Search Results

Search found 945 results on 38 pages for 'avishek kumar'.

Page 8/38 | < Previous Page | 4 5 6 7 8 9 10 11 12 13 14 15  | Next Page >

  • How do I get Catalyst 11.10 with ATI Radeon Mobility HD 5470 working on an HP DV7?

    - by S Kumar
    I have a HP DV7 with a HD 5470 512M card. Installation of the Catalyst 11.10 is repeatedly failing on a fresh install of Ubuntu 11.10. Catalyst 11.8 proprietary drivers were working well with Ubuntu 11.04. I have tried installing directly from the .run and generating the distribution specific packages. Nothing has worked. After installation which goes through successfully, the system hangs on reboot after the flashing dots. I have to replace the /etc/X11/xorg.conf to get the X working. I have followed instructions as per the http://wiki.cchtml.com/index.php/Main_Page wiki. Request for support to ATI/AMD gives the response that this model is unsupported on Linux by HP :). Updated 14-Nov I have reverted back to the open source drivers which work well enough for me.

    Read the article

  • Object of type 'customObject' cannot be converted to type 'customObject'.

    - by Phani Kumar PV
    i am receiving the follwing error when i am invoking a custom object "Object of type 'customObject' cannot be converted to type 'customObject'." Following is the scenario when i am getting the error i am invoking a method in a dll dynamically. Load an assembly CreateInstance.... calling MethodInfo.Invoke() passing int, string as a parameter for my method is working fine = No exceptions are thrown. But if I try and pass a one of my own custom class objects as a parameter, then I get an ArgumentException exception, and it is not either an ArgumentOutOfRangeException or ArgumentNullException. "Object of type 'customObject' cannot be converted to type 'customObject'." I am doing this in a web application. The class file containing the method is in a different proj . also the custom object is a sepearte class in the same file. there is no such thing called a static aseembly in my code. I am trying to invoke a webmethod dynamically. this webmethod is having the customObject type as an input parameter. So when i invoke the webmethod i am dynamically creating the proxy assembly and all. From the same assembly i am trying to create an instance of the cusotm object assinging the values to its properties and then passing this object as a parameter and invoking the method. everything is dynamic and nothing is created static.. :( add reference is not used. Following is a sample code i tried to create it public static object CallWebService(string webServiceAsmxUrl, string serviceName, string methodName, object[] args) { System.Net.WebClient client = new System.Net.WebClient(); //-Connect To the web service using (System.IO.Stream stream = client.OpenRead(webServiceAsmxUrl + "?wsdl")) { //--Now read the WSDL file describing a service. ServiceDescription description = ServiceDescription.Read(stream); ///// LOAD THE DOM ///////// //--Initialize a service description importer. ServiceDescriptionImporter importer = new ServiceDescriptionImporter(); importer.ProtocolName = "Soap12"; // Use SOAP 1.2. importer.AddServiceDescription(description, null, null); //--Generate a proxy client. importer.Style = ServiceDescriptionImportStyle.Client; //--Generate properties to represent primitive values. importer.CodeGenerationOptions = System.Xml.Serialization.CodeGenerationOptions.GenerateProperties; //--Initialize a Code-DOM tree into which we will import the service. CodeNamespace nmspace = new CodeNamespace(); CodeCompileUnit unit1 = new CodeCompileUnit(); unit1.Namespaces.Add(nmspace); //--Import the service into the Code-DOM tree. This creates proxy code //--that uses the service. ServiceDescriptionImportWarnings warning = importer.Import(nmspace, unit1); if (warning == 0) //--If zero then we are good to go { //--Generate the proxy code CodeDomProvider provider1 = CodeDomProvider.CreateProvider("CSharp"); //--Compile the assembly proxy with the appropriate references string[] assemblyReferences = new string[5] { "System.dll", "System.Web.Services.dll", "System.Web.dll", "System.Xml.dll", "System.Data.dll" }; CompilerParameters parms = new CompilerParameters(assemblyReferences); CompilerResults results = provider1.CompileAssemblyFromDom(parms, unit1); //-Check For Errors if (results.Errors.Count > 0) { StringBuilder sb = new StringBuilder(); foreach (CompilerError oops in results.Errors) { sb.AppendLine("========Compiler error============"); sb.AppendLine(oops.ErrorText); } throw new System.ApplicationException("Compile Error Occured calling webservice. " + sb.ToString()); } //--Finally, Invoke the web service method Type foundType = null; Type[] types = results.CompiledAssembly.GetTypes(); foreach (Type type in types) { if (type.BaseType == typeof(System.Web.Services.Protocols.SoapHttpClientProtocol)) { Console.WriteLine(type.ToString()); foundType = type; } } object wsvcClass = results.CompiledAssembly.CreateInstance(foundType.ToString()); MethodInfo mi = wsvcClass.GetType().GetMethod(methodName); return mi.Invoke(wsvcClass, args); } else { return null; } } } I cant find anything static being done by me. any help is greatly appreciated. Regards, Phani Kumar PV

    Read the article

  • How to set BackGround color to a divider in JSplitPane

    - by Sunil Kumar Sahoo
    I have created a divider in JSplitPane. I am unable to set the color of divider. I want to set the color of divider. please help me how to set color of that divider import javax.swing.; import java.awt.; import java.awt.event.*; public class SplitPaneDemo { JFrame frame; JPanel left, right; JSplitPane pane; int lastDividerLocation = -1; public static void main(String[] args) { SplitPaneDemo demo = new SplitPaneDemo(); demo.makeFrame(); demo.frame.addWindowListener(new WindowAdapter() { public void windowClosing(WindowEvent e) { System.exit(0); } }); demo.frame.show(); } public JFrame makeFrame() { frame = new JFrame(); // Create a horizontal split pane. pane = new JSplitPane(JSplitPane.HORIZONTAL_SPLIT); left = new JPanel(); left.setBackground(Color.red); pane.setLeftComponent(left); right = new JPanel(); right.setBackground(Color.green); pane.setRightComponent(right); JButton showleft = new JButton("Left"); showleft.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); if (pane.isShowing()) { lastDividerLocation = pane.getDividerLocation(); } c.remove(pane); c.remove(left); c.remove(right); c.add(left, BorderLayout.CENTER); c.validate(); c.repaint(); } }); JButton showright = new JButton("Right"); showright.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); if (pane.isShowing()) { lastDividerLocation = pane.getDividerLocation(); } c.remove(pane); c.remove(left); c.remove(right); c.add(right, BorderLayout.CENTER); c.validate(); c.repaint(); } }); JButton showboth = new JButton("Both"); showboth.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); c.remove(pane); c.remove(left); c.remove(right); pane.setLeftComponent(left); pane.setRightComponent(right); c.add(pane, BorderLayout.CENTER); if (lastDividerLocation >= 0) { pane.setDividerLocation(lastDividerLocation); } c.validate(); c.repaint(); } }); JPanel buttons = new JPanel(); buttons.setLayout(new GridBagLayout()); buttons.add(showleft); buttons.add(showright); buttons.add(showboth); frame.getContentPane().add(buttons, BorderLayout.NORTH); pane.setPreferredSize(new Dimension(400, 300)); frame.getContentPane().add(pane, BorderLayout.CENTER); frame.pack(); pane.setDividerLocation(0.5); return frame; } } Thanks Sunil kumar Sahoo

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • SIM to OIM Migration: A How-to Guide to Avoid Costly Mistakes (SDG Corporation)

    - by Darin Pendergraft
    In the fall of 2012, Oracle launched a major upgrade to its IDM portfolio: the 11gR2 release.  11gR2 had four major focus areas: More simplified and customizable user experience Support for cloud, mobile, and social applications Extreme scalability Clear upgrade path For SUN migration customers, it is critical to develop and execute a clearly defined plan prior to beginning this process.  The plan should include initiation and discovery, assessment and analysis, future state architecture, review and collaboration, and gap analysis.  To help better understand your upgrade choices, SDG, an Oracle partner has developed a series of three whitepapers focused on SUN Identity Manager (SIM) to Oracle Identity Manager (OIM) migration. In the second of this series on SUN Identity Manager (SIM) to Oracle Identity Manager (OIM) migration, Santosh Kumar Singh from SDG  discusses the proper steps that should be taken during the planning-to-post implementation phases to ensure a smooth transition from SIM to OIM. Read the whitepaper for Part 2: Download Part 2 from SDGC.com In the last of this series of white papers, Santosh will talk about Identity and Access Management best practices and how these need to be considered when going through with an OIM migration. If you have not taken the opportunity, please read the first in this series which discusses the Migration Approach, Methodology, and Tools for you to consider when planning a migration from SIM to OIM. Read the white paper for part 1: Download Part 1 from SDGC.com About the Author: Santosh Kumar Singh Identity and Access Management (IAM) Practice Leader Santosh, in his capacity as SDG Identity and Access Management (IAM) Practice Leader, has direct senior management responsibility for the firm's strategy, planning, competency building, and engagement deliverance for this Practice. He brings over 12+ years of extensive IT, business, and project management and delivery experience, primarily within enterprise directory, single sign-on (SSO) application, and federated identity services, provisioning solutions, role and password management, and security audit and enterprise blueprint. Santosh possesses strong architecture and implementation expertise in all areas within these technologies and has repeatedly lead teams in successfully deploying complex technical solutions. About SDG: SDG Corporation empowers forward thinking companies to strategize their future, realize their vision, and minimize their IT risk. SDG distinguishes itself by offering flexible business models to fit their clients’ needs; faster time-to-market with its pre-built solutions and frameworks; a broad-based foundation of domain experts, and deep program management expertise. (www.sdgc.com)

    Read the article

  • Pourquoi réinventer la roue quand il y a Runnable ? La startup ambitionne de devenir le « YouTube du Code »

    Pourquoi réinventer la roue quand il y a Runnable ? La startup ambitionne de devenir le « YouTube du Code » Runnable, qui a récemment été lancé par une startup du même nom basée à Palo Alto avec pour objectif la facilitation de la découverte et de la réutilisation de portions de code, a annoncé qu'elle a soulevé une levée de fonds de 2 millions de dollars grâce à la participation de Sierra Ventures, Resolute VC, AngelPad et 500 startups.Yash Kumar Directeur Général et co-fondateur de la start-up...

