Contents/Developer/Toolchains/XcodeDefault.xctoolchain/usr/bin/../lib/clang/5.1/include/limits.h:38: In file included from /usr/include/limits.h:63: /usr/include/sys/cdefs.h:658:2: error: Unsupported architecture #error Unsupported architecture ^ In file included from /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx- 10.9-x86_64-2.7/fftfitmodule.c:16: In file included from /opt/local/Library/Frameworks/Python.framework/Versions/2.7/include/python2.7/Python.h:19: In file included from /Applications/Xcode.app/Contents/Developer/Toolchains/XcodeDefault.xctoolchain/usr/bin/../lib/clang/ 5.1/include/limits.h:38: In file included from /usr/include/limits.h:64: /usr/include/machine/limits.h:8:2: error: architecture not supported #error architecture not supported ^ In file included from /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx- 10.9-x86_64-2.7/fftfitmodule.c:16: In file included from /opt/local/Library/Frameworks/Python.framework/Versions/2.7/include/python2.7/Python.h:33: In file included from /usr/include/stdio.h:67: In file included from /usr/include/_types.h:27: In file included from /usr/include/sys/_types.h:33: /usr/include/machine/_types.h:34:2: error: architecture not supported #error architecture not supported ^ In file included from /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx- 10.9-x86_64-2.7/fftfitmodule.c:16: In file included from /opt/local/Library/Frameworks/Python.framework/Versions/2.7/include/python2.7/Python.h:33: In file included from /usr/include/stdio.h:67: In file included from /usr/include/_types.h:27: /usr/include/sys/_types.h:94:9: error: unknown type name '__int64_t' typedef __int64_t __darwin_blkcnt_t; /* total blocks */ ^ /usr/include/sys/_types.h:95:9: error: unknown type name '__int32_t' typedef __int32_t __darwin_blksize_t; /* preferred block size */ ^ /usr/include/sys/_types.h:96:9: error: unknown type name '__int32_t' typedef __int32_t __darwin_dev_t; /* dev_t */ ^ /usr/include/sys/_types.h:99:9: error: unknown type name '__uint32_t' typedef __uint32_t __darwin_gid_t; /* [???] process and group IDs */ ^ /usr/include/sys/_types.h:100:9: error: unknown type name '__uint32_t' typedef __uint32_t __darwin_id_t; /* [XSI] pid_t, uid_t, or gid_t*/ ^ /usr/include/sys/_types.h:101:9: error: unknown type name '__uint64_t' typedef __uint64_t __darwin_ino64_t; /* [???] Used for 64 bit inodes */ ^ /usr/include/sys/_types.h:107:9: error: unknown type name '__darwin_natural_t' typedef __darwin_natural_t __darwin_mach_port_name_t; /* Used by mach */ ^ /usr/include/sys/_types.h:109:9: error: unknown type name '__uint16_t' typedef __uint16_t __darwin_mode_t; /* [???] Some file attributes */ ^ /usr/include/sys/_types.h:110:9: error: unknown type name '__int64_t' typedef __int64_t __darwin_off_t; /* [???] Used for file sizes */ ^ /usr/include/sys/_types.h:111:9: error: unknown type name '__int32_t' typedef __int32_t __darwin_pid_t; /* [???] process and group IDs */ ^ /usr/include/sys/_types.h:131:9: error: unknown type name '__uint32_t' typedef __uint32_t __darwin_sigset_t; /* [???] signal set */ ^ /usr/include/sys/_types.h:132:9: error: unknown type name '__int32_t' typedef __int32_t __darwin_suseconds_t; /* [???] microseconds */ ^ /usr/include/sys/_types.h:133:9: error: unknown type name '__uint32_t' typedef __uint32_t __darwin_uid_t; /* [???] user IDs */ ^ /usr/include/sys/_types.h:134:9: error: unknown type name '__uint32_t' typedef __uint32_t __darwin_useconds_t; /* [???] microseconds */ ^ In file included from /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx-10.9-x86_64-2.7/fftfitmodule.c:16: In file included from /opt/local/Library/Frameworks/Python.framework/Versions/2.7/include/python2.7/Python.h:33: In file included from /usr/include/stdio.h:71: /usr/include/sys/_types/_va_list.h:31:9: error: unknown type name '__darwin_va_list'; did you mean '__builtin_va_list'? typedef __darwin_va_list va_list; ^ note: '__builtin_va_list' declared here In file included from /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx-10.9-x86_64-2.7/fftfitmodule.c:16: In file included from /opt/local/Library/Frameworks/Python.framework/Versions/2.7/include/python2.7/Python.h:33: In file included from /usr/include/stdio.h:72: /usr/include/sys/_types/_size_t.h:30:9: error: unknown type name '__darwin_size_t'; did you mean '__darwin_ino_t'? typedef __darwin_size_t size_t; ^ /usr/include/sys/_types.h:103:26: note: '__darwin_ino_t' declared here typedef __darwin_ino64_t __darwin_ino_t; /* [???] Used for inodes */ ^ fatal error: too many errors emitted, stopping now [-ferror-limit=] 20 errors generated. error: Command "/usr/bin/clang -DNDEBUG -g -fwrapv -O3 -Wall -Wstrict-prototypes -arch ppc -arch i386 -arch x86_64 -g -O2 -I/var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx- 10.9-x86_64-2.7 -I/Library/Python/2.7/site-packages/numpy-1.8.2-py2.7-macosx-10.9- intel.egg/numpy/core/include - I/opt/local/Library/Frameworks/Python.framework/Versions/2.7/include/python2.7 -c /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/src.macosx-10.9-x86_64-2.7/fftfitmodule.c -o /var/folders/sx/j_l_qvys4bv00_38pfvy3m8h0000gp/T/tmp9MmLz8/var/folders/sx/j_l_qvys4bv00_38pfvy3m8h00 00gp/T/tmp9MmLz8/src.macosx-10.9-x86_64-2.7/fftfitmodule.o" failed with exit status 1 Makefile:5: recipe for target 'fftfit' failed gmake: *** [fftfit] Error 1 How can I solve this architecture problem?

    Read the article

  • Generating moderately interesting images

    - by Williham Totland
    Abstract: Can you propose a mathematical-ish algorithm over a plane of pixels that will generate a moderately interesting image, preferably one that on the whole resembles something? The story thus far: Once upon a time I decided in an effort to reduce cycle waste on my (admittedly too) numerous computers, and set out to generate images in a moderately interesting fashion; using a PRNG and some clever math to create images that would, on the whole, resemble something. Or at least, that was the plan. As it turns out, clever math requires being a clever mathematician; this I am not. At some length I arrived at a method that preferred straight lines (as these are generally the components of which our world is made), perhaps too strongly. The result is mildly interesting; resembling, perhaps, city grids as such: Now for the question proper: Given the source code of this little program; can you improve upon it and propose a method that gives somewhat more interesting results? (e.g. not city grids, but perhaps faces, animals, geography, what have you) This is also meant as a sort of challenge; I suppose and as such I've set down some completely arbitrary and equally optional rules: The comments in the code says it all really. Suggestions and "solutions" should edit the algorithm itself, not the surrounding framework, except as for to fix errors that prevents the sample from compiling. The code should compile cleanly with a standard issue C compiler. (If the example provided doesn't, oops! Tell me, and I'll fix. :) The method should, though again, this is optional, not need to elicit help from your friendly neighborhood math library. Solutions should probably be deliverable by simply yanking out whatever is between the snip lines (the ones that say you should not edit above and below, respectively), with a statement to the effect of what you need to add to the preamble in particular. The code requires a C compiler and libpng to build; I'm not entirely confident that the MinGW compiler provides the necessities, but I would be surprised if it didn't. For Debian you'll want the libpng-dev package, and for Mac OS X you'll want the XCode tools.. The source code can be downloaded here. Warning: Massive code splurge incoming! // compile with gcc -o imggen -lpng imggen.c // optionally with -DITERATIONS=x, where x is an appropriate integer // If you're on a Mac or using MinGW, you may have to fiddle with the linker flags to find the library and includes. #include <stdio.h> #include <stdlib.h> #include <png.h> #ifdef ITERATIONS #define REPEAT #endif // ITERATIONS // YOU MAY CHANGE THE FOLLOWING DEFINES #define WIDTH 320 #define HEIGHT 240 // YOU MAY REPLACE THE FOLLOWING DEFINES AS APPROPRIATE #define INK 16384 void writePNG (png_bytepp imageBuffer, png_uint_32 width, png_uint_32 height, int iteration) { char *fname; asprintf(&fname, "out.%d.png", iteration); FILE *fp = fopen(fname, "wb"); if (!fp) return; png_structp png_ptr = png_create_write_struct(PNG_LIBPNG_VER_STRING, NULL, NULL, NULL); png_infop info_ptr = png_create_info_struct(png_ptr); png_init_io(png_ptr, fp); png_set_filter(png_ptr, PNG_FILTER_TYPE_DEFAULT, PNG_FILTER_NONE); png_set_compression_level(png_ptr, Z_BEST_COMPRESSION); png_set_IHDR(png_ptr, info_ptr, width, height, 8, PNG_COLOR_TYPE_GRAY, PNG_INTERLACE_NONE, PNG_COMPRESSION_TYPE_DEFAULT, PNG_FILTER_TYPE_DEFAULT); png_set_rows(png_ptr, info_ptr, imageBuffer); png_set_invert_mono(png_ptr); /// YOU MAY COMMENT OUT THIS LINE png_write_png(png_ptr, info_ptr, PNG_TRANSFORM_IDENTITY, NULL); png_destroy_write_struct(&png_ptr, &info_ptr); fclose(fp); free(fname); } int main (int argc, const char * argv[]) { png_uint_32 height = HEIGHT, width = WIDTH; int iteration = 1; #ifdef REPEAT for (iteration = 1; iteration <= ITERATIONS; iteration++) { #endif // REPEAT png_bytepp imageBuffer = malloc(sizeof(png_bytep) * height); for (png_uint_32 i = 0; i < height; i++) { imageBuffer[i] = malloc(sizeof(png_byte) * width); for (png_uint_32 j = 0; j < width; j++) { imageBuffer[i][j] = 0; } } /// CUT ACROSS THE DASHED LINES /// ------------------------------------------- /// NO EDITING ABOVE THIS LINE; EXCEPT AS NOTED int ink = INK; int x = rand() % width, y = rand() % height; int xdir = (rand() % 2)?1:-1; int ydir = (rand() % 2)?1:-1; while (ink) { imageBuffer[y][x] = 255; --ink; xdir += (rand() % 2)?(1):(-1); ydir += (rand() % 2)?(1):(-1); if (ydir > 0) { ++y; } else if (ydir < 0) { --y; } if (xdir > 0) { ++x; } else if (xdir < 0) { --x; } if (x == -1 || y == -1 || x == width || y == height || x == y && x == 0) { x = rand() % width; y = rand() % height; xdir = (rand() % 2)?1:-1; ydir = (rand() % 2)?1:-1; } } /// NO EDITING BELOW THIS LINE /// ------------------------------------------- writePNG(imageBuffer, width, height, iteration); for (png_uint_32 i = 0; i < height; i++) { free(imageBuffer[i]); } free(imageBuffer); #ifdef REPEAT } #endif // REPEAT return 0; } Note: While this question doesn't strictly speaking seem "answerable" as such; I still believe that it can give rise to some manner of "right" answer. Maybe. Happy hunting.

    Read the article

  • The Clocks on USACO

    - by philip
    I submitted my code for a question on USACO titled "The Clocks". This is the link to the question: http://ace.delos.com/usacoprob2?a=wj7UqN4l7zk&S=clocks This is the output: Compiling... Compile: OK Executing... Test 1: TEST OK [0.173 secs, 13928 KB] Test 2: TEST OK [0.130 secs, 13928 KB] Test 3: TEST OK [0.583 secs, 13928 KB] Test 4: TEST OK [0.965 secs, 13928 KB] Run 5: Execution error: Your program (`clocks') used more than the allotted runtime of 1 seconds (it ended or was stopped at 1.584 seconds) when presented with test case 5. It used 13928 KB of memory. ------ Data for Run 5 ------ 6 12 12 12 12 12 12 12 12 ---------------------------- Your program printed data to stdout. Here is the data: ------------------- time:_0.40928452 ------------------- Test 5: RUNTIME 1.5841 (13928 KB) I wrote my program so that it will print out the time taken (in seconds) for the program to complete before it exits. As can be seen, it took 0.40928452 seconds before exiting. So how the heck did the runtime end up to be 1.584 seconds? What should I do about it? This is the code if it helps: import java.io.; import java.util.; class clocks { public static void main(String[] args) throws IOException { long start = System.nanoTime(); // Use BufferedReader rather than RandomAccessFile; it's much faster BufferedReader f = new BufferedReader(new FileReader("clocks.in")); // input file name goes above PrintWriter out = new PrintWriter(new BufferedWriter(new FileWriter("clocks.out"))); // Use StringTokenizer vs. readLine/split -- lots faster int[] clock = new int[9]; for (int i = 0; i < 3; i++) { StringTokenizer st = new StringTokenizer(f.readLine()); // Get line, break into tokens clock[i * 3] = Integer.parseInt(st.nextToken()); clock[i * 3 + 1] = Integer.parseInt(st.nextToken()); clock[i * 3 + 2] = Integer.parseInt(st.nextToken()); } ArrayList validCombination = new ArrayList();; for (int i = 1; true; i++) { ArrayList combination = getPossibleCombinations(i); for (int j = 0; j < combination.size(); j++) { if (tryCombination(clock, (int[]) combination.get(j))) { validCombination.add(combination.get(j)); } } if (validCombination.size() > 0) { break; } } int [] min = (int[])validCombination.get(0); if (validCombination.size() > 1){ String minS = ""; for (int i=0; i<min.length; i++) minS += min[i]; for (int i=1; i<validCombination.size(); i++){ String tempS = ""; int [] temp = (int[])validCombination.get(i); for (int j=0; j<temp.length; j++) tempS += temp[j]; if (tempS.compareTo(minS) < 0){ minS = tempS; min = temp; } } } for (int i=0; i<min.length-1; i++) out.print(min[i] + " "); out.println(min[min.length-1]); out.close(); // close the output file long end = System.nanoTime(); System.out.println("time: " + (end-start)/1000000000.0); System.exit(0); // don't omit this! } static boolean tryCombination(int[] clock, int[] steps) { int[] temp = Arrays.copyOf(clock, clock.length); for (int i = 0; i < steps.length; i++) transform(temp, steps[i]); for (int i=0; i<temp.length; i++) if (temp[i] != 12) return false; return true; } static void transform(int[] clock, int n) { if (n == 1) { int[] clocksToChange = {0, 1, 3, 4}; add3(clock, clocksToChange); } else if (n == 2) { int[] clocksToChange = {0, 1, 2}; add3(clock, clocksToChange); } else if (n == 3) { int[] clocksToChange = {1, 2, 4, 5}; add3(clock, clocksToChange); } else if (n == 4) { int[] clocksToChange = {0, 3, 6}; add3(clock, clocksToChange); } else if (n == 5) { int[] clocksToChange = {1, 3, 4, 5, 7}; add3(clock, clocksToChange); } else if (n == 6) { int[] clocksToChange = {2, 5, 8}; add3(clock, clocksToChange); } else if (n == 7) { int[] clocksToChange = {3, 4, 6, 7}; add3(clock, clocksToChange); } else if (n == 8) { int[] clocksToChange = {6, 7, 8}; add3(clock, clocksToChange); } else if (n == 9) { int[] clocksToChange = {4, 5, 7, 8}; add3(clock, clocksToChange); } } static void add3(int[] clock, int[] position) { for (int i = 0; i < position.length; i++) { if (clock[position[i]] != 12) { clock[position[i]] += 3; } else { clock[position[i]] = 3; } } } static ArrayList getPossibleCombinations(int size) { ArrayList l = new ArrayList(); int[] current = new int[size]; for (int i = 0; i < current.length; i++) { current[i] = 1; } int[] end = new int[size]; for (int i = 0; i < end.length; i++) { end[i] = 9; } l.add(Arrays.copyOf(current, size)); while (!Arrays.equals(current, end)) { incrementWithoutRepetition(current, current.length - 1); l.add(Arrays.copyOf(current, size)); } int [][] combination = new int[l.size()][size]; for (int i=0; i<l.size(); i++) combination[i] = (int[])l.get(i); return l; } static int incrementWithoutRepetition(int[] n, int index) { if (n[index] != 9) { n[index]++; return n[index]; } else { n[index] = incrementWithoutRepetition(n, index - 1); return n[index]; } } static void p(int[] n) { for (int i = 0; i < n.length; i++) { System.out.print(n[i] + " "); } System.out.println(""); } }

    Read the article

  • GDI+ crashes when loading PNG from IStream

    - by konforce
    I wrote something to load PNG files from a custom C++ IStream via GDI+. It worked great until I ran it on Vista machines. Crashes every time. When compiled on VS 2008, I found that inserting code into the IStream::AddRef method, such as a cout, made the problem go away. When compiling with VS 2010, it still crashes regardless of that. I stripped the program down to its basics. I copied a FileStream straight from Microsoft's documentation. It can load PNGs when using Bitmap::FromFile. It can load JPEGs, GIFs, and BMPs via FromFile or FromStream. So in short: on Vista, PNG files loaded via Bitmap::FromStream crash. #pragma comment(lib, "gdiplus.lib") #include <iostream> #include <objidl.h> #include <gdiplus.h> class FileStream : public IStream { public: FileStream(HANDLE hFile) { _refcount = 1; _hFile = hFile; } ~FileStream() { if (_hFile != INVALID_HANDLE_VALUE) { ::CloseHandle(_hFile); } } public: HRESULT static OpenFile(LPCWSTR pName, IStream ** ppStream, bool fWrite) { HANDLE hFile = ::CreateFileW(pName, fWrite ? GENERIC_WRITE : GENERIC_READ, FILE_SHARE_READ, NULL, fWrite ? CREATE_ALWAYS : OPEN_EXISTING, FILE_ATTRIBUTE_NORMAL, NULL); if (hFile == INVALID_HANDLE_VALUE) return HRESULT_FROM_WIN32(GetLastError()); *ppStream = new FileStream(hFile); if(*ppStream == NULL) CloseHandle(hFile); return S_OK; } virtual HRESULT STDMETHODCALLTYPE QueryInterface(REFIID iid, void ** ppvObject) { if (iid == __uuidof(IUnknown) || iid == __uuidof(IStream) || iid == __uuidof(ISequentialStream)) { *ppvObject = static_cast<IStream*>(this); AddRef(); return S_OK; } else return E_NOINTERFACE; } virtual ULONG STDMETHODCALLTYPE AddRef(void) { return (ULONG)InterlockedIncrement(&_refcount); } virtual ULONG STDMETHODCALLTYPE Release(void) { ULONG res = (ULONG) InterlockedDecrement(&_refcount); if (res == 0) delete this; return res; } // ISequentialStream Interface public: virtual HRESULT STDMETHODCALLTYPE Read(void* pv, ULONG cb, ULONG* pcbRead) { ULONG local_pcbRead; BOOL rc = ReadFile(_hFile, pv, cb, &local_pcbRead, NULL); if (pcbRead) *pcbRead = local_pcbRead; return (rc) ? S_OK : HRESULT_FROM_WIN32(GetLastError()); } virtual HRESULT STDMETHODCALLTYPE Write(void const* pv, ULONG cb, ULONG* pcbWritten) { BOOL rc = WriteFile(_hFile, pv, cb, pcbWritten, NULL); return rc ? S_OK : HRESULT_FROM_WIN32(GetLastError()); } // IStream Interface public: virtual HRESULT STDMETHODCALLTYPE SetSize(ULARGE_INTEGER) { return E_NOTIMPL; } virtual HRESULT STDMETHODCALLTYPE CopyTo(IStream*, ULARGE_INTEGER, ULARGE_INTEGER*, ULARGE_INTEGER*) { return E_NOTIMPL; } virtual HRESULT STDMETHODCALLTYPE Commit(DWORD) { return E_NOTIMPL; } virtual HRESULT STDMETHODCALLTYPE Revert(void) { return E_NOTIMPL; } virtual HRESULT STDMETHODCALLTYPE LockRegion(ULARGE_INTEGER, ULARGE_INTEGER, DWORD) { return E_NOTIMPL; } virtual HRESULT STDMETHODCALLTYPE UnlockRegion(ULARGE_INTEGER, ULARGE_INTEGER, DWORD) { return E_NOTIMPL; } virtual HRESULT STDMETHODCALLTYPE Clone(IStream **) { return E_NOTIMPL; } virtual HRESULT STDMETHODCALLTYPE Seek(LARGE_INTEGER liDistanceToMove, DWORD dwOrigin, ULARGE_INTEGER* lpNewFilePointer) { DWORD dwMoveMethod; switch(dwOrigin) { case STREAM_SEEK_SET: dwMoveMethod = FILE_BEGIN; break; case STREAM_SEEK_CUR: dwMoveMethod = FILE_CURRENT; break; case STREAM_SEEK_END: dwMoveMethod = FILE_END; break; default: return STG_E_INVALIDFUNCTION; break; } if (SetFilePointerEx(_hFile, liDistanceToMove, (PLARGE_INTEGER) lpNewFilePointer, dwMoveMethod) == 0) return HRESULT_FROM_WIN32(GetLastError()); return S_OK; } virtual HRESULT STDMETHODCALLTYPE Stat(STATSTG* pStatstg, DWORD grfStatFlag) { if (GetFileSizeEx(_hFile, (PLARGE_INTEGER) &pStatstg->cbSize) == 0) return HRESULT_FROM_WIN32(GetLastError()); return S_OK; } private: volatile HANDLE _hFile; volatile LONG _refcount; }; #define USE_STREAM int main() { Gdiplus::GdiplusStartupInput gdiplusStartupInput; ULONG_PTR gdiplusToken; Gdiplus::GdiplusStartup(&gdiplusToken, &gdiplusStartupInput, NULL); Gdiplus::Bitmap *bmp; #ifndef USE_STREAM bmp = Gdiplus::Bitmap::FromFile(L"test.png", false); if (!bmp) { std::cerr << " Unable to open image file." << std::endl; return 1; } #else IStream *s; if (FileStream::OpenFile(L"test.png", &s, false) != S_OK) { std::cerr << "Unable to open image file." << std::endl; return 1; } bmp = Gdiplus::Bitmap::FromStream(s, false); #endif std::cout << "Image is " << bmp->GetWidth() << " by " << bmp->GetHeight() << std::endl; Gdiplus::GdiplusShutdown(gdiplusToken); #ifdef USE_STREAM s->Release(); #endif return 0; } Tracing and debugging, shows that it does make some calls to the IStream class. It crashes inside of lastResult = DllExports::GdipCreateBitmapFromStream(stream, &bitmap); from GdiPlusBitmap.h, which is a static inline wrapper over the flat API. Other than the reference counting, the only IStream methods it calls is stat (for file size), read, and seek. Call stack looks like: ntdll.dll!_DbgBreakPoint@0() + 0x1 bytes ntdll.dll!_RtlpBreakPointHeap@4() + 0x28 bytes ntdll.dll!_RtlpValidateHeapEntry@12() + 0x70a3c bytes ntdll.dll!_RtlDebugFreeHeap@12() + 0x9a bytes ntdll.dll!@RtlpFreeHeap@16() + 0x13cdd bytes ntdll.dll!_RtlFreeHeap@12() + 0x2e49 bytes kernel32.dll!_HeapFree@12() + 0x14 bytes ole32.dll!CRetailMalloc_Free() + 0x1c bytes ole32.dll!_CoTaskMemFree@4() + 0x13 bytes GdiPlus.dll!GpPngDecoder::GetImageInfo() + 0x68 bytes GdiPlus.dll!GpDecodedImage::InternalGetImageInfo() + 0x3c bytes GdiPlus.dll!GpDecodedImage::GetImageInfo() + 0x18 bytes GdiPlus.dll!CopyOnWriteBitmap::CopyOnWriteBitmap() + 0x49 bytes GdiPlus.dll!CopyOnWriteBitmap::Create() + 0x1d bytes GdiPlus.dll!GpBitmap::GpBitmap() + 0x2c bytes I was unable to find anybody else with the same problem, so I assume there's something wrong with my implementation...