    Read the article

  • SQLAuthority News – SQL Server 2012 Upgrade Technical Guide – A Comprehensive Whitepaper – (454 pages – 9 MB)

    - by pinaldave
    Microsoft has just released SQL Server 2012 Upgrade Technical Guide. This guide is very comprehensive and covers the subject of upgrade in-depth. This is indeed a helpful detailed white paper. Even writing a summary of this white paper would take over 100 pages. This further proves that SQL Server 2012 is quite an important release from Microsoft. This white paper discusses how to upgrade from SQL Server 2008/R2 to SQL Server 2012. I love how it starts with the most interesting and basic discussion of upgrade strategies: 1) In-place upgrades, 2) Side by side upgrade, 3) One-server, and 4) Two-server. This whitepaper is not just pure theory but is also an excellent source for some tips and tricks. Here is an example of a good tip from the paper: “If you want to upgrade just one database from a legacy instance of SQL Server and not upgrade the other databases on the server, use the side-by-side upgrade method instead of the in-place method.” There are so many trivia, tips and tricks that make creating the list seems humanly impossible given a short period of time. My friend Vinod Kumar, an SQL Server expert, wrote a very interesting article on SQL Server 2012 Upgrade before. In that article, Vinod addressed the most interesting and practical questions related to upgrades. He started with the fundamentals of how to start backup before upgrade and ended with fail-safe strategies after the upgrade is over. He covered end-to-end concepts in his blog posts in simple words in extremely precise statements. A successful upgrade uses a cycle of: planning, document process, testing, refine process, testing, planning upgrade window, execution, verifying of upgrade and opening for business. If you are at Vinod’s blog post, I suggest you go all the way down and collect the gold mine of most important links. I have bookmarked the blog by blogging about it and I suggest that you bookmark it as well with the way you prefer. Vinod Kumar’s blog post on SQL Server 2012 Upgrade Technical Guide SQL Server 2012 Upgrade Technical Guide is a detailed resource that’s also available online for free. Each chapter was carefully crafted and explained in detail. Here is a quick list of the chapters included in the whitepaper. Before downloading the guide, beware of its size of 9 MB and 454 pages. Here’s the list of chapters: Chapter 1: Upgrade Planning and Deployment Chapter 2: Management Tools Chapter 3: Relational Databases Chapter 4: High Availability Chapter 5: Database Security Chapter 6: Full-Text Search Chapter 7: Service Broker Chapter 8: SQL Server Express Chapter 9: SQL Server Data Tools Chapter 10: Transact-SQL Queries Chapter 11: Spatial Data Chapter 12: XML and XQuery Chapter 13: CLR Chapter 14: SQL Server Management Objects Chapter 15: Business Intelligence Tools Chapter 16: Analysis Services Chapter 17: Integration Services Chapter 18: Reporting Services Chapter 19: Data Mining Chapter 20: Other Microsoft Applications and Platforms Appendix 1: Version and Edition Upgrade Paths Appendix 2: SQL Server 2012: Upgrade Planning Checklist Download SQL Server 2012 Upgrade Technical Guide [454 pages and 9 MB] Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: Database, DBA, PostADay, SQL, SQL Authority, SQL Documentation, SQL Download, SQL Query, SQL Server, SQL Tips and Tricks, SQL White Papers, SQLAuthority News, SQLServer, T SQL, Technology

    Read the article

  • Silverlight Cream for November 08, 2011 -- #1165

    - by Dave Campbell
    In this Issue: Brian Noyes, Michael Crump, WindowsPhoneGeek, Erno de Weerd, Jesse Liberty, Derik Whittaker, Sumit Dutta, Asim Sajjad, Dhananjay Kumar, Kunal Chowdhury, and Beth Massi. Above the Fold: Silverlight: "Working with Prism 4 Part 1: Getting Started" Brian Noyes WP7: "Getting Started with the Coding4Fun toolkit Tile Control" WindowsPhoneGeek LightSwitch: "How to Connect to and Diagram your SQL Express Database in Visual Studio LightSwitch" Beth Massi Shoutouts: Michael Palermo's latest Desert Mountain Developers is up Michael Washington's latest Visual Studio #LightSwitch Daily is up From SilverlightCream.com: Working with Prism 4 Part 1: Getting Started Brian Noyes has a series starting at SilverlightShow about Prism 4 ... this is the first one, so a good time to jump in and pick up on an intro and basic info about Prism plus building your first Prism app. 10 Laps around Silverlight 5 (Part 5 of 10) Michael Crump has Part 5 of his 10-part Silverlight 5 investigation up at SilverlightShow talking about all the various text features added in Silverlight 5 Beta: Text Tracking and Leading, Linked and MultiColumn, OpenType, etc. Getting Started with the Coding4Fun toolkit Tile Control WindowsPhoneGeek takes on the Tile control from the Coding4Fun toolkit... as usual, great tutorial... diagrams, code, explanation Using AppHarbor, Bitbucket and Mercurial with ASP.NET and Silverlight – Part 2 CouchDB, Cloudant and Hammock Erno de Weerd has Part 2 of his trilogy and he's trying to beat David Anson for the long title record :) ... in this episode, he's adding in cloud storage to the mix in a 35-step tutorial. Background Audio Jesse Liberty's talking about background Audio... and no not the Muzak in the elevator (do they still have that?) ... he's tlking about the WP7.1 BackgroundAudioPlayer Using the ToggleSwitch in WinRT/Metro (for C#) Derik Whittaker shows off the ToggleSwitch for WinRT/Metro... not a lot to be said about it, but he says it all :) Part 19 - Windows Phone 7 - Access Phone Contacts Sumit Dutta has Part 19! of his WP7 series up... talking today about getting a phone number from the directory using the PhoneNumberChooserTask ContextMenu using MVVM Asim Sajjad shows how to make the Context Menu ViewModel friendly in this short tutorial. Code to make call in Windows Phone 7 Dhananjay Kumar's latest WP7 post is explaining how to make a call programmatically using the PhoneCallTask launcher. Silverlight Page Navigation Framework - Basic Concept Kunal Chowdhury has a 3-part tutorial series on Silverlight Navigation up. This is the first in the series, and he hits the basics... what constitutes a Page, and how to get started with the navigation framework. How to Connect to and Diagram your SQL Express Database in Visual Studio LightSwitch Beth Massi's latest LightSwitch post is on using the Data Designer to easily crete and model database tables... during development this is in SQL Express, but can be deployed to most SQL server db you like Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

  • Silverlight Cream for June 21, 2011 -- #1110

    - by Dave Campbell
    In this Issue: Colin Eberhardt, Kunal Chowdhury(-2-), Peter Kuhn(-2-, -3-), Mike Gold, WindowsPhoneGeek, Nigel Sampson, Paul Sheriff, Dhananjay Kumar, and Erno de Weerd. Above the Fold: Silverlight: "Silverlight Debug Helper" Peter Kuhn3 WP7: "Metro In Motion #8 – AutoCompleteBox Reveal Animation" Colin Eberhardt Shoutouts: Check out the Top 5 from my friends at SilverlightShow from last week: SilverlightShow for June 13 - 19, 2011 From SilverlightCream.com: Metro In Motion #8 – AutoCompleteBox Reveal Animation Colin Eberhardt found yet another 'Metro In Motion' to duplicate... this one is the auto-complete effect seen in the WP7 email client... check out the video on the post! Windows Phone 7 (Mango) Tutorial - 16 - How to Create a WP7 Alarm Application? Kunal Chowdhury has a couple more of his Mango tutorials up... number 16 (!) is on creating an Alarm app using scheduled tasks. Windows Phone 7 (Mango) Tutorial - 17 - How to Create a WP7 Reminder Application? Kunal Chowdhury's latest is number 17 in the Mango series and he's discussing the Reminder class which is part of the Scheduler namespace. Silverlight Debug Helper Peter Kuhn has deployed a new version of his "Silverlight Debug Helper"... this time he's added support for FireFox and Chrome. Getting ready for the Windows Phone 7 Exam 70-599 (Part 3) Peter Kuhn also has Part 3 of his series posted at SilverlightShow on getting ready for the WP7 exam. XNA for Silverlight developers: Part 13 - Mango (2) Finally, Peter Kuhn's latest XNA for Silverlight developers tutorial is up at SilverlightShow and is the 2nd Mango post for game devs. Detecting Altitude using the WP7 Phone WindowsPhoneGeek apparently turned the reigns of his blog over to Mike Gold for this post about Altitude detection on the WP7. Windows Phone Mango: Getting Started with MVVM in 10 Minutes If you're out there and still haven't gotten your head around MVVM, or want to take another look at why you're beating yourself up doing it [ :) ]... WindowsPhoneGeek has a quick write-up on MVVM and WP7.1 apps Creating app promotional videos Nigel Sampson details how he uses Expression Encoder to produce the app videos he has on his blog for his WP7* apps. Sort Data in Windows Phone using Collection View Source Paul Sheriff's latest post is up, and is another WP7 post. This time on how to sort the data you consume by using a CollectionViewSource object in XAML and not write any code! Viewing Flickr Images on Windows 7.1 Phone or Mango Phone Dhananjay Kumar has a tutorial up for WP7.1 showing how to use the Flickr REST service to display images on your device. Windows Phone 7: Drawing graphics for your application with Inkscape – Part II: Icons Part 2 of Erno de Weerd's Trilogy on Drawing graphics for your WP7* apps in Inkscape is up... this tutorial is all about icons... good stuff! Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