    Read the article

  • Processing incorrect mac addresses from 802.11 frames with pcap

    - by Quentin Swain
    I'm working throurgh a project with pcap and wireless. Following an example posted in response to oe of my earlier questions I am trying to extract the mac addresses from wireless frames. I have created structures for the radiotap header and a basic management frame. For some reason when it comes to trying to output the mac addresses I am printing out the wrong data. When I compare to wireshark I don't see why the radio tap data is printing out correctly but the mac addresses are not. I don't see any additional padding in the hex dump that wireshark displays when i look at the packets and compare the packets that I have captured. I am somewhat famialar with c but not an expert so maybe I am not using the pointers and structures properly could someone help show me what I am doing wrong? Thanks, Quentin // main.c // MacSniffer // #include <pcap.h> #include <string.h> #include <stdlib.h> #define MAXBYTES2CAPTURE 65535 #ifdef WORDS_BIGENDIAN typedef struct frame_control { unsigned int subtype:4; /*frame subtype field*/ unsigned int protoVer:2; /*frame type field*/ unsigned int version:2; /*protocol version*/ unsigned int order:1; unsigned int protected:1; unsigned int moreDate:1; unsigned int power_management:1; unsigned int retry:1; unsigned int moreFrag:1; unsigned int fromDS:1; unsigned int toDS:1; }frame_control; struct ieee80211_radiotap_header{ u_int8_t it_version; u_int8_t it_pad; u_int16_t it_len; u_int32_t it_present; u_int64_t MAC_timestamp; u_int8_t flags; u_int8_t dataRate; u_int16_t channelfrequency; u_int16_t channFreq_pad; u_int16_t channelType; u_int16_t channType_pad; u_int8_t ssiSignal; u_int8_t ssiNoise; u_int8_t antenna; }; #else typedef struct frame_control { unsigned int protoVer:2; /* protocol version*/ unsigned int type:2; /*frame type field (Management,Control,Data)*/ unsigned int subtype:4; /* frame subtype*/ unsigned int toDS:1; /* frame coming from Distribution system */ unsigned int fromDS:1; /*frame coming from Distribution system */ unsigned int moreFrag:1; /* More fragments?*/ unsigned int retry:1; /*was this frame retransmitted*/ unsigned int powMgt:1; /*Power Management*/ unsigned int moreDate:1; /*More Date*/ unsigned int protectedData:1; /*Protected Data*/ unsigned int order:1; /*Order*/ }frame_control; struct ieee80211_radiotap_header{ u_int8_t it_version; u_int8_t it_pad; u_int16_t it_len; u_int32_t it_present; u_int64_t MAC_timestamp; u_int8_t flags; u_int8_t dataRate; u_int16_t channelfrequency; u_int16_t channelType; int ssiSignal:8; int ssiNoise:8; }; #endif struct wi_frame { u_int16_t fc; u_int16_t wi_duration; u_int8_t wi_add1[6]; u_int8_t wi_add2[6]; u_int8_t wi_add3[6]; u_int16_t wi_sequenceControl; // u_int8_t wi_add4[6]; //unsigned int qosControl:2; //unsigned int frameBody[23124]; }; void processPacket(u_char *arg, const struct pcap_pkthdr* pkthdr, const u_char* packet) { int i= 0, *counter = (int *) arg; struct ieee80211_radiotap_header *rh =(struct ieee80211_radiotap_header *)packet; struct wi_frame *fr= (struct wi_frame *)(packet + rh->it_len); u_char *ptr; //printf("Frame Type: %d",fr->wi_fC->type); printf("Packet count: %d\n", ++(*counter)); printf("Received Packet Size: %d\n", pkthdr->len); if(rh->it_version != NULL) { printf("Radiotap Version: %d\n",rh->it_version); } if(rh->it_pad!=NULL) { printf("Radiotap Pad: %d\n",rh->it_pad); } if(rh->it_len != NULL) { printf("Radiotap Length: %d\n",rh->it_len); } if(rh->it_present != NULL) { printf("Radiotap Present: %c\n",rh->it_present); } if(rh->MAC_timestamp != NULL) { printf("Radiotap Timestamp: %u\n",rh->MAC_timestamp); } if(rh->dataRate != NULL) { printf("Radiotap Data Rate: %u\n",rh->dataRate); } if(rh->channelfrequency != NULL) { printf("Radiotap Channel Freq: %u\n",rh->channelfrequency); } if(rh->channelType != NULL) { printf("Radiotap Channel Type: %06x\n",rh->channelType); } if(rh->ssiSignal != NULL) { printf("Radiotap SSI signal: %d\n",rh->ssiSignal); } if(rh->ssiNoise != NULL) { printf("Radiotap SSI Noise: %d\n",rh->ssiNoise); } ptr = fr->wi_add1; int k= 6; printf("Destination Address:"); do{ printf("%s%X",(k==6)?" ":":",*ptr++); } while(--k>0); printf("\n"); ptr = fr->wi_add2; k=0; printf("Source Address:"); do{ printf("%s%X",(k==6)?" ":":",*ptr++); }while(--k>0); printf("\n"); ptr = fr->wi_add3; k=0; do{ printf("%s%X",(k==6)?" ":":",*ptr++); } while(--k>0); printf("\n"); /* for(int j = 0; j < 23124;j++) { if(fr->frameBody[j]!= NULL) { printf("%x",fr->frameBody[j]); } } */ for (i = 0;i<pkthdr->len;i++) { if(isprint(packet[i +rh->it_len])) { printf("%c",packet[i + rh->it_len]); } else{printf(".");} //print newline after each section of the packet if((i%16 ==0 && i!=0) ||(i==pkthdr->len-1)) { printf("\n"); } } return; } int main(int argc, char** argv) { int count = 0; pcap_t* descr = NULL; char errbuf[PCAP_ERRBUF_SIZE], *device = NULL; struct bpf_program fp; char filter[]="wlan broadcast"; const u_char* packet; memset(errbuf,0,PCAP_ERRBUF_SIZE); device = argv[1]; if(device == NULL) { fprintf(stdout,"Supply a device name "); } descr = pcap_create(device,errbuf); pcap_set_rfmon(descr,1); pcap_set_promisc(descr,1); pcap_set_snaplen(descr,30); pcap_set_timeout(descr,10000); pcap_activate(descr); int dl =pcap_datalink(descr); printf("The Data Link type is %s",pcap_datalink_val_to_name(dl)); //pcap_dispatch(descr,MAXBYTES2CAPTURE,1,512,errbuf); //Open device in promiscuous mode //descr = pcap_open_live(device,MAXBYTES2CAPTURE,1,512,errbuf); /* if(pcap_compile(descr,&fp,filter,0,PCAP_NETMASK_UNKNOWN)==-1) { fprintf(stderr,"Error compiling filter\n"); exit(1); } if(pcap_setfilter(descr,&fp)==-1) { fprintf(stderr,"Error setting filter\n"); exit(1); } */ pcap_loop(descr,0, processPacket, (u_char *) &count); return 0; }

    Read the article

  • Higher order function « filter » in C++

    - by Red Hyena
    Hi all. I wanted to write a higher order function filter with C++. The code I have come up with so far is as follows: #include <iostream> #include <string> #include <functional> #include <algorithm> #include <vector> #include <list> #include <iterator> using namespace std; bool isOdd(int const i) { return i % 2 != 0; } template < template <class, class> class Container, class Predicate, class Allocator, class A > Container<A, Allocator> filter(Container<A, Allocator> const & container, Predicate const & pred) { Container<A, Allocator> filtered(container); container.erase(remove_if(filtered.begin(), filtered.end(), pred), filtered.end()); return filtered; } int main() { int const a[] = {23, 12, 78, 21, 97, 64}; vector<int const> const v(a, a + 6); vector<int const> const filtered = filter(v, isOdd); copy(filtered.begin(), filtered.end(), ostream_iterator<int const>(cout, " ")); } However on compiling this code, I get the following error messages that I am unable to understand and hence get rid of: /usr/include/c++/4.3/ext/new_allocator.h: In instantiation of ‘__gnu_cxx::new_allocator<const int>’: /usr/include/c++/4.3/bits/allocator.h:84: instantiated from ‘std::allocator<const int>’ /usr/include/c++/4.3/bits/stl_vector.h:75: instantiated from ‘std::_Vector_base<const int, std::allocator<const int> >’ /usr/include/c++/4.3/bits/stl_vector.h:176: instantiated from ‘std::vector<const int, std::allocator<const int> >’ Filter.cpp:29: instantiated from here /usr/include/c++/4.3/ext/new_allocator.h:82: error: ‘const _Tp* __gnu_cxx::new_allocator<_Tp>::address(const _Tp&) const [with _Tp = const int]’ cannot be overloaded /usr/include/c++/4.3/ext/new_allocator.h:79: error: with ‘_Tp* __gnu_cxx::new_allocator<_Tp>::address(_Tp&) const [with _Tp = const int]’ Filter.cpp: In function ‘Container<A, Allocator> filter(const Container<A, Allocator>&, const Predicate&) [with Container = std::vector, Predicate = bool ()(int), Allocator = std::allocator<const int>, A = const int]’: Filter.cpp:30: instantiated from here Filter.cpp:23: error: passing ‘const std::vector<const int, std::allocator<const int> >’ as ‘this’ argument of ‘__gnu_cxx::__normal_iterator<typename std::_Vector_base<_Tp, _Alloc>::_Tp_alloc_type::pointer, std::vector<_Tp, _Alloc> > std::vector<_Tp, _Alloc>::erase(__gnu_cxx::__normal_iterator<typename std::_Vector_base<_Tp, _Alloc>::_Tp_alloc_type::pointer, std::vector<_Tp, _Alloc> >, __gnu_cxx::__normal_iterator<typename std::_Vector_base<_Tp, _Alloc>::_Tp_alloc_type::pointer, std::vector<_Tp, _Alloc> >) [with _Tp = const int, _Alloc = std::allocator<const int>]’ discards qualifiers /usr/include/c++/4.3/bits/stl_algo.h: In function ‘_FIter std::remove_if(_FIter, _FIter, _Predicate) [with _FIter = __gnu_cxx::__normal_iterator<const int*, std::vector<const int, std::allocator<const int> > >, _Predicate = bool (*)(int)]’: Filter.cpp:23: instantiated from ‘Container<A, Allocator> filter(const Container<A, Allocator>&, const Predicate&) [with Container = std::vector, Predicate = bool ()(int), Allocator = std::allocator<const int>, A = const int]’ Filter.cpp:30: instantiated from here /usr/include/c++/4.3/bits/stl_algo.h:821: error: assignment of read-only location ‘__result.__gnu_cxx::__normal_iterator<_Iterator, _Container>::operator* [with _Iterator = const int*, _Container = std::vector<const int, std::allocator<const int> >]()’ /usr/include/c++/4.3/ext/new_allocator.h: In member function ‘void __gnu_cxx::new_allocator<_Tp>::deallocate(_Tp*, size_t) [with _Tp = const int]’: /usr/include/c++/4.3/bits/stl_vector.h:150: instantiated from ‘void std::_Vector_base<_Tp, _Alloc>::_M_deallocate(_Tp*, size_t) [with _Tp = const int, _Alloc = std::allocator<const int>]’ /usr/include/c++/4.3/bits/stl_vector.h:136: instantiated from ‘std::_Vector_base<_Tp, _Alloc>::~_Vector_base() [with _Tp = const int, _Alloc = std::allocator<const int>]’ /usr/include/c++/4.3/bits/stl_vector.h:286: instantiated from ‘std::vector<_Tp, _Alloc>::vector(_InputIterator, _InputIterator, const _Alloc&) [with _InputIterator = const int*, _Tp = const int, _Alloc = std::allocator<const int>]’ Filter.cpp:29: instantiated from here /usr/include/c++/4.3/ext/new_allocator.h:98: error: invalid conversion from ‘const void*’ to ‘void*’ /usr/include/c++/4.3/ext/new_allocator.h:98: error: initializing argument 1 of ‘void operator delete(void*)’ /usr/include/c++/4.3/bits/stl_algobase.h: In function ‘_OI std::__copy_move_a(_II, _II, _OI) [with bool _IsMove = false, _II = const int*, _OI = const int*]’: /usr/include/c++/4.3/bits/stl_algobase.h:435: instantiated from ‘_OI std::__copy_move_a2(_II, _II, _OI) [with bool _IsMove = false, _II = __gnu_cxx::__normal_iterator<const int*, std::vector<const int, std::allocator<const int> > >, _OI = __gnu_cxx::__normal_iterator<const int*, std::vector<const int, std::allocator<const int> > >]’ /usr/include/c++/4.3/bits/stl_algobase.h:466: instantiated from ‘_OI std::copy(_II, _II, _OI) [with _II = __gnu_cxx::__normal_iterator<const int*, std::vector<const int, std::allocator<const int> > >, _OI = __gnu_cxx::__normal_iterator<const int*, std::vector<const int, std::allocator<const int> > >]’ /usr/include/c++/4.3/bits/vector.tcc:136: instantiated from ‘__gnu_cxx::__normal_iterator<typename std::_Vector_base<_Tp, _Alloc>::_Tp_alloc_type::pointer, std::vector<_Tp, _Alloc> > std::vector<_Tp, _Alloc>::erase(__gnu_cxx::__normal_iterator<typename std::_Vector_base<_Tp, _Alloc>::_Tp_alloc_type::pointer, std::vector<_Tp, _Alloc> >, __gnu_cxx::__normal_iterator<typename std::_Vector_base<_Tp, _Alloc>::_Tp_alloc_type::pointer, std::vector<_Tp, _Alloc> >) [with _Tp = const int, _Alloc = std::allocator<const int>]’ Filter.cpp:23: instantiated from ‘Container<A, Allocator> filter(const Container<A, Allocator>&, const Predicate&) [with Container = std::vector, Predicate = bool ()(int), Allocator = std::allocator<const int>, A = const int]’ Filter.cpp:30: instantiated from here /usr/include/c++/4.3/bits/stl_algobase.h:396: error: no matching function for call to ‘std::__copy_move<false, true, std::random_access_iterator_tag>::__copy_m(const int*&, const int*&, const int*&)’ Please tell me what I am doing wrong here and what is the correct way to achieve the kind of higher order polymorphism I want. Thanks.

    Read the article

  • Edit Contact code worked in 1.6 but doesn't work on Droid 2.1?