  • Silverlight Cream for March 13, 2011 -- #1059

    - by Dave Campbell
    In this Issue: András Velvárt, WIndowsPhoneGeek(-2-), Jesse Liberty(-2-), Victor Gaudioso, Kunal Chowdhury, Jeremy Likness, Michael Crump, and Dhananjay Kumar. Above the Fold: Silverlight: "Application Library Caching in Silverlight 4" Kunal Chowdhury WP7: "Handling WP7 orientation changes via Visual States" András Velvárt Shoutouts: Joe McBride gave a MEF Head User Group presentation and has posted How to Become a MEF Head – Slides & Code From SilverlightCream.com: Handling WP7 orientation changes via Visual States András Velvárt has an Expression Blend/WP7 post up discussing WP7 orientation changes and handling them via Visual States ... see an example from his SurfCube app, and a behavior to handle the control... with source. WP7 PerformanceProgressBar in depth WIndowsPhoneGeek has a post up discussing the WP7 Performance bar from the Windows Phone Toolkit. This is an update on the Toolkit based on the Feb 2011 release. Great explanation of the PerformanceProgressBar, external links, and sample code. Getting data out of WP7 WMAppManifest is easy with Coding4Fun PhoneHelper Next WindowsPhoneGeek has a post up about the PhoneHelper in the Coding4Fun TOolkit, and using it to get data out of the WMAppManifest easily. Good discussion, Links, and code as always Silverlight Unit Test For Phone In Jesse Liberty's "Windows Phone From Scratch" number 41, he's discussing Unit Testing for WP7... he gives some good external links and some good examples. Yet Another Podcast #27–Paul Betts Jesse Liberty's next post is his "Yet Another Podcast" number 27, and an interview with Paul Betts, the creator of Reactive UI... check out the podcast and also the good links listed. New Silverlight Video Tutorial: How to use the Fluid Move Behavior Victor Gaudioso has a new video tutorial up on using the Fluid Move Behavior... making a selected item animate from a ListBox to a Master Details Grid. Application Library Caching in Silverlight 4 Kunal Chowdhury takes a break from SilverlightZone long enough to write a post about Application Library Caching... for example on-demand loading of a 3rd-party XAP. Jounce Part 13: Navigation Parameters Jeremy Likness has his 13th post of a series in understanding his Jounce MVVM framework up. This episode surrounds a new release and what it contains, the primary focus being navigation parameters... that is you can raise a navigation event with a payload. Profiling Silverlight Applications after installing Visual Studio 2010 Service Pack 1 Michael Crump digs into the performance wizard for Silverlight that we get with VS2010 SP1. He shows how to get and read a profile... great intro to a new tool. Binding XML File to Data Grid in Silverlight Dhananjay Kumar demonstrates reading an XML file using LINQ to XML and binding the result to a Silverlight DataGrid Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

  • Silverlight Cream for March 07, 2011 -- #1055

    - by Dave Campbell
    In this Issue: Max Paulousky, Chris Rouw, David Anson, Jesse Liberty, Shawn Wildermuth, Simon Guindon, and Dhananjay Kumar. Above the Fold: Silverlight: "Faster Databinding in WPF and Silverlight using OptimizedObservableCollection" Simon Guindon WP7: "Phoney Tools Updated (WP7 Open Source Library)" Shawn Wildermuth From SilverlightCream.com: Problems With Sharing Windows Phone 7 Applications Within A Large Group Of Beta Testers Max Paulousky has a post up discussing the issues surrounding beta testing a WP7 app with a large group of testers... and how to pull it all off. WP7 Insights #1: Consuming REST APIs within a WP7 app Chris Rouw is beginning a WP7 series based on his recent experience of getting a client's app into the marketplace. This first in his series is on consuming REST APIs ... lots of good code and explanations. Improving Windows Phone 7 application performance is even easier with these LowProfileImageLoader and DeferredLoadListBox updates David Anson has an update to his LowProfileImageLoader and DeferredLoadListBox after issues brought up by readers... so we all win with the great feedback from alert devs. When Isolated Storage Isn’t Enough Jesse Liberty started looking at Jeremy Likness' Sterling with this post in the WP7 From Scratch series. He starts with downloading it from CodePlex ... great way to get into Sterling if you haven't already. Phoney Tools Updated (WP7 Open Source Library) Shawn Wildermuth has the latest drop of his Phoney Tools up... this is the last Alpha. I've added a tag for it as well. He's fixed some things, added others... check out the post and go grab the code. Faster Databinding in WPF and Silverlight using OptimizedObservableCollection Simon Guindon is a blogger I've not been following, but this post on an OptimizedObservableCollection caught my eye. He added an AddRange() to the ObservableCollection to get a speed enhancement when adding items... and a pretty good speed enhancement it is. Reading files asynchronously using WebClient class in Silverlight Dhananjay Kumar is another prolific blogger that I've not been following, so we'll start with his latest... a step-by-step guide to reading an XML file asynchronously. Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

  • SQLAuthority News – TechEd India – April 12-14, 2010 Bangalore – An Unforgettable Experience – An Op

    - by pinaldave
    TechEd India was one of the largest Technology events in India led by Microsoft. This event was attended by more than 3,000 technology enthusiasts, making it one of the most well-organized events of the year. Though I attempted to attend almost all the technology events here, I have not seen any bigger or better event in Indian subcontinents other than this. There are 21 Technical Tracks at Tech·Ed India 2010 that span more than 745 learning opportunities. I was fortunate enough to be a part of this whole event as a speaker and a delegate, as well. TechEd India Speaker Badge and A Token of Lifetime Hotel Selection I presented three different sessions at TechEd India and was also a part of panel discussion. (The details of the sessions are given at the end of this blog post.) Due to extensive traveling, I stay away from my family occasionally. For this reason, I took my wife – Nupur and daughter Shaivi (8 months old) to the event along with me. We stayed at the same hotel where the event was organized so as to maximize my time bonding with my family and to have more time in networking with technology community, at the same time. The hotel Lalit Ashok is the largest and most luxurious venue one can find in Bangalore, located in the middle of the city. The cost of the hotel was a bit pricey, but looking at all the advantages, I had decided to ask for a booking there. Hotel Lalit Ashok Nupur Dave and Shaivi Dave Arrival Day – DAY 0 – April 11, 2010 I reached the event a day earlier, and that was one wise decision for I was able to relax a bit and go over my presentation for the next day’s course. I am a kind of person who likes to get everything ready ahead of time. I was also able to enjoy a pleasant evening with several Microsoft employees and my family friends. I even checked out the location where I would be doing presentations the next day. I was fortunate enough to meet Bijoy Singhal from Microsoft who helped me out with a few of the logistics issues that occured the day before. I was not aware of the fact that the very next day he was going to be “The Man” of the TechEd 2010 event. Vinod Kumar from Microsoft was really very kind as he talked to me regarding my subsequent session. He gave me some suggestions which were really helpful that I was able to incorporate them during my presentation. Finally, I was able to meet Abhishek Kant from Microsoft; his valuable suggestions and unlimited passion have inspired many people like me to work with the Community. Pradipta from Microsoft was also around, being extremely busy with logistics; however, in those busy times, he did find some good spare time to have a chat with me and the other Community leaders. I also met Harish Ranganathan and Sachin Rathi, both from Microsoft. It was so interesting to listen to both of them talking about SharePoint. I just have no words to express my overwhelmed spirit because of all these passionate young guys - Pradipta,Vinod, Bijoy, Harish, Sachin and Ahishek (of course!). Map of TechEd India 2010 Event Day 1 – April 12, 2010 From morning until night time, today was truly a very busy day for me. I had two presentations and one panel discussion for the day. Needless to say, I had a few meetings to attend as well. The day started with a keynote from S. Somaseger where he announced the launch of Visual Studio 2010. The keynote area was really eye-catching because of the very large, bigger-than- life uniform screen. This was truly one to show. The title music of the keynote was very interesting and it featured Bijoy Singhal as the model. It was interesting to talk to him afterwards, when we laughed at jokes together about his modeling assignment. TechEd India Keynote Opening Featuring Bijoy TechEd India 2010 Keynote – S. Somasegar Time: 11:15pm – 11:45pm Session 1: True Lies of SQL Server – SQL Myth Buster Following the excellent keynote, I had my very first session on the subject of SQL Server Myth Buster. At first, I was a bit nervous as right after the keynote, for this was my very first session and during my presentation I saw lots of Microsoft Product Team members. Well, it really went well and I had a really good discussion with attendees of the session. I felt that a well begin was half-done and my confidence was regained. Right after the session, I met a few of my Community friends and had meaningful discussions with them on many subjects. The abstract of the session is as follows: In this 30-minute demo session, I am going to briefly demonstrate few SQL Server Myths and their resolutions as I back them up with some demo. This demo presentation is a must-attend for all developers and administrators who would come to the event. This is going to be a very quick yet fun session. Pinal Presenting session at TechEd India 2010 Time: 1:00 PM – 2:00 PM Lunch with Somasegar After the session I went to see my daughter, and then I headed right away to the lunch with S. Somasegar – the keynote speaker and senior vice president of the Developer Division at Microsoft. I really thank to Abhishek who made it possible for us. Because of his efforts, all the MVPs had the opportunity to meet such a legendary person and had to talk with them on Microsoft Technology. Though Somasegar is currently holding such a high position in Microsoft, he is very polite and a real gentleman, and how I wish that everybody in industry is like him. Believe me, if you spread love and kindness, then that is what you will receive back. As soon as lunch time was over, I ran to the session hall as my second presentation was about to start. Time: 2:30pm – 3:30pm Session 2: Master Data Services in Microsoft SQL Server 2008 R2 Business Intelligence is a subject which was widely talked about at TechEd. Everybody was interested in this subject, and I did not excuse myself from this great concept as well. I consider myself fortunate as I was presenting on the subject of Master Data Services at TechEd. When I had initially learned this subject, I had a bit of confusion about the usage of this tool. Later on, I decided that I would tackle about how we all developers and DBAs are not able to understand something so simple such as this, and even worst, creating confusion about the technology. During system designing, it is very important to have a reference material or master lookup tables. Well, I talked about the same subject and presented the session keeping that as my center talk. The session went very well and I received lots of interesting questions. I got many compliments for talking about this subject on the real-life scenario. I really thank Rushabh Mehta (CEO, Solid Quality Mentors India) for his supportive suggestions that helped me prepare the slide deck, as well as the subject. Pinal Presenting session at TechEd India 2010 The abstract of the session is as follows: SQL Server Master Data Services will ship with SQL Server 2008 R2 and will improve Microsoft’s platform appeal. This session provides an in-depth demonstration of MDS features and highlights important usage scenarios. Master Data Services enables consistent decision-making process by allowing you to create, manage and propagate changes from a single master view of your business entities. Also, MDS – Master Data-hub which is a vital component, helps ensure the consistency of reporting across systems and deliver faster and more accurate results across the enterprise. We will talk about establishing the basis for a centralized approach to defining, deploying, and managing master data in the enterprise. Pinal Presenting session at TechEd India 2010 The day was still not over for me. I had ran into several friends but we were not able keep our enthusiasm under control about all the rumors saying that SQL Server 2008 R2 was about to be launched tomorrow in the keynote. I then ran to my third and final technical event for the day- a panel discussion with the top technologies of India. Time: 5:00pm – 6:00pm Panel Discussion: Harness the power of Web – SEO and Technical Blogging As I have delivered two technical sessions by this time, I was a bit tired but  not less enthusiastic when I had to talk about Blog and Technology. We discussed many different topics there. I told them that the most important aspect for any blog is its content. We discussed in depth the issues with plagiarism and how to avoid it. Another topic of discussion was how we technology bloggers can create awareness in the Community about what the right kind of blogging is and what morally and technically wrong acts are. A couple of questions were raised about what type of liberty a person can have in terms of writing blogs. Well, it was generically agreed that a blog is mainly a representation of our ideas and thoughts; it should not be governed by external entities. As long as one is writing what they really want to say, but not providing incorrect information or not practicing plagiarism, a blogger should be allowed to express himself. This panel discussion was supposed to be over in an hour, but the interest of the participants was remarkable and so it was extended for 30 minutes more. Finally, we decided to bring to a close the discussion and agreed that we will continue the topic next year. TechEd India Panel Discussion on Web, Technology and SEO Surprisingly, the day was just beginning after doing all of these. By this time, I have almost met all the MVP who arrived at the event, as well as many Microsoft employees. There were lots of Community folks present, too. I decided that I would go to meet several friends from the Community and continue to communicate with me on SQLAuthority.com. I also met Abhishek Baxi and had a good talk with him regarding Win Mobile and Twitter. He also took a very quick video of me wherein I spoke in my mother’s tongue, Gujarati. It was funny that I talked in Gujarati almost all the day, but when I was talking in the interview I could not find the right Gujarati words to speak. I think we all think in English when we think about Technology, so as to address universality. After meeting them, I headed towards the Speakers’ Dinner. Time: 8:00 PM – onwards Speakers Dinner The Speakers’ dinner was indeed a wonderful opportunity for all the speakers to get together and relax. We talked so many different things, from XBOX to Hindi Movies, and from SQL to Samosas. I just could not express how much fun I had. After a long evening, when I returned tmy room and met Shaivi, I just felt instantly relaxed. Kids are really gifts from God. Today was a really long but exciting day. So many things happened in just one day: Visual Studio Lanch, lunch with Somasegar, 2 technical sessions, 1 panel discussion, community leaders meeting, speakers dinner and, last but not leas,t playing with my child! A perfect day! Day 2 – April 13, 2010 Today started with a bang with the excellent keynote by Kamal Hathi who launched SQL Server 2008 R2 in India and demonstrated the power of PowerPivot to all of us. 101 Million Rows in Excel brought lots of applause from the audience. Kamal Hathi Presenting Keynote at TechEd India 2010 The day was a bit easier one for me. I had no sessions today and no events planned. I had a few meetings planned for the second day of the event. I sat in the speaker’s lounge for half a day and met many people there. I attended nearly 9 different meetings today. The subjects of the meetings were very different. Here is a list of the topics of the Community-related meetings: SQL PASS and its involvement in India and subcontinents How to start community blogging Forums and developing aptitude towards technology Ahmedabad/Gandhinagar User Groups and their developments SharePoint and SQL Business Meeting – a client meeting Business Meeting – a potential performance tuning project Business Meeting – Solid Quality Mentors (SolidQ) And family friends Pinal Dave at TechEd India The day passed by so quickly during this meeting. In the evening, I headed to Partners Expo with friends and checked out few of the booths. I really wanted to talk about some of the products, but due to the freebies there was so much crowd that I finally decided to just take the contact details of the partner. I will now start sending them with my queries and, hopefully, I will have my questions answered. Nupur and Shaivi had also one meeting to attend; it was with our family friend Vijay Raj. Vijay is also a person who loves Technology and loves it more than anybody. I see him growing and learning every day, but still remaining