    - by user225405
    Hi All, I had some fairly simple code in my app to invoke Edit Contact activity on a known good contact index that worked in Android 1.6 but is broken for me now in Android 2.1 on the Droid. I built a sample activity/app 'EdCon' to show this: package com.jbh; import android.app.Activity; import android.content.Intent; import android.net.Uri; import android.os.Bundle; public class EdCon extends Activity { /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); // Build an intent to edit a known good contact index Intent i; i = new Intent(Intent.ACTION_EDIT); i.setData(Uri.parse("content://contacts/people/10")); startActivity(i); } } When I run this on my G1 running 1.6 it works as expected i.e. brings up the Edit Contact screen for the known index and then I can hit BACK to return to "Hello World, EdCon". When I run this on the Droid under 2.1 I get the following: 05-07 15:35:57.787: INFO/ActivityManager(1013): Starting activity: Intent { act=android.intent.action.MAIN cat=[android.intent.category.LAUNCHER] flg=0x10000000 cmp=com.jbh/.EdCon } 05-07 15:35:57.826: DEBUG/AndroidRuntime(13780): Shutting down VM 05-07 15:35:57.826: DEBUG/dalvikvm(13780): DestroyJavaVM waiting for non-daemon threads to exit 05-07 15:35:57.928: DEBUG/dalvikvm(13780): DestroyJavaVM shutting VM down 05-07 15:35:57.928: DEBUG/dalvikvm(13780): HeapWorker thread shutting down 05-07 15:35:57.928: DEBUG/dalvikvm(13780): HeapWorker thread has shut down 05-07 15:35:57.928: DEBUG/jdwp(13780): JDWP shutting down net... 05-07 15:35:57.928: DEBUG/jdwp(13780): Got wake-up signal, bailing out of select 05-07 15:35:57.928: INFO/dalvikvm(13780): Debugger has detached; object registry had 1 entries 05-07 15:35:57.928: DEBUG/dalvikvm(13780): VM cleaning up 05-07 15:35:57.935: INFO/ActivityManager(1013): Start proc com.jbh for activity com.jbh/.EdCon: pid=13802 uid=10052 gids={1015} 05-07 15:35:57.967: ERROR/AndroidRuntime(13780): ERROR: thread attach failed 05-07 15:35:58.053: INFO/ActivityThread(13792): Publishing provider com.android.vending.SuggestionsProvider: com.android.vending.SuggestionsProvider 05-07 15:35:58.154: INFO/dalvikvm(13802): Debugger thread not active, ignoring DDM send (t=0x41504e4d l=38) 05-07 15:35:58.209: DEBUG/dalvikvm(13780): LinearAlloc 0x0 used 639500 of 5242880 (12%) 05-07 15:35:58.365: INFO/dalvikvm(13802): Debugger thread not active, ignoring DDM send (t=0x41504e4d l=18) 05-07 15:35:58.639: INFO/ActivityManager(1013): Starting activity: Intent { act=android.intent.action.EDIT dat=content://contacts/people/10 cmp=com.android.contacts/.ui.EditContactActivity } 05-07 15:35:58.975: DEBUG/dalvikvm(13137): GC freed 2902 objects / 166768 bytes in 61ms 05-07 15:35:59.100: DEBUG/vending(13792): com.android.vending.LocalDbSyncService.run(): Syncing local DB with package manager... 05-07 15:35:59.100: DEBUG/vending(13792): com.android.vending.LocalDbSyncService.syncLocalDbWithPackageManager(): No INSTALLING or UNINSTALLING assets. 05-07 15:35:59.115: INFO/ActivityManager(1013): Displayed activity com.android.contacts/.ui.EditContactActivity: 387 ms (total 1296 ms) 05-07 15:35:59.185: DEBUG/Sources(13137): Creating external source for type=com.facebook.auth.login, packageName=com.facebook.katana 05-07 15:35:59.225: DEBUG/vending(13792): com.android.vending.LocalDbSyncService.run(): Syncing done. 05-07 15:35:59.232: WARN/dalvikvm(13137): threadid=27: thread exiting with uncaught exception (group=0x4001b180) 05-07 15:35:59.232: ERROR/AndroidRuntime(13137): Uncaught handler: thread AsyncTask #1 exiting due to uncaught exception 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): java.lang.RuntimeException: An error occured while executing doInBackground() 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.os.AsyncTask$3.done(AsyncTask.java:200) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.util.concurrent.FutureTask$Sync.innerSetException(FutureTask.java:273) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.util.concurrent.FutureTask.setException(FutureTask.java:124) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:307) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.util.concurrent.FutureTask.run(FutureTask.java:137) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1068) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:561) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.lang.Thread.run(Thread.java:1096) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): Caused by: android.database.sqlite.SQLiteException: no such column: raw_contact_id: , while compiling: SELECT account_name, account_type, sourceid, version, dirty, data_id, res_package, mimetype, data1, data2, data3, data4, data5, data6, data7, data8, data9, data10, data11, data12, data13, data14, data15, data_sync1, data_sync2, data_sync3, data_sync4, _id, is_primary, is_super_primary, data_version, group_sourceid, sync1, sync2, sync3, sync4, deleted, contact_id, starred, is_restricted FROM contact_entities_view WHERE (1) AND (raw_contact_id=10) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.database.sqlite.SQLiteProgram.native_compile(Native Method) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.database.sqlite.SQLiteProgram.compile(SQLiteProgram.java:110) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.database.sqlite.SQLiteProgram.(SQLiteProgram.java:59) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.database.sqlite.SQLiteQuery.(SQLiteQuery.java:49) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.database.sqlite.SQLiteDirectCursorDriver.query(SQLiteDirectCursorDriver.java:49) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.database.sqlite.SQLiteDatabase.rawQueryWithFactory(SQLiteDatabase.java:1221) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.database.sqlite.SQLiteQueryBuilder.query(SQLiteQueryBuilder.java:316) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.providers.contacts.ContactsProvider2.query(ContactsProvider2.java:3850) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.providers.contacts.ContactsProvider2.query(ContactsProvider2.java:3840) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.providers.contacts.ContactsProvider2$RawContactsEntityIterator.(ContactsProvider2.java:4498) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.providers.contacts.ContactsProvider2.queryEntities(ContactsProvider2.java:4751) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.content.ContentProvider$Transport.queryEntities(ContentProvider.java:140) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.content.ContentProviderClient.queryEntities(ContentProviderClient.java:98) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.content.ContentResolver.queryEntities(ContentResolver.java:296) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.contacts.model.EntitySet.fromQuery(EntitySet.java:72) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.contacts.ui.EditContactActivity$QueryEntitiesTask.doInBackground(EditContactActivity.java:191) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.contacts.ui.EditContactActivity$QueryEntitiesTask.doInBackground(EditContactActivity.java:154) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at com.android.contacts.util.WeakAsyncTask.doInBackground(WeakAsyncTask.java:45) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at android.os.AsyncTask$2.call(AsyncTask.java:185) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:305) 05-07 15:35:59.295: ERROR/AndroidRuntime(13137): ... 4 more 05-07 15:35:59.303: INFO/Process(1013): Sending signal. PID: 13137 SIG: 3 05-07 15:35:59.303: INFO/dalvikvm(13137): threadid=7: reacting to signal 3 05-07 15:35:59.303: ERROR/dalvikvm(13137): Unable to open stack trace file '/data/anr/traces.txt': Permission denied 05-07 15:35:59.506: INFO/DumpStateReceiver(1013): Added state dump to 1 crashes 05-07 15:36:07.053: DEBUG/dalvikvm(12901): GC freed 389 objects / 25056 bytes in 145ms 05-07 15:36:17.287: DEBUG/dalvikvm(11649): GC freed 154 objects / 6816 bytes in 136ms 05-07 15:36:22.365: DEBUG/dalvikvm(13574): GC freed 348 objects / 67848 bytes in 112ms 05-07 15:36:27.451: DEBUG/dalvikvm(11836): GC freed 267 objects / 17432 bytes in 65ms 05-07 15:36:32.553: DEBUG/dalvikvm(12757): GC freed 1888 objects / 92440 bytes in 67ms 05-07 15:36:38.803: INFO/power(1013): * set_screen_state 0 05-07 15:36:38.813: DEBUG/SurfaceFlinger(1013): About to give-up screen, flinger = 0x114c30 05-07 15:36:38.826: DEBUG/Sensors(1013): using accelerometer (name=accelerometer) 05-07 15:36:38.834: DEBUG/PhoneWindow(13137): couldn't save which view has focus because the focused view android.widget.ScrollView@44883558 has no id. 05-07 15:36:38.865: DEBUG/WifiService(1013): ACTION_SCREEN_OFF 05-07 15:36:38.889: DEBUG/WifiService(1013): setting ACTION_DEVICE_IDLE timer for 900000ms 05-07 15:36:44.107: DEBUG/dalvikvm(1013): GC freed 7351 objects / 521440 bytes in 130ms 05-07 15:36:49.373: DEBUG/dalvikvm(13553): GC freed 321 objects / 12056 bytes in 102ms The no such column: raw_contact_id: looks like the issue but I'm not sure how or why that would happen or what it means. Any help appreciated! [email protected]

    Read the article

  • Adding a second table in a database

    - by MB
    Hi everyone. I used the code provided by the NoteExample from the developers doc to create a database. Now I want to add a second table to store different data. I simply "copied" the given code, but when I try to insert into the new table I get an error saying: "0ERROR/Database(370): android.database.sqlite.SQLiteException: no such table: routes: , while compiling: INSERT INTO routes(line, arrival, duration, start) VALUES(?, ?, ?, ?);" Can someone please take quick look at my DbAdapter class and give me a hint or a solution? I really don't see any problem. my code compiles without any errors.. thanks in advance! CODE: import static android.provider.BaseColumns._ID; import android.content.ContentValues; import android.content.Context; import android.database.Cursor; import android.database.SQLException; import android.database.sqlite.SQLiteDatabase; import android.database.sqlite.SQLiteOpenHelper; import android.util.Log; public class DbAdapter { public static final String KEY_FROM = "title"; public static final String KEY_TO = "body"; public static final String KEY_ROWID = "_id"; public static final String KEY_START = "start"; public static final String KEY_ARRIVAL = "arrival"; public static final String KEY_LINE = "line"; public static final String KEY_DURATION = "duration"; private static final String DATABASE_NAME = "data"; private static final String DATABASE_NOTESTABLE = "notes"; private static final String DATABASE_ROUTESTABLE = "routes"; private static final String TAG = "DbAdapter"; private DatabaseHelper mDbHelper; private SQLiteDatabase mDb; /** * Database creation sql statement */ private static final String DATABASE_CREATE_NOTES = "create table notes (_id integer primary key autoincrement, " + "title text not null, body text not null)"; private static final String DATABASE_CREATE_ROUTES = "create table routes (_id integer primary key autoincrement, " + "start text not null, arrival text not null, " + "line text not null, duration text not null);"; private static final int DATABASE_VERSION = 2; private final Context mCtx; private static class DatabaseHelper extends SQLiteOpenHelper { DatabaseHelper(Context context) { super(context, DATABASE_NAME, null, DATABASE_VERSION); } @Override public void onCreate(SQLiteDatabase db) { db.execSQL(DATABASE_CREATE_NOTES); Log.d(TAG, "created notes table"); db.execSQL(DATABASE_CREATE_ROUTES); //CREATE LOKALTABLE db.execSQL("CREATE TABLE " + DATABASE_ROUTESTABLE + " " + "(" + _ID + " INTEGER PRIMARY KEY AUTOINCREMENT, " + KEY_START + " TEXT NOT NULL, " + KEY_ARRIVAL + " TEXT NOT NULL, " + KEY_LINE + " TEXT NOT NULL, " + KEY_DURATION + " TEXT NOT NULL"); Log.d(TAG, "created routes table"); } @Override public void onUpgrade(SQLiteDatabase db, int oldVersion, int newVersion) { Log.w(TAG, "Upgrading database from version " + oldVersion + " to " + newVersion + ", which will destroy all old data"); db.execSQL("DROP TABLE IF EXISTS notes"); onCreate(db); } } /** * Constructor - takes the context to allow the database to be * opened/created * * @param ctx the Context within which to work */ public DbAdapter(Context ctx) { this.mCtx = ctx; } /** * Open the notes database. If it cannot be opened, try to create a new * instance of the database. If it cannot be created, throw an exception to * signal the failure * * @return this (self reference, allowing this to be chained in an * initialization call) * @throws SQLException if the database could be neither opened or created */ public DbAdapter open() throws SQLException { mDbHelper = new DatabaseHelper(mCtx); mDb = mDbHelper.getWritableDatabase(); return this; } public void close() { mDbHelper.close(); } /** * Create a new note using the title and body provided. If the note is * successfully created return the new rowId for that note, otherwise return * a -1 to indicate failure. * * @param title the title of the note * @param body the body of the note * @return rowId or -1 if failed */ public long createNote(String title, String body) { ContentValues initialValues = new ContentValues(); initialValues.put(KEY_FROM, title); initialValues.put(KEY_TO, body); return mDb.insert(DATABASE_NOTESTABLE, null, initialValues); } /** * Create a new route using the title and body provided. If the route is * successfully created return the new rowId for that route, otherwise return * a -1 to indicate failure. * * @param start the start time of the route * @param arrival the arrival time of the route * @param line the line number of the route * @param duration the routes duration * @return rowId or -1 if failed */ public long createRoute(String start, String arrival, String line, String duration){ ContentValues initialValues = new ContentValues(); initialValues.put(KEY_START, start); initialValues.put(KEY_ARRIVAL, arrival); initialValues.put(KEY_LINE, line); initialValues.put(KEY_DURATION, duration); return mDb.insert(DATABASE_ROUTESTABLE, null, initialValues); } /** * Delete the note with the given rowId * * @param rowId id of note to delete * @return true if deleted, false otherwise */ public boolean deleteNote(long rowId) { return mDb.delete(DATABASE_NOTESTABLE, KEY_ROWID + "=" + rowId, null) > 0; } /** * Return a Cursor over the list of all notes in the database * * @return Cursor over all notes */ public Cursor fetchAllNotes() { return mDb.query(DATABASE_NOTESTABLE, new String[] {KEY_ROWID, KEY_FROM, KEY_TO}, null, null, null, null, null); } /** * Return a Cursor over the list of all routes in the database * * @return Cursor over all routes */ public Cursor fetchAllRoutes() { return mDb.query(DATABASE_ROUTESTABLE, new String[] {KEY_ROWID, KEY_START, KEY_ARRIVAL, KEY_LINE, KEY_DURATION}, null, null, null, null, null); } /** * Return a Cursor positioned at the note that matches the given rowId * * @param rowId id of note to retrieve * @return Cursor positioned to matching note, if found * @throws SQLException if note could not be found/retrieved */ public Cursor fetchNote(long rowId) throws SQLException { Cursor mCursor = mDb.query(true, DATABASE_NOTESTABLE, new String[] {KEY_ROWID, KEY_FROM, KEY_TO}, KEY_ROWID + "=" + rowId, null, null, null, null, null); if (mCursor != null) { mCursor.moveToFirst(); } return mCursor; } /** * Return a Cursor positioned at the route that matches the given rowId * * @param rowId id of route to retrieve * @return Cursor positioned to matching route * @throws SQLException if note could not be found/retrieved */ public Cursor fetchRoute(long rowId) throws SQLException { Cursor mCursor = mDb.query(true, DATABASE_ROUTESTABLE, new String[] {KEY_ROWID, KEY_START, KEY_ARRIVAL, KEY_LINE, KEY_DURATION}, KEY_ROWID + "=" + rowId, null, null, null, null, null); if (mCursor != null) { mCursor.moveToFirst(); } return mCursor; } /** * Update the note using the details provided. The note to be updated is * specified using the rowId, and it is altered to use the title and body * values passed in * * @param rowId id of note to update * @param title value to set note title to * @param body value to set note body to * @return true if the note was successfully updated, false otherwise */ public boolean updateNote(long rowId, String title, String body) { ContentValues args = new ContentValues(); args.put(KEY_FROM, title); args.put(KEY_TO, body); return mDb.update(DATABASE_NOTESTABLE, args, KEY_ROWID + "=" + rowId, null) > 0; } }