as a ‘human’. I believe that if someone acquires as much knowledge as him, that person will become either a computer or cyborg. Here, Vijay is still a kind gentleman and is able to stay as our close family friend. Shaivi was really happy to play with Uncle Vijay. Pinal Dave and Vijay Raj Renuka Prasad, a Microsoft MVP, impressed me with his passion and knowledge of SQL. Every time he gives me credit for his success, I believe that he is very humble. He has way more certifications than me and has worked many more years with SQL compared to me. He is an excellent photographer as well. Most of the photos in this blog post have been taken by him. I told him if ever he wants to do a part time job, he can do the photography very well. Pinal Dave and Renuka Prasad I also met L Srividya from Microsoft, whom I was looking forward to meet. She is a bundle of knowledge that everyone would surely learn a lot from her. I was able to get a few minutes from her and well, I felt confident. She enlightened me with SQL Server BI concepts, domain management and SQL Server security and few other interesting details. I also had a wonderful time talking about SharePoint with fellow Solid Quality Mentor Joy Rathnayake. He is very passionate about SharePoint but when you talk .NET and SQL with him, he is still overwhelmingly knowledgeable. In fact, while talking to him, I figured out that the recent training he delivered was on SQL Server 2008 R2. I told him a joke that it hurts my ego as he is more popular now in SQL training and consulting than me. I am sure all of you agree that working with good people is a gift from God. I am fortunate enough to work with the best of the best Industry experts. It was a great pleasure to hang out with my Community friends – Ahswin Kini, HimaBindu Vejella, Vasudev G, Suprotim Agrawal, Dhananjay, Vikram Pendse, Mahesh Dhola, Mahesh Mitkari,  Manu Zacharia, Shobhan, Hardik Shah, Ashish Mohta, Manan, Subodh Sohani and Sanjay Shetty (of course!) .  (Please let me know if I have met you at the event and forgot your name to list here). Time: 8:00 PM – onwards Community Leaders Dinner After lots of meetings, I headed towards the Community Leaders dinner meeting and met almost all the folks I met in morning. The discussion was almost the same but the real good thing was that we were enjoying it. The food was really good. Nupur was invited in the event, but Shaivi could not come. When Nupur tried to enter the event, she was stopped as Shaivi did not have the pass to enter the dinner. Nupur expressed that Shaivi is only 8 months old and does not eat outside food as well and could not stay by herself at this age, but the door keeper did not agree and asked that without the entry details Shaivi could not go in, but Nupur could. Nupur called me on phone and asked me to help her out. By the time, I was outside; the organizer of the event reached to the door and happily approved Shaivi to join the party. Once in the party, Shaivi had lots of fun meeting so many people. Shaivi Dave and Abhishek Kant Dean Guida (Infragistics President and CEO) and Pinal Dave (SQLAuthority.com) Day 3 – April 14, 2010 Though, it was last day, I was very much excited today as I was about to present my very favorite session. Query Optimization and Performance Tuning is my domain expertise and I make my leaving by consulting and training the same. Today’s session was on the same subject and as an additional twist, another subject about Spatial Database was presented. I was always intrigued with Spatial Database and I have enjoyed learning about it; however, I have never thought about Spatial Indexing before it was decided that I will do this session. I really thank Solid Quality Mentor Dr. Greg Low for his assistance in helping me prepare the slide deck and also review the content. Furthermore, today was really what I call my ‘learning day’ . So far I had not attended any session in TechEd and I felt a bit down for that. Everybody spends their valuable time & money to learn something new and exciting in TechEd and I had not attended a single session at the moment thinking that it was already last day of the event. I did have a plan for the day and I attended two technical sessions before my session of spatial database. I attended 2 sessions of Vinod Kumar. Vinod is a natural storyteller and there was no doubt that his sessions would be jam-packed. People attended his sessions simply because Vinod is syhe speaker. He did not have a single time disappointed audience; he is truly a good speaker. He knows his stuff very well. I personally do not think that in India he can be compared to anyone for SQL. Time: 12:30pm-1:30pm SQL Server Query Optimization, Execution and Debugging Query Performance I really had a fun time attending this session. Vinod made this session very interactive. The entire audience really got into the presentation and started participating in the event. Vinod was presenting a small problem with Query Tuning, which any developer would have encountered and solved with their help in such a fashion that a developer feels he or she have already resolved it. In one question, I was the only one who was ready to answer and Vinod told me in a light tone that I am now allowed to answer it! The audience really found it very amusing. There was a huge crowd around Vinod after the session. Vinod – A master storyteller! Time: 3:45pm-4:45pm Data Recovery / consistency with CheckDB This session was much heavier than the earlier one, and I must say this is my most favorite session I EVER attended in India. In this TechEd I have only attended two sessions, but in my career, I have attended numerous technical sessions not only in India, but all over the world. This session had taken my breath away. One by one, Vinod took the different databases, and started to corrupt them in different ways. Each database has some unique ways to get corrupted. Once that was done, Vinod started to show the DBCC CEHCKDB and demonstrated how it can solve your problem. He finally fixed all the databases with this single tool. I do have a good knowledge of this subject, but let me honestly admit that I have learned a lot from this session. I enjoyed and cheered during this session along with other attendees. I had total satisfaction that, just like everyone, I took advantage of the event and learned something. I am now TECHnically EDucated. Pinal Dave and Vinod Kumar After two very interactive and informative SQL Sessions from Vinod Kumar, the next turn me presenting on Spatial Database and Indexing. I got once again nervous but Vinod told me to stay natural and do my presentation. Well, once I got a huge stage with a total of four projectors and a large crowd, I felt better. Time: 5:00pm-6:00pm Session 3: Developing with SQL Server Spatial and Deep Dive into Spatial Indexing Pinal Presenting session at TechEd India 2010 Pinal Presenting session at TechEd India 2010 I kicked off this session with Michael J Swart‘s beautiful spatial image. This session was the last one for the day but, to my surprise, I had more than 200+ attendees. Slowly, the rain was starting outside and I was worried that the hall would not be full; despite this, there was not a single seat available in the first five minutes of the session. Thanks to all of you for attending my presentation. I had demonstrated the map of world (and India) and quickly explained what  Geographic and Geometry data types in Spatial Database are. This session had interesting story of Indexing and Comparison, as well as how different traditional indexes are from spatial indexing. Pinal Presenting session at TechEd India 2010 Due to the heavy rain during this event, the power went off for about 22 minutes (just an accident – nobodies fault). During these minutes, there were no audio, no video and no light. I continued to address the mass of 200+ people without any audio device and PowerPoint. I must thank the audience because not a single person left from the session. They all stayed in their place, some moved closure to listen to me properly. I noticed that the curiosity and eagerness to learn new things was at the peak even though it was the very last session of the TechEd. Everybody wanted get the maximum knowledge out of this whole event. I was touched by the support from audience. They listened and participated in my session even without any kinds of technology (no ppt, no mike, no AC, nothing). During these 22 minutes, I had completed my theory verbally. Pinal Presenting session at TechEd India 2010 After a while, we got the projector back online and we continued with some exciting demos. Many thanks to Microsoft people who worked energetically in background to get the backup power for project up. I had a very interesting demo wherein I overlaid Bangalore and Hyderabad on the India Map and find their aerial distance between them. After finding the aerial distance, we browsed online and found that SQL Server estimates the exact aerial distance between these two cities, as compared to the factual distance. There was a huge applause from the crowd on the subject that SQL Server takes into the count of the curvature of the earth and finds the precise distances based on details. During the process of finding the distance, I demonstrated a few examples of the indexes where I expressed how one can use those indexes to find these distances and how they can improve the performance of similar query. I also demonstrated few examples wherein we were able to see in which data type the Index is most useful. We finished the demos with a few more internal stuff. Pinal Presenting session at TechEd India 2010 Despite all issues, I was mostly satisfied with my presentation. I think it was the best session I have ever presented at any conference. There was no help from Technology for a while, but I still got lots of appreciation at the end. When we ended the session, the applause from the audience was so loud that for a moment, the rain was not audible. I was truly moved by the dedication of the Technology enthusiasts. Pinal Dave After Presenting session at TechEd India 2010 The abstract of the session is as follows: The Microsoft SQL Server 2008 delivers new spatial data types that enable you to consume, use, and extend location-based data through spatial-enabled applications. Attend this session to learn how to use spatial functionality in next version of SQL Server to build and optimize spatial queries. This session outlines the new geography data type to store geodetic spatial data and perform operations on it, use the new geometry data type to store planar spatial data and perform operations on it, take advantage of new spatial indexes for high performance queries, use the new spatial results tab to quickly and easily view spatial query results directly from within Management Studio, extend spatial data capabilities by building or integrating location-enabled applications through support for spatial standards and specifications and much more. Time: 8:00 PM – onwards Dinner by Sponsors After the lively session during the day, there was another dinner party courtesy of one of the sponsors of TechEd. All the MVPs and several Community leaders were present at the dinner. I would like to express my gratitude to Abhishek Kant for organizing this wonderful event for us. It was a blast and really relaxing in all angles. We all stayed there for a long time and talked about our sweet and unforgettable memories of the event. Pinal Dave and Bijoy Singhal It was really one wonderful event. After writing this much, I say that I have no words to express about how much I enjoyed TechEd. However, it is true that I shared with you only 1% of the total activities I have done at the event. There were so many people I have met, yet were not mentioned here although I wanted to write their names here, too . Anyway, I have learned so many things and up until now, I am not able to get over all the fun I had in this event. Pinal Dave at TechEd India 2010 The Next Days – April 15, 2010 – till today I am still not able to get my mind out of the whole experience I had at TechEd India 2010. It was like a whole Microsoft Family working together to celebrate a happy occasion. TechEd India – Truly An Unforgettable Experience! Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: About Me, MVP, Pinal Dave, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority Author Visit, SQLAuthority News, SQLServer, T SQL, Technology Tagged: TechEd, TechEdIn

    Read the article

  • SQLAuthority News – TechEd India – April 12-14, 2010 Bangalore – An Unforgettable Experience – An Op

    - by pinaldave
    TechEd India was one of the largest Technology events in India led by Microsoft. This event was attended by more than 3,000 technology enthusiasts, making it one of the most well-organized events of the year. Though I attempted to attend almost all the technology events here, I have not seen any bigger or better event in Indian subcontinents other than this. There are 21 Technical Tracks at Tech·Ed India 2010 that span more than 745 learning opportunities. I was fortunate enough to be a part of this whole event as a speaker and a delegate, as well. TechEd India Speaker Badge and A Token of Lifetime Hotel Selection I presented three different sessions at TechEd India and was also a part of panel discussion. (The details of the sessions are given at the end of this blog post.) Due to extensive traveling, I stay away from my family occasionally. For this reason, I took my wife – Nupur and daughter Shaivi (8 months old) to the event along with me. We stayed at the same hotel where the event was organized so as to maximize my time bonding with my family and to have more time in networking with technology community, at the same time. The hotel Lalit Ashok is the largest and most luxurious venue one can find in Bangalore, located in the middle of the city. The cost of the hotel was a bit pricey, but looking at all the advantages, I had decided to ask for a booking there. Hotel Lalit Ashok Nupur Dave and Shaivi Dave Arrival Day – DAY 0 – April 11, 2010 I reached the event a day earlier, and that was one wise decision for I was able to relax a bit and go over my presentation for the next day’s course. I am a kind of person who likes to get everything ready ahead of time. I was also able to enjoy a pleasant evening with several Microsoft employees and my family friends. I even checked out the location where I would be doing presentations the next day. I was fortunate enough to meet Bijoy Singhal from Microsoft who helped me out with a few of the logistics issues that occured the day before. I was not aware of the fact that the very next day he was going to be “The Man” of the TechEd 2010 event. Vinod Kumar from Microsoft was really very kind as he talked to me regarding my subsequent session. He gave me some suggestions which were really helpful that I was able to incorporate them during my presentation. Finally, I was able to meet Abhishek Kant from Microsoft; his valuable suggestions and unlimited passion have inspired many people like me to work with the Community. Pradipta from Microsoft was also around, being extremely busy with logistics; however, in those busy times, he did find some good spare time to have a chat with me and the other Community leaders. I also met Harish Ranganathan and Sachin Rathi, both from Microsoft. It was so interesting to listen to both of them talking about SharePoint. I just have no words to express my overwhelmed spirit because of all these passionate young guys - Pradipta,Vinod, Bijoy, Harish, Sachin and Ahishek (of course!). Map of TechEd India 2010 Event Day 1 – April 12, 2010 From morning until night time, today was truly a very busy day for me. I had two presentations and one panel discussion for the day. Needless to say, I had a few meetings to attend as well. The day started with a keynote from S. Somaseger where he announced the launch of Visual Studio 2010. The keynote area was really eye-catching because of the very large, bigger-than- life uniform screen. This was truly one to show. The title music of the keynote was very interesting and it featured Bijoy Singhal as the model. It was interesting to talk to him afterwards, when we laughed at jokes together about his modeling assignment. TechEd India Keynote Opening Featuring Bijoy TechEd India 2010 Keynote – S. Somasegar Time: 11:15pm – 11:45pm Session 1: True Lies of SQL Server – SQL Myth Buster Following the excellent keynote, I had my very first session on the subject of SQL Server Myth Buster. At first, I was a bit nervous as right after the keynote, for this was my very first session and during my presentation I saw lots of Microsoft Product Team members. Well, it really went well and I had a really good discussion with attendees of the session. I felt that a well begin was half-done and my confidence was regained. Right after the session, I met a few of my Community friends and had meaningful discussions with them on many subjects. The abstract of the session is as follows: In this 30-minute demo session, I am going to briefly demonstrate few SQL Server Myths and their resolutions as I back them up with some demo. This demo presentation is a must-attend for all developers and administrators who would come to the event. This is going to be a very quick yet fun session. Pinal Presenting session at TechEd India 2010 Time: 1:00 PM – 2:00 PM Lunch with Somasegar After the session I went to see my daughter, and then I headed right away to the lunch with S. Somasegar – the keynote speaker and senior vice president of the Developer Division at Microsoft. I really thank to Abhishek who made it possible for us. Because of his efforts, all the MVPs had the opportunity to meet such a legendary person and had to talk with them on Microsoft Technology. Though Somasegar is currently holding such a high position in Microsoft, he is very polite and a real gentleman, and how I wish that everybody in industry is like him. Believe me, if you spread love and kindness, then that is what you will receive back. As soon as lunch time was over, I ran to the session hall as my second presentation was about to start. Time: 2:30pm – 3:30pm Session 2: Master Data Services in Microsoft SQL Server 2008 R2 Business Intelligence is a subject which was widely talked about at TechEd. Everybody was interested in this subject, and I did not excuse myself from this great concept as well. I consider myself fortunate as I was presenting on the subject of Master Data Services at TechEd. When I had initially learned this subject, I had a bit of confusion about the usage of this tool. Later on, I decided that I would tackle about how we all developers and DBAs are not able to understand something so simple such as this, and even worst, creating confusion about the technology. During system designing, it is very important to have a reference material or master lookup tables. Well, I talked about the same subject and presented the session keeping that as my center talk. The session went very well and I received lots of interesting questions. I got many compliments for talking about this subject on the real-life scenario. I really thank Rushabh Mehta (CEO, Solid Quality Mentors India) for his supportive suggestions that helped me prepare the slide deck, as well as the subject. Pinal Presenting session at TechEd India 2010 The abstract of the session is as follows: SQL Server Master Data Services will ship with SQL Server 2008 R2 and will improve Microsoft’s platform appeal. This session provides an in-depth demonstration of MDS features and highlights important usage scenarios. Master Data Services enables consistent decision-making process by allowing you to create, manage and propagate changes from a single master view of your business entities. Also, MDS – Master Data-hub which is a vital component, helps ensure the consistency of reporting across systems and deliver faster and more accurate results across the enterprise. We will talk about establishing the basis for a centralized approach to defining, deploying, and managing master data in the enterprise. Pinal Presenting session at TechEd India 2010 The day was still not over for me. I had ran into several friends but we were not able keep our enthusiasm under control about all the rumors saying that SQL Server 2008 R2 was about to be launched tomorrow in the keynote. I then ran to my third and final technical event for the day- a panel discussion with the top technologies of India. Time: 5:00pm – 6:00pm Panel Discussion: Harness the power of Web – SEO and Technical Blogging As I have delivered two technical sessions by this time, I was a bit tired but  not less enthusiastic when I had to talk about Blog and Technology. We discussed many different topics there. I told them that the most important aspect for any blog is its content. We discussed in depth the issues with plagiarism and how to avoid it. Another topic of discussion was how we technology bloggers can create awareness in the Community about what the right kind of blogging is and what morally and technically wrong acts are. A couple of questions were raised about what type of liberty a person can have in terms of writing blogs. Well, it was generically agreed that a blog is mainly a representation of our ideas and thoughts; it should not be governed by external entities. As long as one is writing what they really want to say, but not providing incorrect information or not practicing plagiarism, a blogger should be allowed to express himself. This panel discussion was supposed to be over in an hour, but the interest of the participants was remarkable and so it was extended for 30 minutes more. Finally, we decided to bring to a close the discussion and agreed that we will continue the topic next year. TechEd India Panel Discussion on Web, Technology and SEO Surprisingly, the day was just beginning after doing all of these. By this time, I have almost met all the MVP who arrived at the event, as well as many Microsoft employees. There were lots of Community folks present, too. I decided that I would go to meet several friends from the Community and continue to communicate with me on SQLAuthority.com. I also met Abhishek Baxi and had a good talk with him regarding Win Mobile and Twitter. He also took a very quick video of me wherein I spoke in my mother’s tongue, Gujarati. It was funny that I talked in Gujarati almost all the day, but when I was talking in the interview I could not find the right Gujarati words to speak. I think we all think in English when we think about Technology, so as to address universality. After meeting them, I headed towards the Speakers’ Dinner. Time: 8:00 PM – onwards Speakers Dinner The Speakers’ dinner was indeed a wonderful opportunity for all the speakers to get together and relax. We talked so many different things, from XBOX to Hindi Movies, and from SQL to Samosas. I just could not express how much fun I had. After a long evening, when I returned tmy room and met Shaivi, I just felt instantly relaxed. Kids are really gifts from God. Today was a really long but exciting day. So many things happened in just one day: Visual Studio Lanch, lunch with Somasegar, 2 technical sessions, 1 panel discussion, community leaders meeting, speakers dinner and, last but not leas,t playing with my child! A perfect day! Day 2 – April 13, 2010 Today started with a bang with the excellent keynote by Kamal Hathi who launched SQL Server 2008 R2 in India and demonstrated the power of PowerPivot to all of us. 101 Million Rows in Excel brought lots of applause from the audience. Kamal Hathi Presenting Keynote at TechEd India 2010 The day was a bit easier one for me. I had no sessions today and no events planned. I had a few meetings planned for the second day of the event. I sat in the speaker’s lounge for half a day and met many people there. I attended nearly 9 different meetings today. The subjects of the meetings were very different. Here is a list of the topics of the Community-related meetings: SQL PASS and its involvement in India and subcontinents How to start community blogging Forums and developing aptitude towards technology Ahmedabad/Gandhinagar User Groups and their developments SharePoint and SQL Business Meeting – a client meeting Business Meeting – a potential performance tuning project Business Meeting – Solid Quality Mentors (SolidQ) And family friends Pinal Dave at TechEd India The day passed by so quickly during this meeting. In the evening, I headed to Partners Expo with friends and checked out few of the booths. I really wanted to talk about some of the products, but due to the freebies there was so much crowd that I finally decided to just take the contact details of the partner. I will now start sending them with my queries and, hopefully, I will have my questions answered. Nupur and Shaivi had also one meeting to attend; it was with our family friend Vijay Raj. Vijay is also a person who loves Technology and loves it more than