    Read the article

  • Strange (Undefined?) Behavior of Free in C

    - by Chris Cirefice
    This is really strange... and I can't debug it (tried for about two hours, debugger starts going haywire after a while...). Anyway, I'm trying to do something really simple: Free an array of strings. The array is in the form: char **myStrings. The array elements are initialized as: myString[index] = malloc(strlen(word)); myString[index] = word; and I'm calling a function like this: free_memory(myStrings, size); where size is the length of the array (I know this is not the problem, I tested it extensively and everything except this function is working). free_memory looks like this: void free_memory(char **list, int size) { for (int i = 0; i < size; i ++) { free(list[i]); } free(list); } Now here comes the weird part. if (size> strlen(list[i])) then the program crashes. For example, imagine that I have a list of strings that looks something like this: myStrings[0] = "Some"; myStrings[1] = "random"; myStrings[2] = "strings"; And thus the length of this array is 3. If I pass this to my free_memory function, strlen(myStrings[0]) > 3 (4 3), and the program crashes. However, if I change myStrings[0] to be "So" instead, then strlen(myStrings[0]) < 3 (2 < 3) and the program does not crash. So it seems to me that free(list[i]) is actually going through the char[] that is at that location and trying to free each character, which I imagine is undefined behavior. The only reason I say this is because I can play around with the size of the first element of myStrings and make the program crash whenever I feel like it, so I'm assuming that this is the problem area. Note: I did try to debug this by stepping through the function that calls free_memory, noting any weird values and such, but the moment I step into the free_memory function, the debugger crashes, so I'm not really sure what is going on. Nothing is out of the ordinary until I enter the function, then the world explodes. Another note: I also posted the shortened version of the source for this program (not too long; Pastebin) here. I am compiling on MinGW with the c99 flag on. PS - I just thought of this. I am indeed passing numUniqueWords to the free function, and I know that this does not actually free the entire piece of memory that I allocated. I've called it both ways, that's not the issue. And I left it how I did because that is the way that I will be calling it after I get it to work in the first place, I need to revise some of my logic in that function. Source, as per request (on-site): #include <stdio.h> #include <string.h> #include <ctype.h> #include <stdlib.h> #include "words.h" int getNumUniqueWords(char text[], int size); int main(int argc, char* argv[]) { setvbuf(stdout, NULL, 4, _IONBF); // For Eclipse... stupid bug. --> does NOT affect the program, just the output to console! int nbr_words; char text[] = "Some - \"text, a stdin\". We'll have! also repeat? We'll also have a repeat!"; int length = sizeof(text); nbr_words = getNumUniqueWords(text, length); return 0; } void free_memory(char **list, int size) { for (int i = 0; i < size; i ++) { // You can see that printing the values is fine, as long as free is not called. // When free is called, the program will crash if (size > strlen(list[i])) //printf("Wanna free value %d w/len of %d: %s\n", i, strlen(list[i]), list[i]); free(list[i]); } free(list); } int getNumUniqueWords(char text[], int length) { int numTotalWords = 0; char *word; printf("Length: %d characters\n", length); char totalWords[length]; strcpy(totalWords, text); word = strtok(totalWords, " ,.-!?()\"0123456789"); while (word != NULL) { numTotalWords ++; printf("%s\n", word); word = strtok(NULL, " ,.-!?()\"0123456789"); } printf("Looks like we counted %d total words\n\n", numTotalWords); char *uniqueWords[numTotalWords]; char *tempWord; int wordAlreadyExists = 0; int numUniqueWords = 0; char totalWordsCopy[length]; strcpy(totalWordsCopy, text); for (int i = 0; i < numTotalWords; i++) { uniqueWords[i] = NULL; } // Tokenize until all the text is consumed. word = strtok(totalWordsCopy, " ,.-!?()\"0123456789"); while (word != NULL) { // Look through the word list for the current token. for (int j = 0; j < numTotalWords; j ++) { // Just for clarity, no real meaning. tempWord = uniqueWords[j]; // The word list is either empty or the current token is not in the list. if (tempWord == NULL) { break; } //printf("Comparing (%s) with (%s)\n", tempWord, word); // If the current token is the same as the current element in the word list, mark and break if (strcmp(tempWord, word) == 0) { printf("\nDuplicate: (%s)\n\n", word); wordAlreadyExists = 1; break; } } // Word does not exist, add it to the array. if (!wordAlreadyExists) { uniqueWords[numUniqueWords] = malloc(strlen(word)); uniqueWords[numUniqueWords] = word; numUniqueWords ++; printf("Unique: %s\n", word); } // Reset flags and continue. wordAlreadyExists = 0; word = strtok(NULL, " ,.-!?()\"0123456789"); } // Print out the array just for funsies - make sure it's working properly. for (int x = 0; x <numUniqueWords; x++) { printf("Unique list %d: %s\n", x, uniqueWords[x]); } printf("\nNumber of unique words: %d\n\n", numUniqueWords); // Right below is where things start to suck. free_memory(uniqueWords, numUniqueWords); return numUniqueWords; }