anybody. I see him growing and learning every day, but still remaining as a ‘human’. I believe that if someone acquires as much knowledge as him, that person will become either a computer or cyborg. Here, Vijay is still a kind gentleman and is able to stay as our close family friend. Shaivi was really happy to play with Uncle Vijay. Pinal Dave and Vijay Raj Renuka Prasad, a Microsoft MVP, impressed me with his passion and knowledge of SQL. Every time he gives me credit for his success, I believe that he is very humble. He has way more certifications than me and has worked many more years with SQL compared to me. He is an excellent photographer as well. Most of the photos in this blog post have been taken by him. I told him if ever he wants to do a part time job, he can do the photography very well. Pinal Dave and Renuka Prasad I also met L Srividya from Microsoft, whom I was looking forward to meet. She is a bundle of knowledge that everyone would surely learn a lot from her. I was able to get a few minutes from her and well, I felt confident. She enlightened me with SQL Server BI concepts, domain management and SQL Server security and few other interesting details. I also had a wonderful time talking about SharePoint with fellow Solid Quality Mentor Joy Rathnayake. He is very passionate about SharePoint but when you talk .NET and SQL with him, he is still overwhelmingly knowledgeable. In fact, while talking to him, I figured out that the recent training he delivered was on SQL Server 2008 R2. I told him a joke that it hurts my ego as he is more popular now in SQL training and consulting than me. I am sure all of you agree that working with good people is a gift from God. I am fortunate enough to work with the best of the best Industry experts. It was a great pleasure to hang out with my Community friends – Ahswin Kini, HimaBindu Vejella, Vasudev G, Suprotim Agrawal, Dhananjay, Vikram Pendse, Mahesh Dhola, Mahesh Mitkari,  Manu Zacharia, Shobhan, Hardik Shah, Ashish Mohta, Manan, Subodh Sohani and Sanjay Shetty (of course!) .  (Please let me know if I have met you at the event and forgot your name to list here). Time: 8:00 PM – onwards Community Leaders Dinner After lots of meetings, I headed towards the Community Leaders dinner meeting and met almost all the folks I met in morning. The discussion was almost the same but the real good thing was that we were enjoying it. The food was really good. Nupur was invited in the event, but Shaivi could not come. When Nupur tried to enter the event, she was stopped as Shaivi did not have the pass to enter the dinner. Nupur expressed that Shaivi is only 8 months old and does not eat outside food as well and could not stay by herself at this age, but the door keeper did not agree and asked that without the entry details Shaivi could not go in, but Nupur could. Nupur called me on phone and asked me to help her out. By the time, I was outside; the organizer of the event reached to the door and happily approved Shaivi to join the party. Once in the party, Shaivi had lots of fun meeting so many people. Shaivi Dave and Abhishek Kant Dean Guida (Infragistics President and CEO) and Pinal Dave (SQLAuthority.com) Day 3 – April 14, 2010 Though, it was last day, I was very much excited today as I was about to present my very favorite session. Query Optimization and Performance Tuning is my domain expertise and I make my leaving by consulting and training the same. Today’s session was on the same subject and as an additional twist, another subject about Spatial Database was presented. I was always intrigued with Spatial Database and I have enjoyed learning about it; however, I have never thought about Spatial Indexing before it was decided that I will do this session. I really thank Solid Quality Mentor Dr. Greg Low for his assistance in helping me prepare the slide deck and also review the content. Furthermore, today was really what I call my ‘learning day’ . So far I had not attended any session in TechEd and I felt a bit down for that. Everybody spends their valuable time & money to learn something new and exciting in TechEd and I had not attended a single session at the moment thinking that it was already last day of the event. I did have a plan for the day and I attended two technical sessions before my session of spatial database. I attended 2 sessions of Vinod Kumar. Vinod is a natural storyteller and there was no doubt that his sessions would be jam-packed. People attended his sessions simply because Vinod is syhe speaker. He did not have a single time disappointed audience; he is truly a good speaker. He knows his stuff very well. I personally do not think that in India he can be compared to anyone for SQL. Time: 12:30pm-1:30pm SQL Server Query Optimization, Execution and Debugging Query Performance I really had a fun time attending this session. Vinod made this session very interactive. The entire audience really got into the presentation and started participating in the event. Vinod was presenting a small problem with Query Tuning, which any developer would have encountered and solved with their help in such a fashion that a developer feels he or she have already resolved it. In one question, I was the only one who was ready to answer and Vinod told me in a light tone that I am now allowed to answer it! The audience really found it very amusing. There was a huge crowd around Vinod after the session. Vinod – A master storyteller! Time: 3:45pm-4:45pm Data Recovery / consistency with CheckDB This session was much heavier than the earlier one, and I must say this is my most favorite session I EVER attended in India. In this TechEd I have only attended two sessions, but in my career, I have attended numerous technical sessions not only in India, but all over the world. This session had taken my breath away. One by one, Vinod took the different databases, and started to corrupt them in different ways. Each database has some unique ways to get corrupted. Once that was done, Vinod started to show the DBCC CEHCKDB and demonstrated how it can solve your problem. He finally fixed all the databases with this single tool. I do have a good knowledge of this subject, but let me honestly admit that I have learned a lot from this session. I enjoyed and cheered during this session along with other attendees. I had total satisfaction that, just like everyone, I took advantage of the event and learned something. I am now TECHnically EDucated. Pinal Dave and Vinod Kumar After two very interactive and informative SQL Sessions from Vinod Kumar, the next turn me presenting on Spatial Database and Indexing. I got once again nervous but Vinod told me to stay natural and do my presentation. Well, once I got a huge stage with a total of four projectors and a large crowd, I felt better. Time: 5:00pm-6:00pm Session 3: Developing with SQL Server Spatial and Deep Dive into Spatial Indexing Pinal Presenting session at TechEd India 2010 Pinal Presenting session at TechEd India 2010 I kicked off this session with Michael J Swart‘s beautiful spatial image. This session was the last one for the day but, to my surprise, I had more than 200+ attendees. Slowly, the rain was starting outside and I was worried that the hall would not be full; despite this, there was not a single seat available in the first five minutes of the session. Thanks to all of you for attending my presentation. I had demonstrated the map of world (and India) and quickly explained what  Geographic and Geometry data types in Spatial Database are. This session had interesting story of Indexing and Comparison, as well as how different traditional indexes are from spatial indexing. Pinal Presenting session at TechEd India 2010 Due to the heavy rain during this event, the power went off for about 22 minutes (just an accident – nobodies fault). During these minutes, there were no audio, no video and no light. I continued to address the mass of 200+ people without any audio device and PowerPoint. I must thank the audience because not a single person left from the session. They all stayed in their place, some moved closure to listen to me properly. I noticed that the curiosity and eagerness to learn new things was at the peak even though it was the very last session of the TechEd. Everybody wanted get the maximum knowledge out of this whole event. I was touched by the support from audience. They listened and participated in my session even without any kinds of technology (no ppt, no mike, no AC, nothing). During these 22 minutes, I had completed my theory verbally. Pinal Presenting session at TechEd India 2010 After a while, we got the projector back online and we continued with some exciting demos. Many thanks to Microsoft people who worked energetically in background to get the backup power for project up. I had a very interesting demo wherein I overlaid Bangalore and Hyderabad on the India Map and find their aerial distance between them. After finding the aerial distance, we browsed online and found that SQL Server estimates the exact aerial distance between these two cities, as compared to the factual distance. There was a huge applause from the crowd on the subject that SQL Server takes into the count of the curvature of the earth and finds the precise distances based on details. During the process of finding the distance, I demonstrated a few examples of the indexes where I expressed how one can use those indexes to find these distances and how they can improve the performance of similar query. I also demonstrated few examples wherein we were able to see in which data type the Index is most useful. We finished the demos with a few more internal stuff. Pinal Presenting session at TechEd India 2010 Despite all issues, I was mostly satisfied with my presentation. I think it was the best session I have ever presented at any conference. There was no help from Technology for a while, but I still got lots of appreciation at the end. When we ended the session, the applause from the audience was so loud that for a moment, the rain was not audible. I was truly moved by the dedication of the Technology enthusiasts. Pinal Dave After Presenting session at TechEd India 2010 The abstract of the session is as follows: The Microsoft SQL Server 2008 delivers new spatial data types that enable you to consume, use, and extend location-based data through spatial-enabled applications. Attend this session to learn how to use spatial functionality in next version of SQL Server to build and optimize spatial queries. This session outlines the new geography data type to store geodetic spatial data and perform operations on it, use the new geometry data type to store planar spatial data and perform operations on it, take advantage of new spatial indexes for high performance queries, use the new spatial results tab to quickly and easily view spatial query results directly from within Management Studio, extend spatial data capabilities by building or integrating location-enabled applications through support for spatial standards and specifications and much more. Time: 8:00 PM – onwards Dinner by Sponsors After the lively session during the day, there was another dinner party courtesy of one of the sponsors of TechEd. All the MVPs and several Community leaders were present at the dinner. I would like to express my gratitude to Abhishek Kant for organizing this wonderful event for us. It was a blast and really relaxing in all angles. We all stayed there for a long time and talked about our sweet and unforgettable memories of the event. Pinal Dave and Bijoy Singhal It was really one wonderful event. After writing this much, I say that I have no words to express about how much I enjoyed TechEd. However, it is true that I shared with you only 1% of the total activities I have done at the event. There were so many people I have met, yet were not mentioned here although I wanted to write their names here, too . Anyway, I have learned so many things and up until now, I am not able to get over all the fun I had in this event. Pinal Dave at TechEd India 2010 The Next Days – April 15, 2010 – till today I am still not able to get my mind out of the whole experience I had at TechEd India 2010. It was like a whole Microsoft Family working together to celebrate a happy occasion. TechEd India – Truly An Unforgettable Experience! Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: About Me, MVP, Pinal Dave, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority Author Visit, SQLAuthority News, SQLServer, T SQL, Technology Tagged: TechEd, TechEdIn