    Read the article

  • Node.js Adventure - When Node Flying in Wind

    - by Shaun
    In the first post of this series I mentioned some popular modules in the community, such as underscore, async, etc.. I also listed a module named “Wind (zh-CN)”, which is created by one of my friend, Jeff Zhao (zh-CN). Now I would like to use a separated post to introduce this module since I feel it brings a new async programming style in not only Node.js but JavaScript world. If you know or heard about the new feature in C# 5.0 called “async and await”, or you learnt F#, you will find the “Wind” brings the similar async programming experience in JavaScript. By using “Wind”, we can write async code that looks like the sync code. The callbacks, async stats and exceptions will be handled by “Wind” automatically and transparently.   What’s the Problem: Dense “Callback” Phobia Let’s firstly back to my second post in this series. As I mentioned in that post, when we wanted to read some records from SQL Server we need to open the database connection, and then execute the query. In Node.js all IO operation are designed as async callback pattern which means when the operation was done, it will invoke a function which was taken from the last parameter. For example the database connection opening code would be like this. 1: sql.open(connectionString, function(error, conn) { 2: if(error) { 3: // some error handling code 4: } 5: else { 6: // connection opened successfully 7: } 8: }); And then if we need to query the database the code would be like this. It nested in the previous function. 1: sql.open(connectionString, function(error, conn) { 2: if(error) { 3: // some error handling code 4: } 5: else { 6: // connection opened successfully 7: conn.queryRaw(command, function(error, results) { 8: if(error) { 9: // failed to execute this command 10: } 11: else { 12: // records retrieved successfully 13: } 14: }; 15: } 16: }); Assuming if we need to copy some data from this database to another then we need to open another connection and execute the command within the function under the query function. 1: sql.open(connectionString, function(error, conn) { 2: if(error) { 3: // some error handling code 4: } 5: else { 6: // connection opened successfully 7: conn.queryRaw(command, function(error, results) { 8: if(error) { 9: // failed to execute this command 10: } 11: else { 12: // records retrieved successfully 13: target.open(targetConnectionString, function(error, t_conn) { 14: if(error) { 15: // connect failed 16: } 17: else { 18: t_conn.queryRaw(copy_command, function(error, results) { 19: if(error) { 20: // copy failed 21: } 22: else { 23: // and then, what do you want to do now... 24: } 25: }; 26: } 27: }; 28: } 29: }; 30: } 31: }); This is just an example. In the real project the logic would be more complicated. This means our application might be messed up and the business process will be fragged by many callback functions. I would like call this “Dense Callback Phobia”. This might be a challenge how to make code straightforward and easy to read, something like below. 1: try 2: { 3: // open source connection 4: var s_conn = sqlConnect(s_connectionString); 5: // retrieve data 6: var results = sqlExecuteCommand(s_conn, s_command); 7: 8: // open target connection 9: var t_conn = sqlConnect(t_connectionString); 10: // prepare the copy command 11: var t_command = getCopyCommand(results); 12: // execute the copy command 13: sqlExecuteCommand(s_conn, t_command); 14: } 15: catch (ex) 16: { 17: // error handling 18: }   What’s the Problem: Sync-styled Async Programming Similar as the previous problem, the callback-styled async programming model makes the upcoming operation as a part of the current operation, and mixed with the error handling code. So it’s very hard to understand what on earth this code will do. And since Node.js utilizes non-blocking IO mode, we cannot invoke those operations one by one, as they will be executed concurrently. For example, in this post when I tried to copy the records from Windows Azure SQL Database (a.k.a. WASD) to Windows Azure Table Storage, if I just insert the data into table storage one by one and then print the “Finished” message, I will see the message shown before the data had been copied. This is because all operations were executed at the same time. In order to make the copy operation and print operation executed synchronously I introduced a module named “async” and the code was changed as below. 1: async.forEach(results.rows, 2: function (row, callback) { 3: var resource = { 4: "PartitionKey": row[1], 5: "RowKey": row[0], 6: "Value": row[2] 7: }; 8: client.insertEntity(tableName, resource, function (error) { 9: if (error) { 10: callback(error); 11: } 12: else { 13: console.log("entity inserted."); 14: callback(null); 15: } 16: }); 17: }, 18: function (error) { 19: if (error) { 20: error["target"] = "insertEntity"; 21: res.send(500, error); 22: } 23: else { 24: console.log("all done."); 25: res.send(200, "Done!"); 26: } 27: }); It ensured that the “Finished” message will be printed when all table entities had been inserted. But it cannot promise that the records will be inserted in sequence. It might be another challenge to make the code looks like in sync-style? 1: try 2: { 3: forEach(row in rows) { 4: var entity = { /* ... */ }; 5: tableClient.insert(tableName, entity); 6: } 7:  8: console.log("Finished"); 9: } 10: catch (ex) { 11: console.log(ex); 12: }   How “Wind” Helps “Wind” is a JavaScript library which provides the control flow with plain JavaScript for asynchronous programming (and more) without additional pre-compiling steps. It’s available in NPM so that we can install it through “npm install wind”. Now let’s create a very simple Node.js application as the example. This application will take some website URLs from the command arguments and tried to retrieve the body length and print them in console. Then at the end print “Finish”. I’m going to use “request” module to make the HTTP call simple so I also need to install by the command “npm install request”. The code would be like this. 1: var request = require("request"); 2:  3: // get the urls from arguments, the first two arguments are `node.exe` and `fetch.js` 4: var args = process.argv.splice(2); 5:  6: // main function 7: var main = function() { 8: for(var i = 0; i < args.length; i++) { 9: // get the url 10: var url = args[i]; 11: // send the http request and try to get the response and body 12: request(url, function(error, response, body) { 13: if(!error && response.statusCode == 200) { 14: // log the url and the body length 15: console.log( 16: "%s: %d.", 17: response.request.uri.href, 18: body.length); 19: } 20: else { 21: // log error 22: console.log(error); 23: } 24: }); 25: } 26: 27: // finished 28: console.log("Finished"); 29: }; 30:  31: // execute the main function 32: main(); Let’s execute this application. (I made them in multi-lines for better reading.) 1: node fetch.js 2: "http://www.igt.com/us-en.aspx" 3: "http://www.igt.com/us-en/games.aspx" 4: "http://www.igt.com/us-en/cabinets.aspx" 5: "http://www.igt.com/us-en/systems.aspx" 6: "http://www.igt.com/us-en/interactive.aspx" 7: "http://www.igt.com/us-en/social-gaming.aspx" 8: "http://www.igt.com/support.aspx" Below is the output. As you can see the finish message was printed at the beginning, and the pages’ length retrieved in a different order than we specified. This is because in this code the request command, console logging command are executed asynchronously and concurrently. Now let’s introduce “Wind” to make them executed in order, which means it will request the websites one by one, and print the message at the end.   First of all we need to import the “Wind” package and make sure the there’s only one global variant named “Wind”, and ensure it’s “Wind” instead of “wind”. 1: var Wind = require("wind");   Next, we need to tell “Wind” which code will be executed asynchronously so that “Wind” can control the execution process. In this case the “request” operation executed asynchronously so we will create a “Task” by using a build-in helps function in “Wind” named Wind.Async.Task.create. 1: var requestBodyLengthAsync = function(url) { 2: return Wind.Async.Task.create(function(t) { 3: request(url, function(error, response, body) { 4: if(error || response.statusCode != 200) { 5: t.complete("failure", error); 6: } 7: else { 8: var data = 9: { 10: uri: response.request.uri.href, 11: length: body.length 12: }; 13: t.complete("success", data); 14: } 15: }); 16: }); 17: }; The code above created a “Task” from the original request calling code. In “Wind” a “Task” means an operation will be finished in some time in the future. A “Task” can be started by invoke its start() method, but no one knows when it actually will be finished. The Wind.Async.Task.create helped us to create a task. The only parameter is a function where we can put the actual operation in, and then notify the task object it’s finished successfully or failed by using the complete() method. In the code above I invoked the request method. If it retrieved the response successfully I set the status of this task as “success” with the URL and body length. If it failed I set this task as “failure” and pass the error out.   Next, we will change the main() function. In “Wind” if we want a function can be controlled by Wind we need to mark it as “async”. This should be done by using the code below. 1: var main = eval(Wind.compile("async", function() { 2: })); When the application is running, Wind will detect “eval(Wind.compile(“async”, function” and generate an anonymous code from the body of this original function. Then the application will run the anonymous code instead of the original one. In our example the main function will be like this. 1: var main = eval(Wind.compile("async", function() { 2: for(var i = 0; i < args.length; i++) { 3: try 4: { 5: var result = $await(requestBodyLengthAsync(args[i])); 6: console.log( 7: "%s: %d.", 8: result.uri, 9: result.length); 10: } 11: catch (ex) { 12: console.log(ex); 13: } 14: } 15: 16: console.log("Finished"); 17: })); As you can see, when I tried to request the URL I use a new command named “$await”. It tells Wind, the operation next to $await will be executed asynchronously, and the main thread should be paused until it finished (or failed). So in this case, my application will be pause when the first response was received, and then print its body length, then try the next one. At the end, print the finish message.   Finally, execute the main function. The full code would be like this. 1: var request = require("request"); 2: var Wind = require("wind"); 3:  4: var args = process.argv.splice(2); 5:  6: var requestBodyLengthAsync = function(url) { 7: return Wind.Async.Task.create(function(t) { 8: request(url, function(error, response, body) { 9: if(error || response.statusCode != 200) { 10: t.complete("failure", error); 11: } 12: else { 13: var data = 14: { 15: uri: response.request.uri.href, 16: length: body.length 17: }; 18: t.complete("success", data); 19: } 20: }); 21: }); 22: }; 23:  24: var main = eval(Wind.compile("async", function() { 25: for(var i = 0; i < args.length; i++) { 26: try 27: { 28: var result = $await(requestBodyLengthAsync(args[i])); 29: console.log( 30: "%s: %d.", 31: result.uri, 32: result.length); 33: } 34: catch (ex) { 35: console.log(ex); 36: } 37: } 38: 39: console.log("Finished"); 40: })); 41:  42: main().start();   Run our new application. At the beginning we will see the compiled and generated code by Wind. Then we can see the pages were requested one by one, and at the end the finish message was printed. Below is the code Wind generated for us. As you can see the original code, the output code were shown. 1: // Original: 2: function () { 3: for(var i = 0; i < args.length; i++) { 4: try 5: { 6: var result = $await(requestBodyLengthAsync(args[i])); 7: console.log( 8: "%s: %d.", 9: result.uri, 10: result.length); 11: } 12: catch (ex) { 13: console.log(ex); 14: } 15: } 16: 17: console.log("Finished"); 18: } 19:  20: // Compiled: 21: /* async << function () { */ (function () { 22: var _builder_$0 = Wind.builders["async"]; 23: return _builder_$0.Start(this, 24: _builder_$0.Combine( 25: _builder_$0.Delay(function () { 26: /* var i = 0; */ var i = 0; 27: /* for ( */ return _builder_$0.For(function () { 28: /* ; i < args.length */ return i < args.length; 29: }, function () { 30: /* ; i ++) { */ i ++; 31: }, 32: /* try { */ _builder_$0.Try( 33: _builder_$0.Delay(function () { 34: /* var result = $await(requestBodyLengthAsync(args[i])); */ return _builder_$0.Bind(requestBodyLengthAsync(args[i]), function (result) { 35: /* console.log("%s: %d.", result.uri, result.length); */ console.log("%s: %d.", result.uri, result.length); 36: return _builder_$0.Normal(); 37: }); 38: }), 39: /* } catch (ex) { */ function (ex) { 40: /* console.log(ex); */ console.log(ex); 41: return _builder_$0.Normal(); 42: /* } */ }, 43: null 44: ) 45: /* } */ ); 46: }), 47: _builder_$0.Delay(function () { 48: /* console.log("Finished"); */ console.log("Finished"); 49: return _builder_$0.Normal(); 50: }) 51: ) 52: ); 53: /* } */ })   How Wind Works Someone may raise a big concern when you find I utilized “eval” in my code. Someone may assume that Wind utilizes “eval” to execute some code dynamically while “eval” is very low performance. But I would say, Wind does NOT use “eval” to run the code. It only use “eval” as a flag to know which code should be compiled at runtime. When the code was firstly been executed, Wind will check and find “eval(Wind.compile(“async”, function”. So that it knows this function should be compiled. Then it utilized parse-js to analyze the inner JavaScript and generated the anonymous code in memory. Then it rewrite the original code so that when the application was running it will use the anonymous one instead of the original one. Since the code generation was done at the beginning of the application was started, in the future no matter how long our application runs and how many times the async function was invoked, it will use the generated code, no need to generate again. So there’s no significant performance hurt when using Wind.   