    Read the article

  • How to get ASUS UEFI BIOS EZ Mode utility on my asus laptop?

    - by Manoj Kumar
    i have asus laptop with the following specs: Manufacturer ASUSTeK Computer Inc. Model K53SC (CPU 1) Version 1.0 Chipset Vendor IntelBIOS Brand American Megatrends Inc. Version K53SC.208 Chipset Model Sandy Bridge BIOS Brand American Megatrends Inc. Version K53SC.208 Operating System MS Windows 7 Ultimate 64-bit In the BIOS setting i have enabled 'UEFI' but im not unable to see the graphical interface of UEFI.

    Read the article

  • What is the data transfer speeds within the disk, to other devices?

    - by Kumar
    I use Debian 6 on a HP Elitbook 6930 with 2Gigs of RAM. I was copying two AVI files, 1.5 GB in total, and noticed that the data copying was done at the rate of 4MB/sec. When I copy same AVIs to my Western Digital Passport 25G USB plugin drive the data transfer speed is 11+MB/sec. This speed is different if I plugin the drive to different USB ports. Interestingly, at work I also downloaded a 16MB IE8 exe on my virtual xp, run inside Oracle Sun Virtual Box, and it was downloaded AND saved within a second. We have a high speed network at work. :-) Why and how this difference in data speeds is possible?

    Read the article

  • Accidentally Removed Permissions for the XP SP3 Registry key HKEY_CLASSES_ROOT! Workaround Please!

    - by Praveen Kumar
    This is Praveen and I am using Microsoft Windows XP SP3 Build 2600. I had problems with using Microsoft Office 2010. It was keeping on saying, "Please wait while windows configures Microsoft Office Professional Plus 2010". After seeing this link: http://social.answers.microsoft.com/Forums/en-US/outlookcontact/thread/6e9c3f2e-010a-4b74-b433-0c41548ee468?prof=required I thought of giving the Registry Key: HKEY_CLASSES_ROOT, full access permissions for Everyone. I went to the registry, right-clicked on HKEY_CLASSES_ROOT and clicked on Permissions. I added Everyone and gave Full Control to the ACL and clicked on Apply. Also I checked "Replace permission entries on all child objects with entries shown here that apply to child objects." After a long time, it said with an error, cannot replace for few entries. Now, the key, HKEY_CLASSES_ROOT has no access to any user. My system is not starting up. Some of my friends asked me to try the Last Known Good Configuration. Even that did not work out. When I tried to open in the Safe Mode, I got only one driver to load and even that didn't load well. Another friend suggested me to put the Setup disk and reinstall the OS. I tried that and after completing the "Installing Device Drivers" part, when it started "Installing Network", the system is getting restarted. Now, the setup is also half way through and even if I open in Safe Mode to try System Restore, it popped up a message saying, "Setup cannot run under Safe Mode. Setup will restart now." and the system is restarting. All my official files and my software, which I developed for Registry Security, resides in my system now. I am unable to access the system and I want it to be working to submit the project, as the deadline is this week. I had no better solutions from elsewhere. Can anyone please help me out with this issue. If it is possible to open the registry editor's stored file from another system and restore the access permissions, I hope it would solve the problem. Please do help me. Thanking You, Praveen.

    Read the article

  • Problem in installing OpenOffice 3.1 on Solaris 10

    - by Sunil Kumar Sahoo
    I want OpenOffice in Solaris. So I downloaded OpenOffice from the link below. http://download.openoffice.org/other.html#tested-full My OpenOffice is in .tar.gz format so I unzipped the file using gunzip and then untar'ed the file using tar xvf command. Now I got a directory containing packages subfolder. When I cd to that directory I found too many subdirectories. I could not find a single .pkg file or .jar file or .sh file so that I can install the OpenOffice in Solaris 10. How can I install OpenOffice in Solaris 10 given the scenario above?

    Read the article

  • How to setup VIM for php development?

    - by Ashwin kumar
    I have been trying a lot (but not smartly) to figure out setting up VIM, ctags, omnicomple for PHP development. On Googling I found this file. But have no clue how to use it. What have I done until now? Here it is: I am on Fedora 17 64-bit OS Logged in as root Found my VIM version to be VIM - Vi IMproved 7.3 (2010 Aug 15, compiled May 8 2012 15:05:51) Followed the install details as here http://www.vim.org/scripts/script.php?script_id=3171 install details Place in $HOME/.vim/autoload/phpcomplete.vim and enable the php ftplugin What else I am missing? How do I start using omnicomplete. (this is the first time I am using omnicomplete) Why didn't I try IDE's? I have a single core machine running LAMP stack. Didn't wanted to slow down everything and hence sticking to command line environment.

    Read the article

  • Why does Mysql Xampp restart only when i run the mysqld.exe file manually?

    - by Ranjit Kumar
    I am using mysql-xampp v3.0.2 version. while restarting the mysql server first it show me the running status and after 2or3s it stops running automatically. So as of now i got a temporary solution like going into xampp installation folder Xampp-mysql-bin-running the msqld.exe file. i dont know whether it is the correct solution or is there any alternate solution to be made !! please suggest me errorlog 120629 15:29:59 [Note] Plugin 'FEDERATED' is disabled. 120629 15:29:59 InnoDB: The InnoDB memory heap is disabled 120629 15:29:59 InnoDB: Mutexes and rw_locks use Windows interlocked functions 120629 15:29:59 InnoDB: Compressed tables use zlib 1.2.3 120629 15:29:59 InnoDB: Initializing buffer pool, size = 16.0M 120629 15:29:59 InnoDB: Completed initialization of buffer pool InnoDB: The first specified data file D:\xampp\xampp\mysql\data\ibdata1 did not exist: InnoDB: a new database to be created! 120629 15:29:59 InnoDB: Setting file D:\xampp\xampp\mysql\data\ibdata1 size to 10 MB InnoDB: Database physically writes the file full: wait... 120629 15:29:59 InnoDB: Log file D:\xampp\xampp\mysql\data\ib_logfile0 did not exist: new to be created InnoDB: Setting log file D:\xampp\xampp\mysql\data\ib_logfile0 size to 5 MB InnoDB: Database physically writes the file full: wait... 120629 15:30:00 InnoDB: Log file D:\xampp\xampp\mysql\data\ib_logfile1 did not exist: new to be created InnoDB: Setting log file D:\xampp\xampp\mysql\data\ib_logfile1 size to 5 MB InnoDB: Database physically writes the file full: wait... InnoDB: Doublewrite buffer not found: creating new InnoDB: Doublewrite buffer created InnoDB: 127 rollback segment(s) active. InnoDB: Creating foreign key constraint system tables InnoDB: Foreign key constraint system tables created 120629 15:30:02 InnoDB: Waiting for the background threads to start

    Read the article

  • Why does limiting my virtual memory to 512MB with ulimit -v crash the JVM?

    - by Narinder Kumar
    I am trying to enforce maximum memory a program can consume on a Unix system. I thought ulimit -v should do the trick. Here is a sample Java program I have written for testing : import java.util.*; import java.io.*; public class EatMem { public static void main(String[] args) throws IOException, InterruptedException { System.out.println("Starting up..."); System.out.println("Allocating 128 MB of Memory"); List<byte[]> list = new LinkedList<byte[]>(); list.add(new byte[134217728]); //128 MB System.out.println("Done...."); } } By default, my ulimit settings are (output of ulimit -a) : core file size (blocks, -c) 0 data seg size (kbytes, -d) unlimited scheduling priority (-e) 0 file size (blocks, -f) unlimited pending signals (-i) 31398 max locked memory (kbytes, -l) 64 max memory size (kbytes, -m) unlimited open files (-n) 1024 pipe size (512 bytes, -p) 8 POSIX message queues (bytes, -q) 819200 real-time priority (-r) 0 stack size (kbytes, -s) 8192 cpu time (seconds, -t) unlimited max user processes (-u) 31398 virtual memory (kbytes, -v) unlimited file locks (-x) unlimited When I execute my java program (java EatMem), it executes without any problems. Now I try to limit max memory available to any program launched in the current shell to 512MB by launching the following command : ulimit -v 524288 ulimit -a output shows the limit to be set correctly (I suppose): core file size (blocks, -c) 0 data seg size (kbytes, -d) unlimited scheduling priority (-e) 0 file size (blocks, -f) unlimited pending signals (-i) 31398 max locked memory (kbytes, -l) 64 max memory size (kbytes, -m) unlimited open files (-n) 1024 pipe size (512 bytes, -p) 8 POSIX message queues (bytes, -q) 819200 real-time priority (-r) 0 stack size (kbytes, -s) 8192 cpu time (seconds, -t) unlimited max user processes (-u) 31398 virtual memory (kbytes, -v) 524288 file locks (-x) unlimited If I now try to execute my java program, it gives me the following error: Error occurred during initialization of VM Could not reserve enough space for object heap Could not create the Java virtual machine. Ideally it should not happen as my Java program is only taking around 128MB of memory which is well within my specified ulimit parameters. If I change the arguments to my Java program as below: java -Xmx256m EatMem The program again works fine. While trying to give more memory than limited by ulimit like : java -Xmx800m EatMem results in expected error. Why the program fails to execute in the first case after setting ulimit ? I have tried the above test on Ubuntu 11.10 and 12.0.4 with Java 1.6 and Java 7

    Read the article

  • Samba server error message in Windows XP

    - by Kumar P
    We have a RHEL5 Linux Server with few Windows XP client boxes. Using Samba server for share files between systems. My server working well in all systems but one Windows XP machine didn't connect to server. Here i give some screen shots for clear idea, For Check network connection i use ping, It working well. I use above way for connect to server. For all other systems it working well. I am getting error message like this. ** I am using squid for proxy in Linux, For me internet also working well in that Windows XP system. ** I Deleted stored user name and password for samba in windows XP. Help me to solve this problem.

    Read the article

< Previous Page | 4 5 6 7 8 9 10 11 12 13 14 15  | Next Page >