Wind in My Previous Demo Let’s adopt Wind into one of my previous demonstration and to see how it helps us to make our code simple, straightforward and easy to read and understand. In this post when I implemented the functionality that copied the records from my WASD to table storage, the logic would be like this. 1, Open database connection. 2, Execute a query to select all records from the table. 3, Recreate the table in Windows Azure table storage. 4, Create entities from each of the records retrieved previously, and then insert them into table storage. 5, Finally, show message as the HTTP response. But as the image below, since there are so many callbacks and async operations, it’s very hard to understand my logic from the code. Now let’s use Wind to rewrite our code. First of all, of course, we need the Wind package. Then we need to include the package files into project and mark them as “Copy always”. Add the Wind package into the source code. Pay attention to the variant name, you must use “Wind” instead of “wind”. 1: var express = require("express"); 2: var async = require("async"); 3: var sql = require("node-sqlserver"); 4: var azure = require("azure"); 5: var Wind = require("wind"); Now we need to create some async functions by using Wind. All async functions should be wrapped so that it can be controlled by Wind which are open database, retrieve records, recreate table (delete and create) and insert entity in table. Below are these new functions. All of them are created by using Wind.Async.Task.create. 1: sql.openAsync = function (connectionString) { 2: return Wind.Async.Task.create(function (t) { 3: sql.open(connectionString, function (error, conn) { 4: if (error) { 5: t.complete("failure", error); 6: } 7: else { 8: t.complete("success", conn); 9: } 10: }); 11: }); 12: }; 13:  14: sql.queryAsync = function (conn, query) { 15: return Wind.Async.Task.create(function (t) { 16: conn.queryRaw(query, function (error, results) { 17: if (error) { 18: t.complete("failure", error); 19: } 20: else { 21: t.complete("success", results); 22: } 23: }); 24: }); 25: }; 26:  27: azure.recreateTableAsync = function (tableName) { 28: return Wind.Async.Task.create(function (t) { 29: client.deleteTable(tableName, function (error, successful, response) { 30: console.log("delete table finished"); 31: client.createTableIfNotExists(tableName, function (error, successful, response) { 32: console.log("create table finished"); 33: if (error) { 34: t.complete("failure", error); 35: } 36: else { 37: t.complete("success", null); 38: } 39: }); 40: }); 41: }); 42: }; 43:  44: azure.insertEntityAsync = function (tableName, entity) { 45: return Wind.Async.Task.create(function (t) { 46: client.insertEntity(tableName, entity, function (error, entity, response) { 47: if (error) { 48: t.complete("failure", error); 49: } 50: else { 51: t.complete("success", null); 52: } 53: }); 54: }); 55: }; Then in order to use these functions we will create a new function which contains all steps for data copying. 1: var copyRecords = eval(Wind.compile("async", function (req, res) { 2: try { 3: } 4: catch (ex) { 5: console.log(ex); 6: res.send(500, "Internal error."); 7: } 8: })); Let’s execute steps one by one with the “$await” keyword introduced by Wind so that it will be invoked in sequence. First is to open the database connection. 1: var copyRecords = eval(Wind.compile("async", function (req, res) { 2: try { 3: // connect to the windows azure sql database 4: var conn = $await(sql.openAsync(connectionString)); 5: console.log("connection opened"); 6: } 7: catch (ex) { 8: console.log(ex); 9: res.send(500, "Internal error."); 10: } 11: })); Then retrieve all records from the database connection. 1: var copyRecords = eval(Wind.compile("async", function (req, res) { 2: try { 3: // connect to the windows azure sql database 4: var conn = $await(sql.openAsync(connectionString)); 5: console.log("connection opened"); 6: // retrieve all records from database 7: var results = $await(sql.queryAsync(conn, "SELECT * FROM [Resource]")); 8: console.log("records selected. count = %d", results.rows.length); 9: } 10: catch (ex) { 11: console.log(ex); 12: res.send(500, "Internal error."); 13: } 14: })); After recreated the table, we need to create the entities and insert them into table storage. 1: var copyRecords = eval(Wind.compile("async", function (req, res) { 2: try { 3: // connect to the windows azure sql database 4: var conn = $await(sql.openAsync(connectionString)); 5: console.log("connection opened"); 6: // retrieve all records from database 7: var results = $await(sql.queryAsync(conn, "SELECT * FROM [Resource]")); 8: console.log("records selected. count = %d", results.rows.length); 9: if (results.rows.length > 0) { 10: // recreate the table 11: $await(azure.recreateTableAsync(tableName)); 12: console.log("table created"); 13: // insert records in table storage one by one 14: for (var i = 0; i < results.rows.length; i++) { 15: var entity = { 16: "PartitionKey": results.rows[i][1], 17: "RowKey": results.rows[i][0], 18: "Value": results.rows[i][2] 19: }; 20: $await(azure.insertEntityAsync(tableName, entity)); 21: console.log("entity inserted"); 22: } 23: } 24: } 25: catch (ex) { 26: console.log(ex); 27: res.send(500, "Internal error."); 28: } 29: })); Finally, send response back to the browser. 1: var copyRecords = eval(Wind.compile("async", function (req, res) { 2: try { 3: // connect to the windows azure sql database 4: var conn = $await(sql.openAsync(connectionString)); 5: console.log("connection opened"); 6: // retrieve all records from database 7: var results = $await(sql.queryAsync(conn, "SELECT * FROM [Resource]")); 8: console.log("records selected. count = %d", results.rows.length); 9: if (results.rows.length > 0) { 10: // recreate the table 11: $await(azure.recreateTableAsync(tableName)); 12: console.log("table created"); 13: // insert records in table storage one by one 14: for (var i = 0; i < results.rows.length; i++) { 15: var entity = { 16: "PartitionKey": results.rows[i][1], 17: "RowKey": results.rows[i][0], 18: "Value": results.rows[i][2] 19: }; 20: $await(azure.insertEntityAsync(tableName, entity)); 21: console.log("entity inserted"); 22: } 23: // send response 24: console.log("all done"); 25: res.send(200, "All done!"); 26: } 27: } 28: catch (ex) { 29: console.log(ex); 30: res.send(500, "Internal error."); 31: } 32: })); If we compared with the previous code we will find now it became more readable and much easy to understand. It’s very easy to know what this function does even though without any comments. When user go to URL “/was/copyRecords” we will execute the function above. The code would be like this. 1: app.get("/was/copyRecords", function (req, res) { 2: copyRecords(req, res).start(); 3: }); And below is the logs printed in local compute emulator console. As we can see the functions executed one by one and then finally the response back to me browser.   Scaffold Functions in Wind Wind provides not only the async flow control and compile functions, but many scaffold methods as well. We can build our async code more easily by using them. I’m going to introduce some basic scaffold functions here. In the code above I created some functions which wrapped from the original async function such as open database, create table, etc.. All of them are very similar, created a task by using Wind.Async.Task.create, return error or result object through Task.complete function. In fact, Wind provides some functions for us to create task object from the original async functions. If the original async function only has a callback parameter, we can use Wind.Async.Binding.fromCallback method to get the task object directly. For example the code below returned the task object which wrapped the file exist check function. 1: var Wind = require("wind"); 2: var fs = require("fs"); 3:  4: fs.existsAsync = Wind.Async.Binding.fromCallback(fs.exists); In Node.js a very popular async function pattern is that, the first parameter in the callback function represent the error object, and the other parameters is the return values. In this case we can use another build-in function in Wind named Wind.Async.Binding.fromStandard. For example, the open database function can be created from the code below. 1: sql.openAsync = Wind.Async.Binding.fromStandard(sql.open); 2:  3: /* 4: sql.openAsync = function (connectionString) { 5: return Wind.Async.Task.create(function (t) { 6: sql.open(connectionString, function (error, conn) { 7: if (error) { 8: t.complete("failure", error); 9: } 10: else { 11: t.complete("success", conn); 12: } 13: }); 14: }); 15: }; 16: */ When I was testing the scaffold functions under Wind.Async.Binding I found for some functions, such as the Azure SDK insert entity function, cannot be processed correctly. So I personally suggest writing the wrapped method manually.   Another scaffold method in Wind is the parallel tasks coordination. In this example, the steps of open database, retrieve records and recreated table should be invoked one by one, but it can be executed in parallel when copying data from database to table storage. In Wind there’s a scaffold function named Task.whenAll which can be used here. Task.whenAll accepts a list of tasks and creates a new task. It will be returned only when all tasks had been completed, or any errors occurred. For example in the code below I used the Task.whenAll to make all copy operation executed at the same time. 1: var copyRecordsInParallel = eval(Wind.compile("async", function (req, res) { 2: try { 3: // connect to the windows azure sql database 4: var conn = $await(sql.openAsync(connectionString)); 5: console.log("connection opened"); 6: // retrieve all records from database 7: var results = $await(sql.queryAsync(conn, "SELECT * FROM [Resource]")); 8: console.log("records selected. count = %d", results.rows.length); 9: if (results.rows.length > 0) { 10: // recreate the table 11: $await(azure.recreateTableAsync(tableName)); 12: console.log("table created"); 13: // insert records in table storage in parallal 14: var tasks = new Array(results.rows.length); 15: for (var i = 0; i < results.rows.length; i++) { 16: var entity = { 17: "PartitionKey": results.rows[i][1], 18: "RowKey": results.rows[i][0], 19: "Value": results.rows[i][2] 20: }; 21: tasks[i] = azure.insertEntityAsync(tableName, entity); 22: } 23: $await(Wind.Async.Task.whenAll(tasks)); 24: // send response 25: console.log("all done"); 26: res.send(200, "All done!"); 27: } 28: } 29: catch (ex) { 30: console.log(ex); 31: res.send(500, "Internal error."); 32: } 33: })); 34:  35: app.get("/was/copyRecordsInParallel", function (req, res) { 36: copyRecordsInParallel(req, res).start(); 37: });   Besides the task creation and coordination, Wind supports the cancellation solution so that we can send the cancellation signal to the tasks. It also includes exception solution which means any exceptions will be reported to the caller function.   Summary In this post I introduced a Node.js module named Wind, which created by my friend Jeff Zhao. As you can see, different from other async library and framework, adopted the idea from F# and C#, Wind utilizes runtime code generation technology to make it more easily to write async, callback-based functions in a sync-style way. By using Wind there will be almost no callback, and the code will be very easy to understand. Currently Wind is still under developed and improved. There might be some problems but the author, Jeff, should be very happy and enthusiastic to learn your problems, feedback, suggestion and comments. You can contact Jeff by - Email: [email protected] - Group: https://groups.google.com/d/forum/windjs - GitHub: https://github.com/JeffreyZhao/wind/issues   Source code can be download here.   Hope this helps, Shaun All documents and related graphics, codes are provided "AS IS" without warranty of any kind. Copyright © Shaun Ziyan Xu. This work is licensed under the Creative Commons License.

    Read the article

< Previous Page | 75 76 77 78 79 80  | Next Page >